CLUSTAL format seed alignment for MF_03014

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B7PSM5_IXOSC      -------------------------MDAEYMPSVWGVRL----RGDELILDYCQKAMDNS
E4WT97_OIKDI      -MDLPTVIDKYYTQHKSQSLDDSSNLDKQYSPSQWTTRL----TPETIVGNHVETMVSAT
KFA_MOUSE         -MAFPSLS-AGQNPWRNLSSEE---LEKQYSPSRWVIHT----KPEEVVGNFVQIGSQAT
KFA_HUMAN         MMDVSGVGFPSKVPWKKMSAEE---LENQYCPSRWVVRL----GAEEALRTYSQIGIEAT
A9JTU4_XENTR      ------------------------------------------------------------
KFA_DANRE         -----------MSDWKSMSKDE---LELQYSPSRWSPRM----SADDVIRAHVSALKSGT
H3D961_TETNG      --------------------------------------M----SADDVIRAHEKALKEGT
E2BMI6_HARSA      ---------------------MLKEKEKLYTPSEWSKRY----KPEEVMEQFMKFCTEVT
E9GB07_DAPPU      ------------MEPEHWSFWDTQRLEDEYSPSKWSRRG----PADWVFDNHVKLVTQVS
B4N7M9_DROWI      -------------MSLYNQRDLNDDLNREYLPSYHSSRFQNSNHPNQAVQENFIQLTLQH
KFA_DROME         ---------------MYNPR--CKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQH
Q29PD7_DROPS      ---------------MYNPK--STDLERDYFPSYHTIRFQDQPAPNLAVQLHFLQLTKQQ
Q7QKH2_ANOGA      ----------MMEEGGPPSESTLITWEKQYSPSAWSVRF---PTPAEVIDYHVKFVKSES
Q0IFP1_AEDAE      -------MLLEIISAMTPDREQVNQWEKAYSPSEWSTRF---PTAVDVINYHVKFVTDVS
D0MQF7_PHYIT      ----------------------------------------------------------ML
D3B1N4_POLPP      ------------------------------------------------------------
F0ZRI3_DICPU      ------------------------------------------------------------
Q54R44_DICDI      ------------------------------------------------------------
F4P301_BATDJ      ------------------------------------------------------------
Q6C748_YARLI      ------------------------------------------------------------
C7Z3B4_NECH7      -------------------------------------MSTTTKTGTEDAKWQLAEVASPH
E3K2W6_PUCGT      ------------------------------------------------------------
KFA_ASHGO         ------------------------------------------------------------
KFA_YEAST         ------------------------------------------------------------
KFA_VANPO         ------------------------------------------------------------
KFA_CANAL         ------------------------------------------------------------
KFA_DEBHA         ------------------------------------------------------------
KFA_PICGU         ------------------------------------------------------------
KFA_PICST         ------------------------------------------------------------
F9FNM6_FUSOF      --------------------------------------------------MTSQLWSSTP
G0S228_CHATD      --------------------------MAQNSSSSVLLTFEADRAAWSSAAWTPLTVPDEA
F5HBR2_NEUCR      -MIINNVLWLTILSLGTVPVQAQSKQKPLSTPDRNNNNNNNNQMADYNRPSSGGWKPVLD
D5GPF4_TUBMM      ------------------------------------------------------------
C5FU24_ARTOC      ------------------------------------------------------------
C0NJF3_AJECG      ------------------------------------------------------------
Q5BDV9_EMENI      ------------------------------------------------------------
Q4WTA7_ASPFU      ------------------------------------------------------------
G4MSM5_MAGO7      ------------------------------------------------------------
G0RUY2_HYPJQ      ------------------------------------------------------------
C7YTR4_NECH7      ----------------------------------------------------------MA
                                                                              

B7PSM5_IXOSC      TITRQELPCEL--GLRY-GP-----HPRETMDVYGY---GRVPEN-AP------------
