CLUSTAL format seed alignment for MF_03015

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RSSA_ECHGR       -----MSGGIEALELKEDDIRLMVAAKVHLGSTNANYQMQQYVYDRND-EGNHIIHLNKT
RSSA_SCHJA       -----MSGGYPALELSAEDLRLMLAAHVHVGETNMNFQMSTYVHGRTK-DNFHIIKLDKT
RSSA_AEDAE       -----MSGNLDILALKDDDVTKMLAATTHVGSTSVNFQMESYVYKRRP-DGVHIINLGRT
RSSA_CULQU       -----MSGNLDILALKDDDVNKMLAATTHVGSTSVNFQMESYVFKRRP-DGVHIINLGRT
RSSA_ANOGA       -----MSGNLDVLSLKEDDVTKMLAATTHIGSTSVNFQMEQYVYKRRT-DGVHIINLGRT
RSSA_DROSE       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNILNLGKT
RSSA_DROSI       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNILNLGKT
RSSA_DROTE       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNILNLGKT
RSSA_DROYA       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNILNLGKT
RSSA_DROER       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNILNLGKT
RSSA_DROAN       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNIINLGKT
RSSA_DROPE       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNIINLGKT
RSSA_DROPS       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNIINLGKT
RSSA_DROWI       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRA-DGVNIINLGKT
RSSA_DROMO       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVFKRRA-DGVNIINLGKT
RSSA_DROVI       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVFKRRA-DGVNIINLGKT
RSSA_DROGR       -----MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVFKRRA-DGVNIINLGKT
RSSA_DIACI       -----MSGGLDILSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRN-DGVHILNLRRT
RSSA_MACHI       -----MSGGLEILKLTEGDITKMLSANTHLGAENTNFQMEQYIYKRRS-DGINIFNLRKT
RSSA_BOMMO       -----MSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRA-DGTHVINLRRT
RSSA_URECA       -----MSGSIDTLALKEEDVTKFLACASHLGANNVDFQMEQYVYKRRP-DGTSIINVRKT
RSSA_PINFU       -----MSGGLDVLALKEEDITKFLACSTHLGATNVDFQMEQYVYKRKP-DGVYIINLRRT
RSSA_TRIGR       -----MSGGLDCLALKEDDVQKFLASGAHIGSSNLDYQMTQYVYKRKP-DGTYIINLRRT
RSSA_ORNPR       -----MSGGLSVLGLKDDDVRRFLTAKTHIGTAQLDFQMQQYCFKRRS-DGVYLIDLKKT
RSSA_NEMVE       -----MSGGLDILQLKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKS-DGVNIINVKKT
RSSA_SUBDO       -----MSGGLEVLSMKEDDVTKLLAAGTHLGDSNVDIQMAQYVFKTKG-DGVPIINVRKT
RSSA_TRIAD       -----MSGGLDILRLTADDVSKMLAASAHLGTTNVDYQMEQYVFRRRT-DGVHIIDLRQT
RSSA_HYDVD       -----MSEGIDALSLKEEDVVKFLAAGVHLGSTNVGSSCQGYVFKRKS-DGIHIINLRKT
RSSA_CAEEL       -----MSGGAAHSALTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRF-DGPNIINVKKT
RSSA_CAEBR       -----MSSGAAHSALTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRF-DGPNIINVKKT
RSSA_BRUMA       -----MSAGLETFALKEEDAIKLLACQTHVGAANCDFQMEQYVWKRRA-DGIHIIHLRKT
RSSA_LEIIN       --MTAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRTA-EGSHIIDLHMM
RSSA_LEIMA       --MSAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRTA-EGSHIIDVHMM
RSSA_LEIBR       --MTAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGRTA-EGSHIIDVHML
RSSA_MONBE       -----MSEGFDILKPTEADIQKLLMAKVHLGASNCTTAMSKYVYKRRS-DGVNVIDLNKT
RSSA1_YEAST      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA1_YEAS7      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA1_YEAS1      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA2_YEAST      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA2_YEAS1      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA2_YEAS7      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA_CANGA       ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARP-DGVHVINVGKT
RSSA_ZYGRC       ------MSLPATFDLTTEDAQLLLAANTHLGARNVQVHQEPYVFKTRP-DGVNVVDVGKT
RSSA1_VANPO      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNTRP-DGVNVINVGKT
RSSA2_VANPO      ------MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNTRP-DGVNVINVGKT
RSSA_KLULA       ------MSLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARP-DGVNVINVGKT
RSSA_ASHGO       ------MSLPATFDLTPEDAQLLLAANVHLGSKNVQVHQEPYLYKTRP-DGVNIIHIGKT
RSSA_LACTC       ------MSLPATFDLTPEDAQLLLAANVHLGSKNVQVHQEPYVFKTRP-DGVNVVNVGKT
RSSA_KOMPG       ------MSLPASFDLTAEDAKLLLAANVHLGAKNCQVHNEPYVYKTRP-DGVNVINIGKT
RSSA_CANAL       ------MSLPASFDLTPEDAKLLLAANVHLGAKNVQVHNKPYVYKTRP-DGMNIINIGKT
RSSA_CANAW       ------MSLPASFDLTPEDAKLLLAANVHLGAKNVQVHNKPYVYKTRP-DGMNIINIGKT
RSSA_CANDC       ------MSLPASFDLTPEDAKLLLAANVHLGAKNVQVHNKPYVYKTRP-DGMNIINIGKT
RSSA_CANTR       ------MSLPASFDLTPEDAKLLLAGNVHLGSKNVQVHNKPYVYKTRP-DGVNIINIGKT
RSSA_LODEL       ------MSLPASFDLTPEDAKLLLAANVHLGSKNVQVHNKPYVYKTRP-DGVNIINIGKT
RSSA_DEBHA       ------MSLPGSFDLTPEDAKLLLAANVHLGSKNVQVHNKPYVYKTRP-DGVNVINVGKT
RSSA_PICST       ------MSLPASFDLTPEDAKLLLAANVHLGSKNVQVHNKPYVYKTRP-DGVNVINIGKT
RSSA_PICGU       ------MSLPASFDLTAEDAKLLLAANVHLGSKNVIVHNKPYVYKTRP-DGVNVINIGKT
RSSA_CLAL4       ------MSLPESFALTAEDAKLLLAANVHLGSKNVQVHNEPYVYKTRP-DGVNVINIAKT
RSSA_NEUCR       ---MAPANLPSIFNATSTDIEQLLAAQCHIGSKNLGVHMQPYLWKTRA-DGVNILNVGKT
RSSA_PODAN       ---MAPANLPSIFNATSQDIEQLLAAQCHIGSKNLGVHAQPYLWKTRA-DGVNIINIGKT
RSSA_CHAGB       ---MAPANLPSIFNATSTDIEQLLAAQCHVGSKNLGVNMQPYLWKTRA-DGVNVINIGKT
RSSA_MAGO7       ---MAPANLPSVFNATSQDIEMLLAAQSHIGSKNLQVHMAPYLWKTRQ-DGVNVINVGKT
RSSA_NECH7       ---MAPSNLPSVFNATSQDIEMLLAAQCHLGSKNLQVHMENYLWKTRA-DGVNVLNVGKT
RSSA_ASPFC       ---MAPSQLPPIFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_ASPFU       ---MAPSQLPPIFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_NEOFI       ---MAPSQLPPMFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_ASPCL       ---MAPSQLPPMFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_ASPTN       ---MAPSQLPPMFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_ASPOR       ---MAPSQLPPIFNPTQQDIEQLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_ASPFN       ---MAPSQLPPIFNPTQQDIEQLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINIGKT
RSSA_ASPNC       ---MAPSQLPPIFNPTSQDIEMLLAAQCHLGSKNLQSHMEPYLWKTRP-DGVNVINIGKT
RSSA_EMENI       ---MAPSQLPPIFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGVNVINVGKT
RSSA_PENRW       ---MAPSQLPPVFNPTAQDIEMLLAAQCHLGSKNLQVHMEPYLWKLRA-DGVNVLNIGKT