E4WT97_OIKDI      KNARSNINCET--GVKY-SD----LGPNCLLDIYKP---AEVTKG-TP------------
KFA_MOUSE         QKARATRRNQL--DVPY-GD-----GEGEKLDIYFP---DEDSKA-FP------------
KFA_HUMAN         TRARATRKSLL--HVPY-GD-----GEGEKVDIYFP---DESSEA-LP------------
A9JTU4_XENTR      ---------ML--NIQY-GE-----RESEKLDLYLP---QVPSTS-FP------------
KFA_DANRE         ERARSVTQTLM--DVPY-GE-----AEGEKLDVYLP---SSSSPD-VP------------
H3D961_TETNG      DRARSLAQTLL--NVPY-GE-----GDGEKLDVYIP---STCSLD-IN------------
E2BMI6_HARSA      EEVRESIKCEL--DVPY-GT-----TERTIYDIYGT---DLPKDA--P------------
E9GB07_DAPPU      NQVKEEIQCDL--DIPY-GK-----REGEKFDIFGA---QLLPND-AP------------
B4N7M9_DROWI      EKELTSDPGIVIQNLRY-GG----TDDRQVVDIFHL---KTTPPTGSP------------
KFA_DROME         GRELTEKQGITVDHLRY-G------EGRQLVDVFYS---EKTTNQ-AP------------
Q29PD7_DROPS      GKDLTTKQGIKVDHLRY-GG----QDDRQIVDVFYN---DSTTDS-SP------------
Q7QKH2_ANOGA      DKNREQLETLL--DVPY-GS-----GDRDKVDIYGE---NLPPDA--P------------
Q0IFP1_AEDAE      DKNRKELKCEL--DVEY-GN-----DDSEKFDIYGG---DLPENA--P------------
D0MQF7_PHYIT      RRTLPSLGAYSWKELPYVTE---CPHVLQVLDIAIP--RRIPPRAKLP------------
D3B1N4_POLPP      -----MEKTAIYYDEAY-GK----VHSSQKLDLYEPSVEEVSPDKKFP------------
F0ZRI3_DICPU      ----MSIIEKL--NISYNSN----NNEQQQLDLYYP---NDDNGKDRT------------
Q54R44_DICDI      ---MVKIIEKL--DIEYLNT----GKDGHKLDLYYQ--DNDENNENRP------------
F4P301_BATDJ      MNPSVEVVKQC--DIRYPGE----YDSARALDLYLP---SLDIAESSK--R---------
Q6C748_YARLI      ------MTTIT--KLTY-GP-----DPRQYSNVWIPKGSKAPSH----------------
C7Z3B4_NECH7      LSNPVSVYVAR--NIPC-TS--N-SNRFQNITVYAP---RAIKSL--V--GIGETITSLP
E3K2W6_PUCGT      ----MTVNHRLLDSLTYPGG----IPPYQCFDVYIP---LAAPPKLTQ------------
KFA_ASHGO         ------------------MQ-----RDYTATEVFQE---SGPD-----------------
KFA_YEAST         --MSNTVRAISPDITLF----------NKTLTFQEI---SQNTRE---------------
KFA_VANPO         ------MNDPT--DTLY-HQ-----TAIHKLAEIG----KNCKHL---------------
KFA_CANAL         ---MEDISEEQ--EFKY-GE-----HSLQKIKVFKY---SSTNAS---------------
KFA_DEBHA         -------MDDG--IVSY-GE-----HPLNRLKFFQF---DKSNDV---------------
KFA_PICGU         ------MSSSK--LLKY-GS-----DDLQTIRVYRH---DSGNHL---------------
KFA_PICST         -------MSEK--IVFY-GK-----EQLQRIRIFNY---SESNDK---------------
F9FNM6_FUSOF      WIDSGDTLHKR--RVPYIQD----ATYLHTLDIWQP---KSLGGSSLPTADVLPQGKGP-
G0S228_CHATD      APDATRILGWCKSSIPY-LPSQQRPLPLQTLDVWVP--ARNATSSTAPPEPSSLPVPSCE
F5HBR2_NEUCR      PTDNKTIIGHHWRRHDYVPG--EEALALQTLDMWIPISPAALSWGKPTPNTLLGDGAKAP
D5GPF4_TUBMM      --MTTTLKPPQ--ELPY-GS----AHPLQSLDLYHQ---NLDPNTY--------------
C5FU24_ARTOC      --MAAVESCYE--KYTY-GD-----HYLQNVYVHIP--PSPAPVESGF------------
C0NJF3_AJECG      -MTSCQGSEFHRETHRY-GQ----KNILQEISVYYPRSLPQPDPSSSV------------
Q5BDV9_EMENI      ---------MSLETFPY-GD-----HDLQTVTVAKPYPARAPLHAENIDNESGY------
Q4WTA7_ASPFU      ---------MPTETLRY-GD-----HKLQTVTISTV---SDNLNAGY-------------
G4MSM5_MAGO7      -----MAETLVYSEHKY-GQ----VHDLQTLGIWDF--PAKDGNTGTTTDGKY-------
G0RUY2_HYPJQ      MAYSADIPGLRYASHQY-GQ-----HNLQRVGVWQH---NDAPEAADSTPSY--------
C7YTR4_NECH7      ELAKDPSLGLTYTSHKY-GE-----HSRQKLGVWRF--KDRPDQETGY------------
                                                                              

B7PSM5_IXOSC      ----------ILVFFHGGYWIEGDKDMHAFVAKPFVESG---------------LAVVVA
E4WT97_OIKDI      ----------VFVFIHGGYWQECSRDVSGHAAESVTKMG---------------AIYVGI
KFA_MOUSE         ----------LFLFLHGGYWQSGSKDDSAFMVNPLTAQG---------------IVVVIV