RSSA_TALMQ       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_TALSN       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_COCIM       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_COCP7       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_UNCRE       ---MAPSNLPPVFNATSQDMEMLLAAQCHLGSKNLQVHMDPYLWKTRP-DGINVINIGKT
RSSA_AJEDR       ---MAPSNLPPIFNATSQDIEMLLAAQCHLGSKNLQVHMDPYLWKTRP-DGINVINIGKT
RSSA_BLAGS       ---MAPSNLPPIFNATSQDIEMLLAAQCHLGSKNLQVHMDPYLWKTRP-DGINVINIGKT
RSSA_AJECG       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_PARBD       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_PARBP       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_PARBA       ---MAPSNLPPVFNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_ARTOC       ---MAPSNLPPIFNATSQDMEMMLTAQCHLGSKNMQTHMEPYLWKTRP-DGVNVINIGKT
RSSA_BOTFB       ---MAPSQLPAIFNPTSQDIEQLLAAQCHLGAKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_SCLS1       ---MAPSQLPAIFNPTSQDIEQLLAAQCHLGSKNLQVHMEPYLWKTRP-DGINVINIGKT
RSSA_PHANO       ---MAPSNLPAIFNPSQQDIEMLLAAQCHLGAKNLQVHMEPYLWKTRP-DGVNVINVGKT
RSSA_PYRTR       ---MAPSNLPAIFNPTQQDIEMLLAAQCHLGAKNLQVHMEPYLWKTRP-DGVNVLNIGKT
RSSA_YARLI       -------MSAPIFDPTPEDIQNLLAAQTHIGSKNVQVQNIPYVFKQRA-DGVNIINVGKT
RSSA_PNECA       --------MGILDAQPAADIEMLISANCHIGSRNCELRMEPYVFKRRA-DGVHIINLGKR
RSSA1_SCHPO      ---MAQVGRPNILNATDEDIKQLLAANCHIGSKNLEVRMDNYVWKRRS-DGVHILNLGKT
RSSA1_SCHJY      ---MAQAGRPSILNATDDDIKQLLAASCHIGSKNLDVRMENYVWKRRS-DGVHIINIGKT
RSSA2_SCHPO      --MAESIARPSVLNATDDDIKNLLAADSHIGSKNLEVRMENYVWKRRS-DGIHIINLGKT
RSSA2_SCHJY      --MAESVAHPSVLNATEEDIKQLLAASCHIGSKNLDVRMENYVWKRRA-DGVNIINIGKT
RSSA3_SCHJY      --MAESVAHPSVLNATEEDIKQLLAASCHIGSKNLEIRMENYVWKRRA-DGVNIINIGKT
RSSA_COPC7       ----MTSKLPSILSATEEDIQLLLAAQCHIGTKNCDKQMEPYVWKRRA-DGIHILNIGKT
RSSA_POSPM       ----MSSKLPSVLSATDEEIQLLLAAQAHIGSKNCDKQMLPYVWKRRA-DGIHILNIGKT
RSSA_LACBS       ----MASKLPSVLAATEEEIQLLLAAQCHIGTKNCDKQMEPYVWKRRA-DGIHILNIGKT
RSSA_MALGO       ----MASKQPAILNPTPEDISLLLAAQTHIGTKNCEKAMLPYVHKRRA-DGIHLINIGKT
RSSA_USTMA       -----MSKVPAALNPTEEDISLLLAAQTHIGTKNADKQMAPYIYKRRA-DGIHLLNIGKT
RSSA_CRYNJ       ---MSADKLPKALQATEDDIQLLLAAQCHLGTKNCDKSMENYVWKRRA-DGIHVINVGKT
RSSA1_ARATH      MATNGSASS-AQLSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRN-DGIYIFNLGKT
RSSA_BRANA       MAANGS----TQLSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRN-DGIYIFNLGKT
RSSA2_ARATH      MAANGVATAGRQVSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRD-DGIYIINLGKT
RSSA_CICAR       MATTTAPS--RQLTQKEADIQMMLAADVHLGTKNCNFQMERYIFKRRN-DGIYIINLGKT
RSSA_VITVI       ---MATPT--RALSQKEQDIQMMLAAEVHLGTKNCNFQMERYVFKRRN-DGIYIINLGKT
RSSA_DAUCA       ---MASGA--RELSTMEADIQMMCAAEVHLGTKNCDFQMERYVFKRRN-DGIYIINLGKT
RSSA_CHLRE       ----------MALSQKEQDIQMMLAAQCHLGTKNCHYQMERYMYRRRQ-DGIYIINLEKT
RSSA_OSTLU       --------MAPQMSQKEADIAMMLAAGCHLGTKNVDFQMERYVWKRRA-DGIHIINLGRT
RSSA_OSTTA       --------MAPQMSQKEADIAMMLAAGCHLGTKNVDFQMERYVWKRRA-DGIHIINLGKT
RSSA_PLABA       ----MSNK-KVQ-SPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAK-DGVHIINLAKT
RSSA_PLAYO       ----MSNK-KVQ-SPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAK-DGVHIINLAKT
RSSA_PLACH       ----MSNK-KVQ-SPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAK-DGVHIINLAKT
RSSA_PLAF7       ----MSNK-KGQ-SPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAK-DGVHIINLAKT
RSSA_PLAKH       ---MSTNK-KVQ-SPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAK-DGVHILNLAKT
RSSA_PLAVS       ----MSSK-KVQ-SPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAK-DGVHILNLAKT
RSSA_TOXGO       ---MAADK-QAKLSLQEDSIAKMLICKAHIGTKNVEHKMRPYVFKSTS-EGIHLINLAKT
RSSA_THEAN       ----MAAP-TSKLTPDEDSIRMMLTAKVHIGTKNVENKMRKYVYSRTQ-EGVHLINLAHT
RSSA_THEPA       ----MAAP-TSKLTPDEDSIRMMLTAKVHIGTKNVENKMRKYVYSRTQ-EGVHLINLAHT
RSSA_CRYHO       ----MPPA-ETR---KLDDIAKMIVCKTHIGTKNVEDKMLSYVYKRTH-EGIFLINLAKT
RSSA_DICDI       ---MTQFP--AALNPHQDDILKMLACQTHLGGNNVDVEMESYTWKRKD-NGHFIINLAKT
RSSA_GIAIC       MSTEKTSQASKEYQLKEADVKKMLVATTHLGVRNIDRRMQFYIFDRQK-DGTFVFNLQKV
RSSA_ENCCU       -MPQDNTRISDSIKIPDEFVKLLIVSQSHLGGTSTNKSFARYLYGTRPRDRINIIDINAT
RSSA_NOSCE       ----MAKVN---IPIPNDFVKLILISQGHLGGIKTSKLMERYVFGTRKLENIKVIDIEKT
RSSA_ENTBH       ----MSDSS---IKMPPVFGKLLLATQAHLGGVKVTKPMKKYIYGERQ-DKVSVFDLKKT
                                       :     *:*  .       *       :   :..:   

RSSA_ECHGR       WEKLLLAARAICAIENPADVVIIGGQPTWQRGALKFGHYTGT-TSVPGRFTPGAFTNQIQ
RSSA_SCHJA       WEKILLSARAIAAIDTASDVFAIGSRPFSQRAVLKFANYTGA-TAMAGRFTPGAFTNQKQ
RSSA_AEDAE       WEKLLLAARCIASIEYPGEVFAISSRPYGQRAVLKFAHYTE-ATPTAGRFTPGAFTNQIQ
RSSA_CULQU       WEKLLLAARCIASIEYPGEVFAISSRQFGQRAVLKFAHYTE-ATPIAGRFTPGAFTNQIQ
RSSA_ANOGA       YEKLLLAARCIASIEYPGEVFAISSRPYGQRAVLKYAHYTQ-ATPIAGRFTPGAFTNQIQ
RSSA_DROSE       WEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROSI       WEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROTE       WEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROYA       WEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROER       WEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROAN       WEKLQLAARAIVAIDNASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROPE       WEKLQLAARAIVAIENASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROPS       WEKLQLAARAIVAIENASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROWI       WEKLVLAARAIVAIENASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROMO       WEKLVLAARAIVAIENASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROVI       WEKLVLAARAIVAIENASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DROGR       WEKLVLAARAIVAIENASDVFVISSRPIGQRAVLKFAKYTD-TTPIAGRFTPGAFTNQIQ
RSSA_DIACI       WEKLLLAARAIVAIEHPADVFVISSRPIGQRAVLKFASYTG-ATPIAGRFTPGAFTNQIQ
RSSA_MACHI       WEKLLLAARAIAAVEHAAEIFVISSRPFGQRAVLKFAAHTG-ATPIAGRFTPGAFTNQIQ
RSSA_BOMMO       WEKLVLAARAVVAIENPADVFVISSRPFGQRAVLKFAAHTG-ATPIAGRFTPGAFTNQIQ
RSSA_URECA       WEKVLLAARAIAAIENPADICVISARPYGQRAVLKFAHYTG-ATPIAGRFTPGTFTNQIQ
RSSA_PINFU       WEKLLLAARAIAAIENPADVCVISARPYGQRAVLKFASATG-ATPIAGRFTPGTFTNQIQ
RSSA_TRIGR       WEKLLMAARIIVAIENPADVCVISSRPYGQRAVLKFGAHTG-ATPIAGRYTPGTFTNQIQ
RSSA_ORNPR       WEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTG-ATPIAGRFTPGTFTNQIQ
RSSA_NEMVE       WEKLLLAARIIVTIENPADVCVISARPYGQRAILKYASHTG-ATPIAGRFTPGTFTNQIQ
RSSA_SUBDO       WEKLLLAARVIAAIENPADVCVLANKPFGQRAILKFAHYTG-AFPIAGRFTPGTFTNQIQ