KFA_HUMAN         ----------FFLFFHGGYWQSGSKDESAFMVHPLTAQG---------------VAVVIV
A9JTU4_XENTR      ----------LLVYIHGGYWQFLSKEESGFMVPPLVLHG---------------IGVMVM
KFA_DANRE         ----------LVIYFHGGYWQFLSKDESGFLAVPLVQKG---------------AVVVAV
H3D961_TETNG      ----------LVIYLHGGYWQFLSKEESGFMAVPLVDKG---------------VVVVAV
E2BMI6_HARSA      ----------ILVFIHGGYWQEFSKDLTGFSVPLFVKNK---------------IKVITV
E9GB07_DAPPU      ----------VFVYIHGGYWQALDRSISSYSVIPQFKAG---------------HIVVVV
B4N7M9_DROWI      ----------LFVYIHGGYWQMLEKIHSCSIVGPLLRRN---------------HRVAIM
KFA_DROME         ----------LFVFVHGGYWQEMDMSMSCSIVGPLVRRG---------------YRVAVM
Q29PD7_DROPS      ----------LFVYVHGGYWQFLDITESCSMVGPLVRRG---------------YRVAVM
Q7QKH2_ANOGA      ----------LFVYVHGGYWQMLEKETSAYPAKPLVDRG---------------VRVMIV
Q0IFP1_AEDAE      ----------LFVYVHGGYWQMLSKKESAYCAKPLVQKG---------------YRVIVL
D0MQF7_PHYIT      ----------TCVFVHGGSWQRGDKSGGLNQDIDEAFVHAG-------------CLGVSV
D3B1N4_POLPP      ----------LLVYVHGGFWMDRDKSDYVEMGRLFASHG---------------YMVAVV
F0ZRI3_DICPU      ----------LVIYIHGGFWVARDKKEYSNLGKYLAEKVN--------------VACAVI
Q54R44_DICDI      ----------LLVYVHGGFWVDRDKKGYSGLGHYFAQEMN--------------VATAII
F4P301_BATDJ      ----------PAVFVHGGAWITSKKSEFEYMGYALASRG---------------IPTVIA
Q6C748_YARLI      ----------WVIFMHGGAWVDYKQTEKDGDELMEAVVDGN-------------VWGASI
C7Z3B4_NECH7      SVASPSKGTRWLIHIHGGAWRDPFLDSSSIEAAVAHAFSSDDSDVPI-------SAIVSV
E3K2W6_PUCGT      ----------LVTYVHGGAWRAGDKADRHSVGLIGNLSSQFPT-----------AAICSV
KFA_ASHGO         ----------AIVYLHGGAWIDVRNSPRDFAELAARVREDAPL-----------ASQYAV
KFA_YEAST         ----------AVIYIHGGAWNDPENTPNDFNQLANTIKSMDTEST---------VCQYSI
KFA_VANPO         ----------GIIFIHGGAWVDPLNTSNDFKGIAGEISKVIENNNTQGFN----ISMFGI
KFA_CANAL         ----------TYIYIHGGAWRDPSNTFDEMRPVLGIPNAN----------------LIGI
KFA_DEBHA         ----------TLLLIHGGAWRDPNNTYNDFKDMISHIQKNQYAAK---------YNLIAM
KFA_PICGU         ----------SIIFIHGGAWRDPRNTFNDFEELVGKLPST--------------INTFGI
KFA_PICST         ----------TLIVLHGGGWRDPRNSYNDFEDMANYILEEKKATN---------INIIGI
F9FNM6_FUSOF      ----------WVIYIHGGAWRDPLVDSSSFEATALKLLSYKDTPI---------AGVASV
G0S228_CHATD      DQEKVLV---WIVYIHGGAWRDPTIEADSFGPAAKELLKRFTPATSRSSSKNVLAGLASL
F5HBR2_NEUCR      ----------WLIYIHGGAWRDPAIDSSSFDASATKILSDLAQQPLEQRKKTV-AGIASI
D5GPF4_TUBMM      ----------WVIFIHGGAWRDPKMTKSSGHPLICSLLSKYPH-----------LNAASI
C5FU24_ARTOC      ----------WIVYIHGGAWRDPDILAPSFKATQDNLLAGSNTEVTRSI-----AGIASI
C0NJF3_AJECG      ----------WIIYIHGGAWRDPAITSISFEPTLDALASDCDSQTLQRV-----AAFASI
Q5BDV9_EMENI      ----------WVILIHGGAWRDPTQTSTSYLAPTLSILSSSESKSPKSQSQHI-RGLASI
Q4WTA7_ASPFU      ----------WVILIHGGAWRDPTQTAASYVAPAESILTTSPTYTSTTLP-HI-AAFASI
G4MSM5_MAGO7      ----------WIVFIHGGAWRDPNVDLHSLEPTISRLLADEHRDFAAAHI----AGFASI
G0RUY2_HYPJQ      ----------WIIFVHGGGWRDPRNTLHDFVPSIKHMLAQPDLPRSAV------RGFASV
C7YTR4_NECH7      ----------WVVFIHGGGWRDPRNTEDDFAESIKRTVISGAVALEDI------KGFISI
                                .*** *                                        

B7PSM5_IXOSC      GYPLAPE----------------------STLDQIVESARHCMTCVI-KM---------S
E4WT97_OIKDI      GYDLCPS----------------------VSMAEIVSQVQAAFQFIRHRF---------P
KFA_MOUSE         AYDIAPK----------------------GTLDQMVDQVTRSVVFLQRRY---------P
KFA_HUMAN         AYGIAPK----------------------GTLDHMVDQVTRSVAFVQKRY---------P
A9JTU4_XENTR      DYDIAPQ----------------------GHMDLIVSQVRQSIAVTIQRY---------P
KFA_DANRE         GYSIAPK----------------------GDMDLMVSQVRRSVVSVIQQY---------S
H3D961_TETNG      DYDVAPK----------------------GNMDLIVSQVRRSVVSVVQQY---------S
E2BMI6_HARSA      EYDLCPN----------------------VRVSDIIVQVKSACEQIL-KY---------A
E9GB07_DAPPU      GYELAPK----------------------VGLKDIILEIQSAISAVL-KW---------A
B4N7M9_DROWI      DYNICPQ----------------------VTLEELISEFKSFLAWIF-DY---------A
KFA_DROME         DYNLCPQ----------------------VTLEQLMTQFTHFLNWIF-DY---------T
Q29PD7_DROPS      DYNLCPQ----------------------VTLEQLMLEFTNFLNWTF-AY---------A
Q7QKH2_ANOGA      GYELCPE----------------------VTLEELVRQMKAAGEFVL-NY---------A
Q0IFP1_AEDAE      DYALCPK----------------------VTLEELMKQVQRAGEYIL-NY---------A
D0MQF7_PHYIT      NYRLSPE----------------------VQHPEHAKDVAAAVTWLHQNI--------AK
D3B1N4_POLPP      NYRLSKQAHKTP-----------------IRYPVHNNDFAESLRWLVDNR--------DD
F0ZRI3_DICPU      NYRLSSDKHKETER---------------ILYPEHNYDLIESIVWLIQNNCDDK----GK
Q54R44_DICDI      NYRLSSKDINKPE----------------VLYPNHNEDLVQSLIWLIENNNKHENTGDNK
F4P301_BATDJ      GYRLSPAQGIIDPK---------------LCHPMHFEDISSAVAWVLSKEAV------VC
Q6C748_YARLI      EYRLAPE----------------------VSGKTFAEDVYNAIKSIFDKY---------P
C7Z3B4_NECH7      NYTLSPFPTHPTLP---------YDASRSARHPRHIKDVLQAFALLR------------S
E3K2W6_PUCGT      NYRLSTGKVNPESD---------------VKHPTHNADVARAIEHVKTLP---------E
KFA_ASHGO         TYRLSPE----------------------VQHPVHVADCVEHISQLIVEK---------G
KFA_YEAST         EYRLSPE----------------------ITNPRNLYDAVSNITRLVKEK---------G
KFA_VANPO         EYRLSPS----------------------VKHPIHITDVITNTYKLINEY---------K
KFA_CANAL         NYRLSPE----------------------IKHPEHLIDILRALRFVKQNF---------D
KFA_DEBHA         NYRLSPE----------------------VKHPFHLWDVLEGLQFLVQNY---------D
KFA_PICGU         NYRLSPA----------------------VKHPAHLEDVVSAIEYLAKNY---------K
KFA_PICST         DYRLSPF----------------------IKHPVHLIDVLTAFRYILENY---------K
F9FNM6_FUSOF      NYPLSNHPNHPTHPAPPRDSSEPVDIARQAKHPDHIIALLTAISFLQNDL---------G
G0S228_CHATD      NYRLSPHPNHPAPD----------RPDRNVRHPEHLRDVLTGLSFLQRVI-F------SS
F5HBR2_NEUCR      NYRLSPHPNHPSSD--------PYDPNRTAKHPDHVADVLTALGFLKNYF---------G
D5GPF4_TUBMM      NYRLSPHPCYPSNGN-----V--------ARHPNHIDDVRLALSFLQERY---------S
C5FU24_ARTOC      DYRLSPHPNFPQDAG-----SVDAREYRNAKRPEHITDVQKALALLQEKY---------A
C0NJF3_AJECG      DYRLSAHPNFPQDPT-----TTEPTDLRCAIHPDHLNDVRNAIAYLQNKF---------E
Q5BDV9_EMENI      SYRLSPHPSHSQDAS-----TTMESHLRNAKHPEHINDIQLALSFLQRKY---------R
Q4WTA7_ASPFU      EYRLSAHPSYPQNPD-----HLDSTEYRNAKHPDHIRDVQAALALLQRKY---------G
G4MSM5_MAGO7      NYRLSPHANFPQDPA-----ATPANELRAAQHPEHIQDAVAAMTLLHTLR---------P
G0RUY2_HYPJQ      DYRLSPHPQFPQDPA-----STPANELRQALHPQHVQDVLAALRLLDAEY---------G
C7YTR4_NECH7      DYRLSPHPEFPHDSA-------NKTEARDAKHPDHLEDIWSALNFLQGKY---------K
                   * :.                                                       

B7PSM5_IXOSC      KQKNSAGIIVSGHSAGAHLAAMVL----------SSQSWTSRSEN---------------
E4WT97_OIKDI      YT---VGIHIMGHSAGAHLATMIL-----------AQNSHDFP-----------------
KFA_MOUSE         SN---EGIYLCGHSAGAHLAAMVL-----------LARWTKHGV----------------
KFA_HUMAN         SN---KGIYLCGHSAGAHLAAMML-----------LADWTKHGV----------------
A9JTU4_XENTR      QI---TGIYLCGHSAGAHLVAMTL-----------CTKWSEYMV----------------
KFA_DANRE         HI---SGLYLCGHSAGAHLAAMVL-----------STDWTQYDV----------------
H3D961_TETNG      HI---SGLYLCGHSAGAHLAAMVL-----------STDWSQYSV----------------