RSSA_TRIAD       WEKLLIAARIIASIENPADVCVLSARPYGQRAVLKFAKFTG-ASPIAGRFTPGTFTNQIQ
RSSA_HYDVD       WEKLILAARIIASIENPADVCVISSRPYGTRAVLKFAQSTG-AIPIAGRFTPGTFTNQIQ
RSSA_CAEEL       WEKLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTG-ATAIFGRFSPGCLTNQIQ
RSSA_CAEBR       WEKLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTG-ATAIFGRFSPGCLTNQIQ
RSSA_BRUMA       WEKLLLAARAIAAIDNPGDVCVVSARPYAQRALLKFAAHTG-STPIFGRFTPGCLTNQIQ
RSSA_LEIIN       WEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFH-GGRFIPGTFTNQIQ
RSSA_LEIMA       WEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFH-GGRFIPGTFTNQIQ
RSSA_LEIBR       WEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFH-GGRFIPGTFTNQIQ
RSSA_MONBE       YEKIVLAARIIAAVDSPANVCAISGRNFGQRAILKFCNHIGGAFPIAGRFTPGAFTNQIQ
RSSA1_YEAST      WEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA1_YEAS7      WEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA1_YEAS1      WEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA2_YEAST      WEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA2_YEAS1      WEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA2_YEAS7      WEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA_CANGA       WEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGA-TPIAGRFTPGSFTNYIT
RSSA_ZYGRC       WEKLVLAARIIAAIPNPEDIVAISSRTFGQRAVLKFSAHTGA-TPIAGRFTPGSFTNYIT
RSSA1_VANPO      WEKIVLAARIIAAIPNPEDVCAISSRTYGQRAVLKFSAHTGA-TPIAGRFTPGSFTNYIT
RSSA2_VANPO      WEKIVLAARIIAAIPNPEDVCAISSRTYGQRAVLKFSAHTGA-TPIAGRFTPGSFTNYIT
RSSA_KLULA       WEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGA-TPIAGRFTPGSFTNYIT
RSSA_ASHGO       WEKIVLAARIIAAIPNAEDVVAISSRTYGQRAVLKFSAHTGA-TAIAGRFTPGSFTNYIT
RSSA_LACTC       WEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFSAHTGA-TAIAGRFTPGSFTNYIT
RSSA_KOMPG       WEKIVLAARIIAAIPNPEDVVAVSSRTFGQRAVLKFASHTNG-SAIAGRFTPGSFTNYIT
RSSA_CANAL       WEKIVLAARIIAAVPNASDVAVCSSRTFGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_CANAW       WEKIVLAARIIAAVPNASDVAVCSSRTFGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_CANDC       WEKIVLAARIIAAVPNASDVAVCSSRTFGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_CANTR       WEKIVLAARIIAAIPNANDVAVCSSRTFGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_LODEL       WEKIVLAARIIAAVPNSSDVAVCSSRTFGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_DEBHA       WEKIVLAARIIAAIPNAADVAVCSTRTFGQRAVLKFAAHTGA-TPIAGRFTPGNFTNYIT
RSSA_PICST       WEKIVLAARIIAAVPNPSDVAVCSSRTFGQRAVLKFAAHTGA-TPIAGRFTPGNFTNYIT
RSSA_PICGU       WEKIVLAARTIAAIPNAADVAVCSSRTFGQRAVLKFAAHTGA-TPIAGRFTPGNFTNYIT
RSSA_CLAL4       WEKIVLAARIIAAIPNASDVVVCSSRTFGQRAVLKFASHTGA-TPIAGRFTPGNFTNYIT
RSSA_NEUCR       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-QAIAGRFTPGSFTNYIT
RSSA_PODAN       WEKIVLAARIIAAIDNPSDVCVISARPYGQRAVLKFAAHTGA-QAIAGRFTPGSFTNYIT
RSSA_CHAGB       WEKITLAARIIAAIDNPSDVCVISARPYGQRAVLKFAAHTGA-QAIAGRFTPGSFTNYIT
RSSA_MAGO7       WEKIVLAARIITAIDNPADVCVISARPYGQRAVLKFAAHTGA-QAIAGRFTPGSFTNYIT
RSSA_NECH7       WEKIVLAARIIAAIDNPADVCVISARPYGQRAVLKFASHTGA-TAIAGRFTPGSFTNYIT
RSSA_ASPFC       WEKILLAARIIAAIENPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_ASPFU       WEKILLAARIIAAIENPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_NEOFI       WEKILLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_ASPCL       WEKILLAARIIAAIDNPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_ASPTN       WEKILLAARIIAAIDNPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_ASPOR       WEKILLAARIIAAVENPADICVISARPYGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_ASPFN       WEKILLAARIIAAVENPADICVISARPYGQRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_ASPNC       WEKILLAARIIAAIDNPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_EMENI       WEKILLAARIIAAIDNPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_PENRW       WEKIVLAARIIAAIDNPADVCVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_TALMQ       WEKIVLAARIIAAIDNPADVAVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_TALSN       WEKIVLAARIIAAIDNPADVAVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_COCIM       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGSFTNYIT
RSSA_COCP7       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGSFTNYIT
RSSA_UNCRE       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGSFTNYIT
RSSA_AJEDR       WEKIVLAARIIAAIDNPADVCVISARPYGQRAVLKFAAHTGA-AAIAGRFTPGNFTNYIT
RSSA_BLAGS       WEKIVLAARIIAAIDNPADVCVISARPYGQRAVLKFAAHTGA-AAIAGRFTPGNFTNYIT
RSSA_AJECG       WEKIVLAARIIAAVDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_PARBD       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_PARBP       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_PARBA       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_ARTOC       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGSFTNYIT
RSSA_BOTFB       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_SCLS1       WEKIVLAARIIAAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_PHANO       WEKIVLAARIIVAIDNPADICVISARPYGQRAVLKFAAHTGA-VAIAGRFTPGNFTNYIT
RSSA_PYRTR       WEKIVLAARIIVAIDNPADICVISARPYGQRAVLKFASHTGA-TAIAGRFTPGNFTNYIT
RSSA_YARLI       WEKIQLAARIIAAVPNPADVVAISARTYGQRAVLKFANHCGA-TAIAGRFTPGSFTNYIT
RSSA_PNECA       WEKLILAARIIVTIENPTDIIAVSSRSYGQRAVHKYALHTGAREAISSRFTPGSFTNYIT
RSSA1_SCHPO      WEKLVLAARVIATIENPADVCVVSTRTYGHRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA1_SCHJY      WEKIVLAARVIATIENPADVCVVSSRPYGHRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA2_SCHPO      WEKLVLAARVIATIENPADVCVISSRPYGHRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA2_SCHJY      WEKIVLAARVIATIENPADVCVISARPYGHRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA3_SCHJY      WEKIVLAARIIATVENPADVCVVSSRPYGHRAVLKFAAHTGA-TAIAGRFTPGNFTNYIT
RSSA_COPC7       WEKLVLAARIIAAVENPNDICVISARPYGHRAVLKFAANTGA-QAIAGRFTPGSFTNYIT
RSSA_POSPM       WEKLVFAARIIAAIENPNDVCVISARPYGHRAVLKYAANTGA-QAIAGRFTPGSFTNYIT
RSSA_LACBS       WEKLVLAARVIAAVENPNDVCVISARPYGHRAVLKYAANTGA-QAIAGRFTPGSFTNYIT
RSSA_MALGO       WEKLVFAARVLAAVENPADICVISSRTYGHRAVHKFAANTGA-TAIAGRFTPGSFTNYIT
RSSA_USTMA       WEKIVFAARILAAIENPADICVISGRQYGHRAVLKFAAQTGA-TAIAGRFTPGSFTNYIT