E2BMI6_HARSA      ADNGCKSVLISGHSAGAHLAASLL----------HDVEWMKRMEQQGY------------
E9GB07_DAPPU      AERGSRSVVIAGHSAGSHLASMLL----------HDPQWQKSEPH---------------
B4N7M9_DROWI      EKTQTSEIHFAGHSAGAHLLAILL----------NVPHITTPER----------------
KFA_DROME         EMTKVSSLTFAGHSAGAHLLAQIL----------MRPNVITAQR----------------
Q29PD7_DROPS      EKIKTTEIHFAGHSAGGHMLAQIL----------NAPEVVTPER----------------
Q7QKH2_ANOGA      TENGVRHISIAGHSAGAHLIASML----------DRPFMDAVGEE---------------
Q0IFP1_AEDAE      VENHVKHVSFAGHSAGAHLLAAML----------DRNFVATVGDE---------------
D0MQF7_PHYIT      FGGDPNKLVLVGHSAGAHLIMQIL----------ADPQYLRAAGMEQPV-----------
D3B1N4_POLPP      YRYDVNNITLIGHSCGGHMIACLS----------MQPNQYASLAEIQG------------
F0ZRI3_DICPU      EMYSNSKIVLMGHSCGGHMISTVA------------LNWDLYIDQMIKDNKNRFKQFNET
Q54R44_DICDI      PIYSNKKIVLMGHSVGGHMITLV------------GLEWEKYIDQLKLDTCKKSY-----
F4P301_BATDJ      LGFTPAYIVLIGHSAGAHLTGLLA----------LKSINCATPTKTRLDQ----------
Q6C748_YARLI      AA----PWTMIGHSAGAFHSLKL------------DTDVKEKGG----------------
C7Z3B4_NECH7      LGLKDDSYLLSGHSAGACLAFQAA--------LFGAQHWGPEFERIPS------------
E3K2W6_PUCGT      LK-DIDETYLIGHSVGAFICLSLA-------GILEPPSPEAPRLAPST------------
KFA_ASHGO         IR----KLHLLGHSVGATLCWQILTALPGDRRYPEGPDFAMKLALV--------------
KFA_YEAST         LT----NINMVGHSVGATFIWQIL-------AALKDPQEKMSEAQLQMLGL---------
KFA_VANPO         ID----ILYIVGHSVGATLGLQLA--------TDNRDYLIKYSSQLHLI-----------
KFA_CANAL         VS----QITLLGHSVGATMILQLL----HYRQIIRDGLKHTHKDDLSSLDNLFAYVND--
KFA_DEBHA         IH----KISIAGHSVGATLMLQLL----DYNKILDTGFQILVEDSKADKNRTETDLHVPS
KFA_PICGU         VE----NVGLVGHSVGATLALQIL----------NYKTILPGLERPL-------------
KFA_PICST         TG----QLSIVGHSVGATLLLEIL----NYVEIIQTGLEQLETSEPSIEELQTLFDFIS-
F9FNM6_FUSOF      VA---HDYVLSGHSCGATMTFQTV---------MNPGHWLGTAKGISVPE----------
G0S228_CHATD      TPTENIEFILTGHSCGATLSFQSI----------MSPLTRFSLPPNLSL-----------
F5HBR2_NEUCR      MK----EYVLAGHSCGATLALQAC---------MSPERWGLAGTAEWRAGWYN-------
D5GPF4_TUBMM      MK--REKSVLVGHSAGAYMAFQID----------AGC-----------------------
C5FU24_ARTOC      FG---ERYVLIGHSCGGTMSFQVV-----------MDRVLRAEE----------------
C0NJF3_AJECG      FG---ERYILVGHSCGATLAFQTV----------MGSVLNAESKRSEATEMN--------
Q5BDV9_EMENI      FG---KRYILVGHSCGATLAFQAV----------MASLSVQGREGLVND-----------
Q4WTA7_ASPFU      FG---SKYILVGHSAGATLAFQSV----------MGTFRDSAAAV---------------
G4MSM5_MAGO7      LDRNRGGYVLTGHSCGATMSYQLL----------MGAQAGVPSPSALP------------
G0RUY2_HYPJQ      IG---GNYVLIGHSVGGTLVHQVI----------MNNDASRAWGPA--------------
C7YTR4_NECH7      LA---EDYILVGHSAGATLAFQLL----------MGDDVLASHAQ---------------
                           . *** *.                                           

B7PSM5_IXOSC      ------------LACIKGAVLFSSVLDVKPLLST------------SVAK-DAAITVDQ-
E4WT97_OIKDI      ------------TLLPVTIYAVSGVFDLRPLIET--------------SV-NNALKMTTE
KFA_MOUSE         ------------TPNLQGFLLVSGIYDLEPLIAT--------------SQ-NDPLRMTLE
KFA_HUMAN         ------------TPNLRGFFLVSGVFDLEPIVYT--------------SQ-NVALQLTLE
A9JTU4_XENTR      ------------KPDIKGAVLVSGVYDLLPIIHT--------------YV-NDALKMSQT
KFA_DANRE         ------------SPKIKGAFLVSGIYDLQPILST--------------YV-NEPLKMTEE
H3D961_TETNG      ------------QPQIKGALLVSGIYDLLPILST--------------CV-NDPLKMTEE
E2BMI6_HARSA      ------------LALLKGIVLIAGLYDIRPIVDV--------------SH-SAVLNFTDE
E9GB07_DAPPU      ------------LDLLHGMVHISGVFDVIPLVAT--------------SM-NLPLNLDNE