RSSA_CRYNJ       WEKLVLAARVLATIENPNDVCVISARPYGHRAVLKYGSFTGA-QAIAGRFTPGSFTNYIT
RSSA1_ARATH      WEKLQMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGA-NAIAGRHTPGTFTNQMQ
RSSA_BRANA       WEKLMMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGA-NAIAGRHTPGTFTNQMQ
RSSA2_ARATH      WDKLQMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGV-NAIAGRHTPGTFTNQMQ
RSSA_CICAR       WDKLNLAARIIVAIENSQDIIVQSARPYGQRAVLKFAQYTGA-HAIAGRHTPGTFTNQLQ
RSSA_VITVI       WEKLQLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGA-HAIAGRHTPGTFTNQLQ
RSSA_DAUCA       WEKLMLAARVIVSIENPQDIIVQSARPYGQRAVLKFAQYTGA-HAIAGRHTPGTFTNQLQ
RSSA_CHLRE       YEKLQMAARIIVAIENPQDICVLSARPYGQRAVFKFAQYLGC-KSMAGRHTPGTFTNQIQ
RSSA_OSTLU       WDKLMLAARIIVACENPQDVICQAARPYGQRAVLKFAQYTGA-KAIAGRHTPGTYTNQKD
RSSA_OSTTA       WDKLMLAARVIVAVENPQDVIAQAARPYGQRAVLKFAQYTGA-KALAGRHTPGTYTNQKD
RSSA_PLABA       YEKLQLAARVIVAVSNPADVVVVSARPFGSRAVLKFAQYTGA-QAIAGRWTPGMLTNQII
RSSA_PLAYO       YEKLQLAARVIVAVSNPADVVVVSARPFGSRAVLKFAQYTGA-QAIAGRWTPGMLTNQII
RSSA_PLACH       YEKLQLAARVIVAVSNPADVVVVSARPFGSRAVLKFAQYTGA-QAIAGRWTPGMLTNQII
RSSA_PLAF7       YEKLQLAARIIVAISNPADVVVVSARPFGSRAVLKFAQYTGA-QAIAGRWTPGMLTNQII
RSSA_PLAKH       YEKLQLAARIIVAINNPADVVVVSARPFGSRAVLKFAQYTGA-QAIAGRWTPGMLTNQII
RSSA_PLAVS       YEKLQLAARIIVAINNPADVVVVSARPFGSRAVLKFAQYTGA-QAIAGRWTPGMLTNQII
RSSA_TOXGO       WEKILMAARVIVAIENPADVLVISARPYGSRAVLKFSQYVGA-QAIAGRWTPGMLTNQIT
RSSA_THEAN       LEKLKVAARAIVTVSNPEEVVVVSARPYGSRAVLKFSHYVGS-HPIAGRWIPGTLTNQIT
RSSA_THEPA       LEKLKVAARAIVTVSNPEEVVVVSARPYGSRAVLKFSHYVGS-HPIAGRWIPGTLTNQIT
RSSA_CRYHO       WEKIQIAARIIATIDNLADVVVVSQRPYGSRPALKFAQHTGA-HAMVGRFTPGTLTNQIT
RSSA_DICDI       WEKIQLAARVIVAIENPADISVISAKPLGQRAVLKFANFIGA-TAFSGRFTPGTFTNQIQ
RSSA_GIAIC       WAKIVFAARILVTIDDPAEIAVVANRPDAQRAILKFCKYTHA-TAFPGRFIPGNFTNRMN
RSSA_ENCCU       WEKLIIAARAFCGIKHPSSIAVVSTKTFGRKPVVKFCEAVGA-TPITGRFIPGSFTNSEV
RSSA_NOSCE       WEKFILAARMFCSLKHPSDAVVVSTKTFGRKGVLKFCESTCA-TPVIGRFIPGTFCNNQV
RSSA_ENTBH       WDKFILAARAFCGLNYGDDVTVISCKTFGKKPVLKFAETTGA-KSYTGRFIPGSFTNTTI
                   *. .:** .       .    . :    :   *:           .*  **   *   

RSSA_ECHGR       SGFKEPRLLIVCDPKGDHQPVREGSAVNIPVIGFCNTDSPLQCVDIGIPCNN-DKYSIAL
RSSA_SCHJA       SCFREPRLLVVSDPLSDHQAVMEASSVNVPLIALCNTDSPLTRVDIVIPCNNKSTHSIAV
RSSA_AEDAE       PAFREPRLLIVTDPLTDHQPVTEASYVNIPVIAFCNTDSPLKFVDIAIPCNNKSPHSIGL
RSSA_CULQU       PAFREPRLLIVTDPLTDHQPVTEASYVNIPVIAFCNTDSPLKFVDIAIPCNTKSPHSIGL
RSSA_ANOGA       TTFREPRLLIVTDPLTDHQPVTEASYVNIPVIAFCNTDSPVKFVDIAIPCNTKSTHSIGL
RSSA_DROSE       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROSI       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROTE       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROYA       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROER       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROAN       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROPE       PAFREPRLLVVTDPMTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROPS       PAFREPRLLVVTDPMTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGL
RSSA_DROWI       PAFREPRLLVVTDPMTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSPHSIGL
RSSA_DROMO       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSPHSIGL
RSSA_DROVI       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSPHSIGL
RSSA_DROGR       PAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSPHSIGL
RSSA_DIACI       AAFREPRLLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGL
RSSA_MACHI       AAFREPRLLVVTDPAEDKQPITEASYVNIPVIAFCNTDSPLRYVDIAIPCNTKSAHSIGL
RSSA_BOMMO       AAFREPRLLIVLDPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGL
RSSA_URECA       TAFREPRLLVVTDPYTDHQPVTEASYVNIPVIALTNTDSPLKYVDIAIPCNNKSIHSVGL
RSSA_PINFU       AAFREPRLLVVTDPRIDHQPVTEASYVNIPVIALCNTDSPLRYVDVAIPCNNKSVHSVGL
RSSA_TRIGR       AAFREPRILIVTDPRSDHQPVTEASYVNIPVIALCNTDSPLRYVDIAIPCNNKSIHSIGL
RSSA_ORNPR       AAFREPRLLVVCDPREDHQPVTEASYVNIPVIAFCNTDACLRYVDVAIPCNNKAQHSIGL
RSSA_NEMVE       AAFREPRLLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGL
RSSA_SUBDO       KAFREPRLLIVSDARSDHQPITEAAYVNIPVIAFCNTNSPLRYIDVAIPCNNMGKNSLGL
RSSA_TRIAD       KAYREPRLLIVTDPRVDHQPITEASYVNIPVIAFCNTDSRLRYIDVGIPCNNKGAHAIGL
RSSA_HYDVD       KRFREPRLLISTDPQHDNQALTEASYVNIPVIALCNTDSPLRFVDCAIPCNNRGIQSIGT
RSSA_CAEEL       KTFKEPRLLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGL
RSSA_CAEBR       KTFKEPRLLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGL
RSSA_BRUMA       KQFKEPRLLIVSDPRVDHQAVTEASYVGVPVISFCNTDSPLKFIDIAIPCNNKGVQSIGL
RSSA_LEIIN       KKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIAIPCNNRGIKSIGM
RSSA_LEIMA       KKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIAIPCNNRGIKSIGM
RSSA_LEIBR       KKFMQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLDFVDIAIPCNNRGIKSIGM
RSSA_MONBE       KAFQEPRLLVLTDPLVDHQAVREASYVNIPIISLCDVDAPLRYVDVVIPCNNKSPHAIGI
RSSA1_YEAST      RSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGL
RSSA1_YEAS7      RSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGL
RSSA1_YEAS1      RSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGL
RSSA2_YEAST      RSFKEPRLVIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGL
RSSA2_YEAS1      RSFKEPRLVIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGL
RSSA2_YEAS7      RSFKEPRLVIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGL
RSSA_CANGA       RSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGL
RSSA_ZYGRC       RSFKEPRLIIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGL
RSSA1_VANPO      RSFKEPRLIIVTDPRSDFQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGL
RSSA2_VANPO      RSFKEPRLIIVTDPRSDFQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGL
RSSA_KLULA       RSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGL
RSSA_ASHGO       RSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLESPSEYVDVAIPCNNRGKHSIGL
RSSA_LACTC       RSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNKGKHSIGL
RSSA_KOMPG       REFKEPRLIIVTDPRTDSQAIKESSYVNIPIIALTDMDSPSEFVDVAIPCNNKGKHSIGL
RSSA_CANAL       RSFKEPRLVVVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_CANAW       RSFKEPRLVVVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_CANDC       RSFKEPRLVIVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_CANTR       RSFKEPRLVIVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_LODEL       RSFKEPRLVIVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_DEBHA       RSFKEPRLVVVTDPRTDFQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_PICST       RSFKEPRLVVVTDPRTDAQAIKESSYVNIPVIALTDMDSPSEYVDVAIPCNNKGKHSIGL
RSSA_PICGU       RSFKEPRLVIVTDPRTDAQAIKESSYVNIPVIALTDMDSPTDYVDIAIPCNNKGKHSIGL
RSSA_CLAL4       RSFKEPRLVIVTDPRTDAQAIKESSYVNIPVIALSDVDSPSEYVDVAIPCNNKGKHSIGL
RSSA_NEUCR       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDADSPTEYVDVAIPTNNKGRHAIGC
RSSA_PODAN       RSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEYVDVAIPTNNKGRHSIGL
RSSA_CHAGB       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEYVDVAIPTNNKGRHSIGL
RSSA_MAGO7       RSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEYVDVAIPTNNKGRHAIGC
RSSA_NECH7       RSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALTDTDSPTEYVDVAIPTNNKGRHAIGC
RSSA_ASPFC       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_ASPFU       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_NEOFI       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_ASPCL       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVDVAIPTNNKGRHAIGL
RSSA_ASPTN       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVDVAIPTNNKGRHSIGL
RSSA_ASPOR       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVLALCDTDSPTDFVDVAIPTNNKGRHSIGL
RSSA_ASPFN       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVLALCDTDSPTDFVDVAIPTNNKGRHSIGL
RSSA_ASPNC       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVDVAIPTNNKGRHAIGL
RSSA_EMENI       RSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVDVAIPTNNKGRHAIGL
RSSA_PENRW       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVDVAIPTNNKGRHAIGL
RSSA_TALMQ       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_TALSN       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_COCIM       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_COCP7       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_UNCRE       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEYVDVAIPTNNKGRHAIGL
RSSA_AJEDR       RSFKEPRLIIVTDPRTDHQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_BLAGS       RSFKEPRLIIVTDPRTDHQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_AJECG       RSFKEPRLIIVTDPRTDHQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_PARBD       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_PARBP       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_PARBA       RSFKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHAIGL
RSSA_ARTOC       RSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALCDADSPTEFVDVAIPTNNKGRHAIGL
RSSA_BOTFB       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHSIGL
RSSA_SCLS1       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVDVAIPTNNKGRHSIGL
RSSA_PHANO       RSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDGDSPTEYVDVAIPTNNKGRHAIGL
RSSA_PYRTR       RSFREPRLVIVTDPRTDAQAIKEASYVNIPVIALCDGDSPTEYVDVAIPTNNKGRHAIGL
RSSA_YARLI       RSFKEPRLLIVTDPRTDHQAIKEASYVNIPVIALVDTDSPVEFVDVAIPCNNKGRHSVGL
RSSA_PNECA       RSYKEPRLIIVTDPRTDSQAIKEASYVNIPVIALCDTDSPLQYVDVAIPTNNKGRHSIGL
RSSA1_SCHPO      RTYREPRLIVVTDPRADAQAIKEASFVNIPVIALCDTDSILNHVDIAIPTNNKGRKSIGL
RSSA1_SCHJY      RTYREPRLIIATDPRADAQAIKEASYVNIPVISLCDTDSPLAHVDVAIPTNNKGYKSIGL
RSSA2_SCHPO      RTYREPRLIIVTDPRADAQAIKEASFVNIPVIALCDTDSILNHVDVAIPINNKGYKSIGL
RSSA2_SCHJY      RTYREPRLIVVTDPRADHQAIKEASYVNIPVIALCDTDSPLAHVDIAIPTNNKGYKSIGL
RSSA3_SCHJY      RTFREPRLIIATDPRADAQAIKEASYVNIPVIALCDTDSPLAHVDVAIPTNNKGYKSIGL
RSSA_COPC7       RSFKEPRIIIVTDPRVDHQAIREASYVNIPVIALCDTDAPLQFVDVAIPTNNKTRHSIGL
RSSA_POSPM       RSFKEPRLIVVTDPRVDHQAIREASYVNIPVIAFCDTDAPLKFVDVAIPTNNKSRHSIGL
RSSA_LACBS       RSFKEPRLIIVTDPRVDHQAIREASYVNIPVIALCDTDAPLKFVDVAIPTNNKTRHSIGL
RSSA_MALGO       RSFKEPRVIVVTDPRVDHQAIRESAYVNIPVIALCDTDAPLRHVDIAIPGNNKGRHSIGL
RSSA_USTMA       RSFKEPRVIVVTDPRVDHQAIREASYVNIPCISFVDSDSPLKFVDVAIPGNVRGRHSVGL
RSSA_CRYNJ       RSFKEPRVIIVTDPRVDHQAIREAAYVNIPVIAFCDTDASTKFVDIAIPANNKSRHSIGL
RSSA1_ARATH      TSFSEPRLLILTDPRTDHQPIKEGALGNIPIIAFCDTDSPMRFVDIGIPANNKGKHSIGC
RSSA_BRANA       TSFSEPRLLILTDPRTDHQPIKEGALGNIPIIAFCDTDSPMRFVDIGIPANNKGKHSIGC
RSSA2_ARATH      TSFSEPRLLILTDPRTDHQPIKEGALGNIPTIAFCDTDSPMGFVDIGIPANNKGKHSIGC
RSSA_CICAR       TSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMNYVDIGIPANNKGKHSIGC
RSSA_VITVI       TSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGC
RSSA_DAUCA       TSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGC
RSSA_CHLRE       KAFEEPRLLILTDPRTDHQPVKESSYMNIPTIAFCDTDSPLTHVDVAIPANNKGKHSIGV
RSSA_OSTLU       AIFAEPRVLIVTDPRTDAQPISETAYVNLPTIAFCDTDSPLKNVDVAIPANNKAKHSIGC
RSSA_OSTTA       AVFAEPRVLVVTDPRTDAQPISETAFVNIPTIAFCDTDSPLKNVDIAIPANNKAKQSIGC
RSSA_PLABA       QKFIEPRLLIVTDPRTDAQSVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIAL
RSSA_PLAYO       QKFIEPRLLIVTDPRTDAQSVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIAL
RSSA_PLACH       QKFIEPRLLIVTDPRTDAQSVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIAL
RSSA_PLAF7       QKFTEPRLLIVTDPRTDAQSVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIAL
RSSA_PLAKH       QKFTEPRLLIVTDPRTDAQPVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIAL
RSSA_PLAVS       QKFTEPRLLIVTDPRTDAQPVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIAL
RSSA_TOXGO       QKFMEPRLLIVTDPRTDAQAVRESAYANVPVIALCDTDSPLEHVDICIPCNNKGKESIAL
RSSA_THEAN       QKFIEPRLLVATDPRTDAQSLKESSYVSLPVIALCDTDSPLNYVDIAIPCNNKGKESIAL
RSSA_THEPA       QKFIEPRLLVATDPRTDAQSLRESSYVSLPVIALCDTDSPLNYVDIAIPCNNKGKESIAL
RSSA_CRYHO       QKFMEPRLLIVTDPRVDSQAVIESSYANIPVIALCDTDSPLQYVDVAIPCNNKGKESIAL
RSSA_DICDI       SKFTEPRLLIVADPLLDKQPLMEASYVNIPTIALCDTTSCLDGVDIAIPCNNRGKNSIAL
RSSA_GIAIC       PNYCEPRLLLVNDPVVDRQAILEASYVNIPTISLCNSDANLKFIDVAIPCNNKTPMSIGL
RSSA_ENCCU       KRVYDPRVLIVSDTYADKQAILESQYCNLPTIAFVNTDNSLVGVDIAIPMNNRSPSAIAA
RSSA_NOSCE       KRPLEPRVLIVSDPFADKQAVIEGSHVNLQTIAFCNTDNDVSFVDIVIPMNNRSPVSISA
RSSA_ENTBH       RNSCEPRLIIVSDPIVDKQAIEEAAKVNCPTIAFCNTDCDLKYVDIAIPLNNRSPKAIGA
                     :**:::  *.  * *.: *    .   :.: :       :*  :* *     ::. 