B4N7M9_DROWI      ------------RLKVKRLFFICGVYDLRELWPL-----------TEVNP-NNILGLNAT
KFA_DROME         ------------SKMVWALIFLCGVYDLRELSNL-----------ESVNP-KNILGLNER
Q29PD7_DROPS      ------------RMNIRSLIFICGVYDLRELWSL-----------ENVNP-NNILGLNAE
Q7QKH2_ANOGA      ------------LALLKDVYLISGVYNVQELRYT-----------KSVNK-DNLLGINDA
Q0IFP1_AEDAE      ------------IHLIKHVYLISGVFRLDELRFT-----------KAVNE-NNLLSLNDK
D0MQF7_PHYIT      ------------DTFVKGAVGISGVYNIVRLANT---------SFYGTLVTNPPFGERVE
D3B1N4_POLPP      ------------QYKITRCIGIQGIYDMQQLNTD-----FPD---YKENI-SFVFNNDDV
F0ZRI3_DICPU      YKQL--------KTSIKGCIGIQGLYDFVALHED-----FPN---YLEDI-KIVFNDD--
Q54R44_DICDI      ------------KQSLIGFIGIQGLYNLKALYED-----FPN---YKPDI-TLGFGTDDP
F4P301_BATDJ      ------------TASIRGVIGIEGIYSLSDLAKT-----FPT---YVPWFIERAFMRDPL
Q6C748_YARLI      ------------FASPTNIILSEGIYDLRTLVDD-----HPT---YSYFT-NPAWGEDKA
C7Z3B4_NECH7      ------------PPRPAAVLGLNGLYDIPDLVSGLGDSHKHLQEVYEILL-VQAFGEDQT
E3K2W6_PUCGT      ------------CKNIRGLILLDGIYDLVKLLEE-----YPS---YNDFV-AGAFQEKDI
KFA_ASHGO         ------------RSSLAHVFLVDGIYSLRALLEE-----YPD---YDYFV-NKAFKSLKD
KFA_YEAST         ------------LQIVKRVFLLDGIYSLKELLVE-----YPE---YDCFT-RLAFPDGIQ
KFA_VANPO         ------------RSTIQGLFLLDGIYSLQELLKE-----YPT---YDSFI-SKAFTNYEL
KFA_CANAL         ------------NVLLSQVIFLDGIYDVVELLKE-----YPD---YASFV-DDAFVSNKH
KFA_DEBHA         KKERILMNEAMEKLQLRTFCFIDGIYDITQLISE-----YGCP--YESFV-NNAFSSPEQ
KFA_PICGU         ------------GIKMKFLVFLDGIYDVPKLVEE-----YPT---YSSFV-NEAFKTKQD
KFA_PICST         -----------KNLTFKTMYFLDGIYDVRALLEE-----YPS---YDFFV-KSAFVSTVA
F9FNM6_FUSOF      ------------VKKPRVIAPLNGLYDLAAFINNPPESHKQLQQLYTDFT-KNAFGDDEA
G0S228_CHATD      ------------CKKPMAIVGFNGLYDLAGFIHKPPKGWEGHVPPYEEFT-RGAFGDDER
F5HBR2_NEUCR      ------------VAKPKAVVGFNGLYDLAGFIADPPKGYERWKEAYREFV-VGAFGKKEE
D5GPF4_TUBMM      ------------GAAAAAVVGVEGVYHLGKLVEE-----YAD---YEEFV-GGAFGEG--
C5FU24_ARTOC      ------------VVRPVAIVCVAGVTHMPLLVET-----MAHVPAYREFI-ADAFGGEDT
C0NJF3_AJECG      ------------IELPIAIVGVAGIYDLRSLRDT-----FKDIVIYQEFI-KAAFGSDEK
Q5BDV9_EMENI      ------------YIAPLAILGMAGIYNLRLLRDS-----HRDISAYQEFI-EGAFGKDEK
Q4WTA7_ASPFU      ------------ASPPVAILGMAGIYDLRLLRDT-----HRDISAYQEFI-EGAFGSDEA
G4MSM5_MAGO7      ------------FPLPAAVVGFEGIYDLNGLDRR-----KDGN--YTGFM-AAAFGDDRA
G0RUY2_HYPJQ      ------------APLPAALVSISGIHDLRGLAER-----HGGV--YETFI-ADAFGPDRQ
C7YTR4_NECH7      ------------APLPIAIIGVSGIFDLVGLNER-----FGGN--YAGFI-SSAFGEDQT
                                         .:  .  :                             

B7PSM5_IXOSC      -----AEINSPLEVVNLFPR------------------DVFVQLVLAEHDPPPFH-RQTK
E4WT97_OIKDI      D----AEEMSPMDPKNFKKIYANSRQ------------STRFIICIAENDSPAFH-DQSV
KFA_MOUSE         D----AQRNSPQRHLDVVPAQPVAP-------------ACPVLVLVGQHDSPEFH-RQSK
KFA_HUMAN         D----AQRNSPQLKVAQAQPVDP---------------TCRVLVVVGQFDSPEFH-RQSW
A9JTU4_XENTR      D----AERNSPMRCLTQMESHIR---------------TCQIAIVVAEHDSPEFH-RQSQ
KFA_DANRE         V----ALRNSPSRFLSQLKVSSA---------------SCDITVAVAQNDSPEFR-KQSE
H3D961_TETNG      V----ALRNSPSELVSQLQLSSS---------------GCHIIMAVAENDSPEFH-KQSE
E2BMI6_HARSA      E----VKRISWFLCDEPKERIH----------------GLKVIVTIGDCDSPAFI-DDSC
E9GB07_DAPPU      T----AKLMSPLHCFNQSMEKVL---------------NIKQLLVVGENDPTEFK-RQTS
B4N7M9_DROWI      N----SRALSPMLWNY--PEVSVWQAG-----------DTHLYVLTAQHESVTFI-EQSR
KFA_DROME         N----IESVSPMLWEY--TDVTVWN-------------STKIYVVAAEHDSTTFI-EQSR