RSSA_ECHGR       MLWMLAREVRRIWGLDPRS----QPGDVI-----MDLFLMREHVDEPP----EGPEGEAQ
RSSA_SCHJA       VWWFLAREVRRIRGEDTRL----QQWSVL-----PDLFLYRDPNEEEQNV--EDPEDARL
RSSA_AEDAE       MWWLLAREVLRLRGKITH-----DKWDI-----KPDLFFYRDPEEAEKEQ--AAL---E-
RSSA_CULQU       MWWLLAREVLKLRGKIS------DKWEL-----KPDLFFYRDPEEQEKEQ--AALL--E-
RSSA_ANOGA       MWWMLAREVLRLRGKITH-----DRWEV-----MPDLFFFRDPEEAEKEQ--AAIE--A-
RSSA_DROSE       MWWLLAREVLRLRGTISRS----VEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROSI       MWWLLAREVLRLRGTISRS----VEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROTE       MWWLLAREVLRLRGTISRS----VEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROYA       MWWLLAREVLRLRGTISRS----VEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROER       MWWLLAREVLRLRGTISRS----VEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROAN       MWWLLAREVLRLRGTISRS----VEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROPE       MWWLLAREVLRLRGTISRT----VEWPV-----VVDLYFYRDPEEAEKEE-AAAKE----
RSSA_DROPS       MWWLLAREVLRLRGTISRT----VEWPV-----VVDLYFYRDPEEAEKEE-AAAKE----
RSSA_DROWI       MWWLLAREVLRLRGTISRS----IEWPV-----VVDLFFYRDPEEAEKEE-AAAKE----
RSSA_DROMO       MWWLLAREVLRLRGTISRT----TEWPV-----VVDLFFYRDPEEAEKEEAAAAKE----
RSSA_DROVI       MWWLLAREVLRLRGTISRT----TEWPV-----VVDLFFYRDPEEAEKEEAAAAKE----
RSSA_DROGR       MWWLLAREVLRLRGTISRT----TEWPV-----VVDLFFYRDPEEAEKEEAAAAKE----
RSSA_DIACI       MWWLLAREVLRFRGTIPRE----PKWDV-----VVDLFFYRDPEEAEKEE-QAGKESAA-
RSSA_MACHI       MWWLLAREVLRLRGSIPRD----GKWDV-----VVDLFFYRDPEEVEKED-QAAKEAAA-
RSSA_BOMMO       MWWLLAREVLRLRGVLPRD----QRWDV-----VVELFFYRDPEESEKDEQQAKEQAVV-
RSSA_URECA       MWWMLAREVLRLRGTISRE----VPWEV-----MVDLFFYRDPEEAEKEAQA--EQAAA-
RSSA_PINFU       MWWLLAREVLRLRGTISRD----HPWEV-----MVDLYFYRDPEEAEKEEQTVVEKPAV-
RSSA_TRIGR       MWWMLSREVLRLRGAISRD----VTWEI-----MCDLYFFRDPEEAEKEEQEARDRATA-
RSSA_ORNPR       MWWMLTREVLRMRGSIIRE----IPWDT-----MVDLFFYRDPEEAEKEEQTQVVPERS-
RSSA_NEMVE       MFWLLAREVLRMRGSISRA----LPWEI-----MPDLYFYRDPEEAEKEEQAALARQQE-
RSSA_SUBDO       MWWLLCREVLRLRGTISRE----LPWEV-----MPDLFFYRDPEEVEKEEQAKAEAERER
RSSA_TRIAD       MWWLLAREVLRLRGTISRD----TDWEH-----MPDLFFYRDPEEVEKEEQAQ-------
RSSA_HYDVD       MWWILAREVLHLRGIISRK----TPWNV-----MPDLFFYRDPEDIEKEEQAAAIASAK-
RSSA_CAEEL       MWWMLAREILILRGKISRQ----TGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEA
RSSA_CAEBR       MWWMLAREILILRGKISRQ----TGFVLDGKEIMPDLYFYRDPTETEKEETGAHAEVAET
RSSA_BRUMA       MWWLLAREVLLIKGKMTRQ----TGFVLDDKEIMPDLYFYRNPEEQEKEELAEPREVKEP
RSSA_LEIIN       MYWLLAREVLRLRGTIVRS----VPWEE-----KVDLFFYRDPNEAAEEKAAAAAAAPA-
RSSA_LEIMA       MYWLLAREVLRLRGTIVRS----VPWEE-----KVDLFFYRDPNEAAEEKAAAAAAAPA-
RSSA_LEIBR       MYWLLAREVLRLRGTIVRS----VPWEE-----KVDLFFYRDPNEAAEEKAAAAAAAPA-
RSSA_MONBE       VWWMLAREVLRLRGTLPRD----AEWDV-----MPDLYFFRDPEEIKKEEEAAAAA----
RSSA1_YEAST      IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRDPEEVEQQV---AEEATT-
RSSA1_YEAS7      IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRDPEEVEQQV---AEEATT-
RSSA1_YEAS1      IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRDPEEVEQQV---AEEATT-
RSSA2_YEAST      IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRNPEEVEQVA---EEAAAA-
RSSA2_YEAS1      IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRNPEEVEQVA---EEAAAA-
RSSA2_YEAS7      IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRNPEEVEQVA---EEAAAA-
RSSA_CANGA       IWYLLAREVLRLRGALTDR---TQPWSIM-----PDLYFYRNPEEIEQQT---AEEAAQ-
RSSA_ZYGRC       IWYLLAREVLRLRGALVDR---TQPWSVM-----PDLYFYRNPEEIEQQV---AEETAG-
RSSA1_VANPO      VWYLLAREVLRLRGALVDR---TQPWAIM-----PDLYFYRNPEEVEQQA---AEETTS-
RSSA2_VANPO      VWYLLAREVLRLRGALVDR---TQPWAIM-----PDLYFYRNPEEVEQQA---VEEASA-
RSSA_KLULA       IWYLLAREVLRLRGALPDR---TQPWAIM-----PDLYFYRNPEEIEQQT---AEEEAV-
RSSA_ASHGO       IWYLLAREVLRLRGALVDR---TQPWSIM-----PDLYFYRDPEEIEQQA---AEEAAA-
RSSA_LACTC       IWYLLAREVLRLRGSLVDR---TQPWSIM-----PDLYFYRDPEEVDQQV---AEEATA-
RSSA_KOMPG       IWYLLSREVLRLRGVLPNR---TEAWSVM-----PDLYFYRDPEEIEQTA---EEEAEA-
RSSA_CANAL       IWWLLAREVLRLRGIIPDR---TTEWSVM-----PDLYFYRDPEEIEQNA---VEEAKT-
RSSA_CANAW       IWWLLAREVLRLRGIIPDR---TTEWSVM-----PDLYFYRDPEEIEQNA---VEEAKT-
RSSA_CANDC       IWWLIAREVLRLRGIIPDR---TTEWSVM-----PDLYFYRDPEEVEQNA---AEEAKT-
RSSA_CANTR       IWWLLAREVLRSRGIIPDR---TTEWSVM-----PDLYFYRDPEEIEQNA---AEEAKA-
RSSA_LODEL       IWWLLAREVLRLRGIIADR---TTEWSVM-----PDLYFYRDPEEIEQNA---TEDVQG-
RSSA_DEBHA       IWWLVAREVLRLRGIIPDR---TTEWSVM-----PDLYFYRDPEEIEQNA---TEDIKT-
RSSA_PICST       IWWLIAREVLRLRGIIPDR---TTEWSVM-----PDLYFYRDPEEIEQNA---AEEAKT-
RSSA_PICGU       IWWLLAREVLRLRGIIPDR---STEWSVM-----PDLYFYRDPEEIEQNA---AEDSKA-
RSSA_CLAL4       IWWLLAREVLRLRGIIPDR---EAEWSVM-----PDLYFYRDPEEIEQNA---AEEARAG
RSSA_NEUCR       VWWMLAREVLRLRGTIYNR---ETPWDVM-----VDLYFYRDPEAEAEEK---VEEEKLP
RSSA_PODAN       VWWMLAREVLRLRGTIYNR---EAPWDVM-----VDLYFYRDPEAEAEEK---VEEEKLP
RSSA_CHAGB       VWWMLAREVLRLRGTIYNR---ETPWDVM-----PDLYFYRDPEAEAEEK---VEEEKVP
RSSA_MAGO7       IWWMLAREVLRLRGTIYNR---ETPWDVM-----VDLYFYRDPEAEAEDK---VEEEKLA
RSSA_NECH7       VWWMLAREVLRLRGTIYSR---ETPWDVM-----VDLYFYRDPEAEAEEK---VEEEKVP
RSSA_ASPFC       IWWLLAREVLRLRGTLATR---ETEWDVV-----VDLYFYRDPEAEENKEI--ADEAKVP
RSSA_ASPFU       IWWLLAREVLRLRGTLATR---ETEWDVV-----VDLYFYRDPEAEENKEI--ADEAKVP
RSSA_NEOFI       IWWLLAREVLRLRGTLATR---ETEWDVV-----VDLYFYRDPEAEENKEI--ADETKVP
RSSA_ASPCL       VWWLLAREVLRLRGTLANR---ETEWDVV-----VDLYFYRDPEAEENKEI--AEETKVP
RSSA_ASPTN       VWWLLAREVLRLRGTLASR---EAEWDVV-----VDLYFYRDPEAEENKEI--AEEAKVP
RSSA_ASPOR       VWWMLAREVLRLRGTLATR---ETEWDVV-----PDLYFYRDPEAEENKEI--ADESKVA
RSSA_ASPFN       VWWMLAREVLRLRGTLATR---ETEWDVV-----PDLYFYRDPEAEENKEI--ADESKVA
RSSA_ASPNC       VWWLLAREVLRLRGTLASR---EVDWDVV-----VDLYFYRDPEAEENKEV--VEE-KVA
RSSA_EMENI       IWWLLAREVLRLRGTLANR---EVDWDVV-----VDLYFYRDPEAEENKEV--AEE-KVA
RSSA_PENRW       VWWMLAREVLRLRGTLATR---ETEWDTV-----VDLYFYRDPEAEENKEI--ADESKVA
RSSA_TALMQ       VWWLLAREVLRLRGTLATR---ETEWDVV-----VDLYFYRDPEAEETKEI--ADETKVA
RSSA_TALSN       VWWLLAREVLRLRGTLATR---ETEWDVV-----VDLYFYRDPEAEETKEI--ADESKVP
RSSA_COCIM       VWWLLAREVLRLRGTLANR---ETEWDVV-----VDLYFYRDPEAEEAKE---LEEAKAP
RSSA_COCP7       VWWLLAREVLRLRGTLANR---ETEWDVV-----VDLYFYRDPEAEEAKE---LEEAKAP
RSSA_UNCRE       VWWLLAREVLRLRGTLATR---ETEWDVV-----VDLYFYRDPEAEEAKE---LEEAKAA
RSSA_AJEDR       IWWMLAREVLRLRGTIASR---ETEWDVV-----VDLYFYRDPEAEENKE---IEEAKVP
RSSA_BLAGS       IWWMLAREVLRLRGTIASR---ETEWDVV-----VDLYFYRDPEAEENKE---IEEAKVP
RSSA_AJECG       IWWMLAREVLRLRGTLASR---ETEWDVV-----VDLYFYRDPEAEENKE---IEEAKVP
RSSA_PARBD       IWWMLAREVLRLRGTLANR---ETEWDVV-----VDLYFYRDPEAEENKE---IEETKVP
RSSA_PARBP       IWWMLAREVLRLRGTLANR---ESEWDVV-----VDLYFYRDPEAEENKE---IEETKVP
RSSA_PARBA       IWWMLAREVLRLRGTLANR---ETEWDVV-----VDLYFYRDPEAEENKE---VEETKVP
RSSA_ARTOC       VWWMLAREVLRLRGTLASR---ETEWDIV-----VDLYFYRDPEAEETKE---IEEAKAA
RSSA_BOTFB       VWWMLAREVLRLRGSIASR---EAEWDTM-----VDLYFYRDPEAEENKE--AIEEAKAP
RSSA_SCLS1       VWWMLAREVLRLRGSIASR---EAEWDTM-----VDLYFYRDPEAEENKD--AIEEAKAP
RSSA_PHANO       VWWMLAREVLRLRGTLASR---EAEWDVM-----TDLYFYRDPEAEENKDSAGVEEAKVP
RSSA_PYRTR       VWWMLAREVLRLRGTLANR---ETEWDVM-----TDLYFYRDPEAEENKDSAGVEEAKVP
RSSA_YARLI       VWWMISREVLRLRGALEDR---NTEWSVM-----PDLYFYRDPEEPENTE---EAAEEAA
RSSA_PNECA       IWWMLAREVLRLRGTLANR---DVEWGIM-----VDLYFYRDPEETEKDTE---SEQKAL
RSSA1_SCHPO      IWYLLAREVLRVRGTLSRS----APWDVM-----PDLYFYRDPEEVEREE----EAKKAA
RSSA1_SCHJY      VWWLLAREVLRLRGTISRT----SPWDVM-----VDMYFYRDPEEIEREE----EAKAAA
RSSA2_SCHPO      AWYLLAREVLRLRGNISRT----TAWEVM-----PDLYFYRDPEEIEREE----EQKAAA
RSSA2_SCHJY      VWWLLAREVLRLRGALSRT----APWDIM-----VDMYFYRDPE-AEREE----EAKAVE
RSSA3_SCHJY      VWWLLAREVLRLRGALTRT----GAWDVM-----VDMYFYRDPEEIEREE----EAKAAA
RSSA_COPC7       IWWLLAREVLRLRGTIPRT---PDGWNVM-----VDMFFYRDPEEVEKQQ----QEEAAA
RSSA_POSPM       MWWLLAREVLRLRGTIPRT---TDGWNVM-----VDMFFYRDPEEVEKQQ----QEEAQA
RSSA_LACBS       IWWLLAREVLRLRGTIPRT---SDGWNVM-----VDMFFYRDPEEVEKQQ----QEEAAA
RSSA_MALGO       LWWLLCREFLRLRGIVPRT---PNGWNVM-----VDMFFYRDPEEIEREQ----AEAALA
RSSA_USTMA       LWWLLCRTVLRIKG---------GDLSVM-----PDMFFYRDPEEVEREA----QEAAAA
RSSA_CRYNJ       MWYLLCREVLRLRGTVPRGPTGPSGWDVL-----PDLFFYRDPEEIEREA----AEKAAA
RSSA1_ARATH      LFWLLARMVLQMRGTIA-A---GQKWDVM-----VDLFFYREPE--ETKPEDEDEAGPQA
RSSA_BRANA       LFWLLARMVLQMRGTIR-P---AQKWDVM-----VDLFFYREPE--ETKPEDEDEVAPQA
RSSA2_ARATH      LFWLLARMVLQMRGTIL-A---AQKWDVM-----VDLFFYREPE--EAKQEGDEEAEVQA
RSSA_CICAR       LFWLLARMVLQMRGTIR-P---GLKWDVM-----VDLFFYREPE--EAKQPEEDE-VAAP
RSSA_VITVI       LFWLLARMVLQMRRTIA-P---GHKWDVM-----VDLFFYREPE--EPKEQEGDEVVAAP
RSSA_DAUCA       LFWLLARMVLQMRGVIS-Q---GHKWEVM-----VDLFFYREPE--ETKDQEEED-LPVG
RSSA_CHLRE       LYFLLARMVLEMRDQIN-V---TNPWSVP-----VDLFFYREPE--EAKEAGEEETFEAE
RSSA_OSTLU       LYYLLARMVLQMRGTVS-A---ANPWDVM-----VDLFFYRDPEELEAKE---EEAAAAA
RSSA_OSTTA       LYYLLARMVLQMRGTIS-P---ANPWDVM-----VDLFFYRDPEELEAKEQEEEETAAAA
RSSA_PLABA       MYWLLAQEVLYLKGSIP-R---SQAWDVM-----VDMFLWRDPEQFELKN--LANEEAAP
RSSA_PLAYO       MYWLLAQEVLYLKGTIP-R---SQAWDVM-----VDMFLWRDPEQFELKN--LANEEATP
RSSA_PLACH       MYWLLAQEVLYLKGSIP-R---SQAWDVM-----VDMFLWRDPEQFELKN--LANEEATP
RSSA_PLAF7       MYWLLAQEVLYLKGVIP-R---SEPWNVM-----VDMFLWRDPEQFELKN--LANEENTP
RSSA_PLAKH       MYWLLAQEVLYLKGTLP-R---SKPWNVM-----VDMFLWRDPEQFELKN--LAIEETAP
RSSA_PLAVS       MYWLLAQEVLYLKGTLP-R---SKPWKVM-----VDMFLWRDPEQFELKN--LAIEETAP
RSSA_TOXGO       MYWLLAREVLYLRGELPSR---SVPWDVM-----VDMFLWRDPEEFERKER-LEDEEAAP
RSSA_THEAN       MYWLLAREVLYLRDQLK-R---WMPWDVL-----VDTFFWRDPEQFEQKP---EETVNTH
RSSA_THEPA       MYWLLAREVLYLRDQLK-R---WMPWDVL-----VDTFFWRDPEQFEQKP---EETVNTH
RSSA_CRYHO       MYYLLAREVNFLRGKTD-------KWDVM-----VDVFFWRDPEEYENSAIGADMELNDG
RSSA_DICDI       MFWLLAREVLYLRGTIP-R---NTTWSVK-----VDLFIYRDTD--EEPE--KEKTAAVA
RSSA_GIAIC       IYWLLAREVLRLKGSISRT----EEWDVK-----PDLFVALPEEIPDEEE---SEDFYDD
RSSA_ENCCU       GFFILSRLINYMKTGAELV------RDMK----EVELFLFRDSVELEQLV----EEQLLE
RSSA_NOSCE       GLFILSRLIRFMKTGEPLD------ENMK----EVELFIYRDPIELEKLV----EEQKII
RSSA_ENTBH       SFFILSRIIRYIKFGTPMD------QDIK----EVELFFYRDPIELEKLQ----EDQ---
                   ::: : .                          : :.                     