Q29PD7_DROPS      K----AAALSPILWKY--PDAKSWS-------------SIKFHVMAAEHESLTFI-EQSR
Q7QKH2_ANOGA      N----AKSLSPLYASYEHLRPIVEQQ---------QGGALRFHVYVAEHDSDVFR-EMAV
Q0IFP1_AEDAE      N----VANLSPLNGDYRHLSSC----------------GMKFHVYVAENDSAVFK-QMSV
D0MQF7_PHYIT      Q----WREASIGMTATRVGATSPL--------------TKLPLLLINAQEDFHFQ-EDAQ
D3B1N4_POLPP      EQ---WESPQRFTPIDDNNKNSVS--------------AIKWLLVHSPADKLVNS-VQTK
F0ZRI3_DICPU      -----WFDTTNIKETTLDRSNTSW------------------LIIHSPEDTWVNR-RQSV
Q54R44_DICDI      NR---WYDTVSVNEIINNSNNNNID----------YTTTQSWMIVHSPDDPWVNN-RQAI
F4P301_BATDJ      L----WDKASPKEVAISMLSEKSHIA---------DVTLPRYLLIHSPEDELVNM-EQTN
Q6C748_YARLI      K----WDEESPLLHHQACP-------------------KINYTIVHSDIDELVPFDGQPQ
C7Z3B4_NECH7      A----WPAASPARFDAKTLIGRVEE----------GRVARLVLLDQSPEDQLVPI-SQAD
E3K2W6_PUCGT      DRLTYLEDVSPLSWSSSTVNPTTCP---------------RILILHSRQDSLLTI-RQSE
KFA_ASHGO         -----FEDPSESAERISA--------------------GPILHVIHSYKDELLTL-KQTQ
KFA_YEAST         M----YEEEPSRVMPYVKKALSRF--------------SIDMHLVHSYSDELLTL-RQTN
KFA_VANPO         E----FQDPKEYLDKEQQFIK-----------------NLSFYIIHSFQDELLTL-RQTD
KFA_CANAL         F----ADSTQLSSANESLDLPFSLVSK-----------DTKFLIYQSLEDDLLSM-KQTH
KFA_DEBHA         Y----AEATQLSSSTVDVGSPFSYNT-----HSANVRNELNLVILQSNKDELLSM-RQTN
KFA_PICGU         -----YMRATPVSSEMPQFDISVE--------------KCVILLVQSTEDELLSV-QQTE
KFA_PICST         -----IEEASQLSWKQHNEAFKIA--------------VDKYEILHSLEDELLSL-NQPK
F9FNM6_FUSOF      V----WKAACPTSVAD---WSTEWPE------------GKAVVIAQSKGDGLVPY-AQTE
G0S228_CHATD      V----WRAVCPASAEG--DWLGEWLE---------EKKGAKVVLGISKQDSLVPR-EQMV
F5HBR2_NEUCR      D----WKKVCPGSIAE--GWVREWNLTQQQQQGEEWKKR-KVVLVQSLEDSLVPV-EQTE
D5GPF4_TUBMM      -----WKGVDEEVLVEVEDGRDG---------------GGRVVLVHSSQDGLLSF-GQSK
C5FU24_ARTOC      -----WRLASPAMDVTAGGVVDSWKN------------GRLAVVARSVNDEALPG-NQLA
C0NJF3_AJECG      L----WDGVSPARVEGQTSIENWWAN------------GRLAVLAHSEADELIDV-GQLR
Q5BDV9_EMENI      V----WDAASPGVVRGVNGVE-GWKE------------GRLVVLAHSKEDELCDM-EQSE
Q4WTA7_ASPFU      V----WDAASPAFVKGSQGVEGGWTS------------GRLAVLAHSAEDGLVDA-AQQK
G4MSM5_MAGO7      A----WDLVSPALFRG---YADAWS----------GVPKHLAVVAHSPEDSLVDM-DEAI
G0RUY2_HYPJQ      V----WDAASPAKFAG--NFKSLWPNE-----------PRLVILASSAEDTLIDV-AELD
C7YTR4_NECH7      A----WNKASPARFSS--SFKDRWTG------------GKLTVLAWSPEDTLIDG-PEID
                                                             :     :          

B7PSM5_IXOSC      RYMEALRD---------RGIKCELV-VYNDEDHFSFFPRLMDKEDEVTSQIIKNVLRETG
E4WT97_OIKDI      RFYEMLSA---------TGVQCDFI-EFENTDHFNIVEKSTDPNYLMNDVIKNQLSSLST
KFA_MOUSE         EFYETLLR---------VGWKASFQ-QLRGVDHFDIIENLTREDDVLTQIILKTVFQKL-
KFA_HUMAN         EFYQTLCQ---------GEWKASFE-ELHDVDHFEIVENLTQKDNVLTQIILKTIFQ---
A9JTU4_XENTR      EYFQSLQA---------VGFSVTFT-QIDGTDHFDVIEQLHDEKYVLTQMILEMIKKKQS
KFA_DANRE         EYYKALES---------AGLKVSFE-DVSETDHFSIIEQLVDENYLLTKLLLKMIGKS--
H3D961_TETNG      EYYKLLEA---------SGLNVSME-NVANTDHFNIIEQLVDGDYHLTKLLLKMMGKS--
E2BMI6_HARSA      RYIQKIIS---------MVNNVEFH-LLRDIDHFDIVEKLLDPDYVLAKSMLHCLQSGTN
E9GB07_DAPPU      TYAQALLR---------AGFTDVHCKMMDSLDHFNIVEELRNEDYELTRLIVKLIS----
B4N7M9_DROWI      SFSECLNK---------AGFSVTFK-MFDNYDHFDIIEETAKDDSNISIYLQHALL----
KFA_DROME         HYADVLRK---------KGYKASFT-LFKGYDHFDIIEETAIDDSD-VSRFLRNIEIE--
Q29PD7_DROPS      VFGQVLEK---------AGFPTSFK-VIQGYDHFDIIEETAIDDSI-IAKNLQEILKL--
Q7QKH2_ANOGA      KMSELLRS---------YGMRCDLS-VLPGLDHFDIVEKLASADHTITAAILAGVAATGE
Q0IFP1_AEDAE      DMHERLKN---------AGIATSLH-ILSDLDHFDIVEKLSESSYTITEEIINNLKS---
D0MQF7_PHYIT      ELERWLTA---------AGNTSIQRHSIPNCNHFTIVEHLANNDPD-SNPTMQLIKAFVA
D3B1N4_POLPP      NFEQRLQS--------TWNSKVEIL-DSFEATHFEVVIKLGDVEHKSLETVRESILKFLL
F0ZRI3_DICPU      NAVNHLRN--------VLKFDKVQLEENVKGPHFEVVTNFGNLSVIDADNTREIVKNYLN
Q54R44_DICDI      DCVNHLKD--------KLSFKNVILEQDLNGAHFEVIDNLGNKLQPSADKFRQIIKNFFS
F4P301_BATDJ      DYAAALQS---------INVDVEVC-INISGSHDDILKNPELHDRL--AKFISSLEF---
Q6C748_YARLI      LLAKKWKQ---------QGVPFDFE-VIRGLKHNDVFISSEFAKIA--NEIIQKSS----
C7Z3B4_NECH7      KMERSLKE--------VQGIKVVRG-RRCQSRHAAPWEEGYMIWQS-VLDVLGMLDSEG-
E3K2W6_PUCGT      LAAIILES------KLSLGNKLESDFESVSGDHDDLLLSPELASRI-KSFIAGSK-----
KFA_ASHGO         YLTAVLTA---------HQIPYKLY-VDDLGLHEDVYRNEKVAAYI-VAQLP--------
KFA_YEAST         CLISCLQD---------YQLSFKLY-LDDLGLHNDVYKNGKVAKYI-FDNIC--------
KFA_VANPO         YLVELLKA---------KEISFNLS-ISDYGRHNDVYINDRVAKLI-IFNILSNIN----
KFA_CANAL         LLIDYLSS---------KNQGFTLH-VGNWGKHEEIFGKYREIVFSGNVP----------
KFA_DEBHA         LFIEYLTQ---------KNLNFKPF-VGEWGGHEHVYRHEDVANIV-LDSI---------
KFA_PICGU         LMADFLQA---------KSIPFEKH-LGAFGAHEQVYRHHKVAKLI-TDAIGANLDGLVR
KFA_PICST         LFAKYLQD---------RKIECSFR-TGNWGEHEQVYRSQAVSEHV-LQNM---------
F9FNM6_FUSOF      LMKDHLRK----------TSTLEVVEMKASGDHNDLWKQADEIVDI-IKCAIGYLTKL--
G0S228_CHATD      VMRECLER----EKEKGRGVEVRVV-EGDWGDHDEVWQSGWGMAGV-LGDVVEEL-----
F5HBR2_NEUCR      GMAEYLERENQKVADEDKKVEVVVLREEKGGDHDEVWKKGERLGEILLGVLNGEI-----
D5GPF4_TUBMM      YWAGVLRG---------RGRVVREV-YDVVGNHNEVL-EGAELVEV-VEEELKGLEVEAG
C5FU24_ARTOC      PMKEALAP-WAAAAEAGKERRVKII-EDMVDTHDGMWTSGKEVAAV-ISTAIKELQDMKL
C0NJF3_AJECG      TMAKVIGK-WRTAGTRGLPRNLLLL-DDLKHGHDEIWSKGDELAQV-IAKTVFELQRLEK
Q5BDV9_EMENI      KMKEFLDG-WKGNDQ----KRLVQF-LDIKGRHDEVWENGEELARG-ILFTIEELQSLRE
Q4WTA7_ASPFU      AMQAALSR-WEDNTPQGSGQRRVEM-LSLKDDHDDAWMKGDELARA-IAHTLAELQKQ--
G4MSM5_MAGO7      VMDQALRE---------SGVPALLF-KDLTGDHDVVRQEGVHTARV-LVKTIETLQS---
G0RUY2_HYPJQ      IMEAKLVK---------DGITPIAI-RDLRLEHDSIWEDGTQVAAL-AAKAVAKLRQQ--
C7YTR4_NECH7      NMAALLTK---------QGIDVQVL-KDLRGEHDFIWQDGSQIARL-IITALHQLRRL--
                                                  *                           

B7PSM5_IXOSC      TA----------
E4WT97_OIKDI      K-----------
KFA_MOUSE         ------------
KFA_HUMAN         ------------
A9JTU4_XENTR      ------------
KFA_DANRE         ------------
H3D961_TETNG      ------------
E2BMI6_HARSA      TR----------
E9GB07_DAPPU      ------------
B4N7M9_DROWI      ------------
KFA_DROME         ------------
Q29PD7_DROPS      ------------
Q7QKH2_ANOGA      KS----------
Q0IFP1_AEDAE      ------------
D0MQF7_PHYIT      EVADPGEIAPLL
D3B1N4_POLPP      ------------
F0ZRI3_DICPU      KI----------
Q54R44_DICDI      NYIFNK------
F4P301_BATDJ      ------------
Q6C748_YARLI      ------------
C7Z3B4_NECH7      ------------
E3K2W6_PUCGT      ------------
KFA_ASHGO         ------------
KFA_YEAST         ------------
KFA_VANPO         ------------
KFA_CANAL         ------------
KFA_DEBHA         ------------
KFA_PICGU         ARPQN-------
KFA_PICST         ------------
F9FNM6_FUSOF      ------------
G0S228_CHATD      ------------
F5HBR2_NEUCR      ------------
D5GPF4_TUBMM      KGN---------
C5FU24_ARTOC      ------------
C0NJF3_AJECG      S-----------
Q5BDV9_EMENI      ------------
Q4WTA7_ASPFU      ------------
G4MSM5_MAGO7      ------------
G0RUY2_HYPJQ      ------------
C7YTR4_NECH7      ------------