RSSA_ECHGR       ---------EPPFEQGK---------FDAAEA------------EAPEWPAES-------
RSSA_SCHJA       ---------EPVIPGAD---------AEAAETWG----------VEPSMPVGSLGDMG--
RSSA_AEDAE       --------AAPAAKDLY-----PEEPI-VVDE-------------TNWAGEDAALPAV--
RSSA_CULQU       --------AAPAAKEMY-----TDEPIPAVEE-------------GGNWGEEAAPAAP--
RSSA_ANOGA       --------AAPVIKDV------PDEVV-VADE-------------PTTWGEDVTQTAM--
RSSA_DROSE       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROSI       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROTE       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROYA       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROER       ---------LLPAPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROAN       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROPE       ---------LLPPPK-------IEEVVDHPVE------------ETTNWADEVAA-----
RSSA_DROPS       ---------LLPPPK-------IEEVVDHPVE------------ETTNWADEVAA-----
RSSA_DROWI       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROMO       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROVI       ---------LLPPPK-------IEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DROGR       ---------LLPPPK-------VEEAVDHPVE------------ETTNWADEVAA-----
RSSA_DIACI       --------AIADKPA-------DEFAAHAPTESWNDTVVPSADLAPQSWAEESASIP---
RSSA_MACHI       --------AVPTPKQEP-----LEYGVTGASEWTEAITEQGG--IQPSWADESLPGQPTV
RSSA_BOMMO       --------PAKPEVVAP-----VHEDWNETLE------------PVASWAEDTAPPAA--
RSSA_URECA       --------EKDKAPK---EEFTADQAFTAPGT------------EVSDWASE-VPVAPV-
RSSA_PINFU       --------KSDEVQD---QWATTDIAIQPPQQ------------EVSDWAAESIPVAP--
RSSA_TRIGR       --------VKEEPAQPYAEQWSDPVAVPPAGQPVA---------EVTDWAADSVKAPV--
RSSA_ORNPR       ---------IKEAPEFP----PDQWGVGDTAAVQP---------EVADWSTAAEIPFQ--
RSSA_NEMVE       --------EANAGTTAG----FSEWGGAAPWGADPM--------ATAGIAPTIPAPFA--
RSSA_SUBDO       LATDQWQTNQPAAPQQDPDQWADTMGVPSGGDWGDEPV---TTAPVPTGGAPPVAS----
RSSA_TRIAD       -------NNKWAAPEQSP---ALSAAVPS------------SAAPVEEWSSSPSKE----
RSSA_HYDVD       -------PDEPYQPDFSGNVDQSAAGADWG------------DQPVVTGADWTAEP----
RSSA_CAEEL       QEYQ----QPTDID-----------FTTQGG-------------KVDDWAAETATWTA--
RSSA_CAEBR       QEFQ----QQPDID-----------FTAQGG-------------KVEDWAAETATWTN--
RSSA_BRUMA       WPGV----PPPEVAKIDEVVRSIGMYQTIGGVEPAKKLDFSMVEPVSDWAQETERAVQ--
RSSA_LEIIN       ----------AEAEE--------GFGWVERND-------------DNAWEA---------
RSSA_LEIMA       ----------AEAEE--------GFGWVERND-------------DNAWEA---------
RSSA_LEIBR       ----------AEVEE--------GFGWVERND-------------DNAWEA---------
RSSA_MONBE       ----------KEAED--------DTGYTTQWD-------------DAALDADWSATGT--
RSSA1_YEAST      ----------EEAGEEE---------AKE-EVT-----------EEQAEATEWAEE----
RSSA1_YEAS7      ----------EEAGEEE---------AKE-EVT-----------EEQAEATEWAEE----
RSSA1_YEAS1      ----------EEAGEEE---------AKE-EVT-----------EEQAEATEWAEE----
RSSA2_YEAST      ----------EEGEEEE---------VKE-EVT-----------EGQAEATEWAEE----
RSSA2_YEAS1      ----------EEGEEEE---------VKE-EVT-----------EGQAEATEWAEE----
RSSA2_YEAS7      ----------EEGEEEE---------VKE-EVT-----------EGQAEATEWAEE----
RSSA_CANGA       ----------EAG-EEE---------AKE-EVT-----------EEQTEAAEWAQE----
RSSA_ZYGRC       ----------AATEEEE---------AKE-EVT-----------EEQTEATEWAEE----
RSSA1_VANPO      ----------TGADAEE---------SKE-EVA-----------EGQNEASEWAEE----
RSSA2_VANPO      ----------TGA-TEE---------ATE-EAT-----------EETTEATEWAED----
RSSA_KLULA       ----------ASGEQTE---------EAV-DAT-----------EEQTEAAEWAEEG---
RSSA_ASHGO       ----------GEEDDEA---------KEE-VAA-----------EEQTEAADWAEGQ---
RSSA_LACTC       ----------AADED-V---------KEE-VA------------EEQTEAADWAEGN---
RSSA_KOMPG       ----------AEGAEFE---------VEEEEVE-----------QEWQEPAEADWNA---
RSSA_CANAL       ---------EEVEEAPV---------AEAETEW-----------TGETEDVDWADSG---
RSSA_CANAW       ---------EEVEEAPV---------AEAETEW-----------TGETEDVDWADSG---
RSSA_CANDC       ---------EEVEEAPV---------AEAETEW-----------TGETEDVDWADSG---
RSSA_CANTR       ---------EETEEAPA---------AEAETEW-----------TGETDDVDWADSG---
RSSA_LODEL       ---------EEVEEVQA---------AEAETEW-----------TGETEEVDWAESG---
RSSA_DEBHA       ---------DDVEEAPA---------ADAETEW-----------TGETEEVDWAESG---
RSSA_PICST       ---------TEDVEEAA---------PVDADEW-----------TGETEEVDWAESG---
RSSA_PICGU       ---------EDAEEAPV---------ADAEPDW-----------SGETEDVDWAESG---
RSSA_CLAL4       --------ATEETEEVV---------AEAETEW-----------NTETNVEDWADSG---
RSSA_NEUCR       --------GVEEEGVAA---------IESGFPA-----------TG-DWEAAPAGFP---
RSSA_PODAN       --------GVDEEGVAA---------IESGFPA-----------AGGDWEAAPAAFP---
RSSA_CHAGB       --------GVEEEGPVA---------IESGFPA-----------GGADWEAAPAGFP---
RSSA_MAGO7       --------GVEEVGPAA---------IESGFAT-----------GGGDWEATAP------
RSSA_NECH7       --------GAEEEGPAA---------IESGFAA-----------TGGDWEAPAAGFA---
RSSA_ASPFC       --------GAEEIGAGA---------VESGFA-------------GENWDTQAPGAG---
RSSA_ASPFU       --------GAEEIGAGA---------VESGFA-------------GENWDTQAPGAG---
RSSA_NEOFI       --------GAEEIGAGA---------VESGFA-------------GENWDTQAPGAG---
RSSA_ASPCL       --------GAEEIGAGA---------VESGFA-------------GENWDTQAPGAG---
RSSA_ASPTN       --------GADEIGAGA---------VESGFA-------------GENWETQAPGAG---
RSSA_ASPOR       --------TAEEVGAGA---------IESGFA-------------GENWDTQGAGAG---
RSSA_ASPFN       --------TAEEVGAGA---------IESGFA-------------GENWDTQGAGAG---
RSSA_ASPNC       --------SAEEVGAGA---------IESGFA-------------GENWDVAGAGAG---
RSSA_EMENI       --------SAEDVGAGA---------IESGFA-------------AESWDAQGAAA----
RSSA_PENRW       --------GAEEIGAGA---------VESGFA-------------GENWDASAPGAG---
RSSA_TALMQ       --------GAEEVGPAA---------IESGYV-------------GDSWDAAAPGAA---
RSSA_TALSN       --------GAEEVGPAA---------IETGYV-------------GDSWDAAAPGAA---
RSSA_COCIM       --------GVEEIGAAA---------VETGFG-------------AEGWEAAGGSAF---
RSSA_COCP7       --------GVEEIGAAA---------VETGFG-------------AEGWEAAGGSAF---
RSSA_UNCRE       --------GVDEIGPGA---------VESGFG-------------AEGWEASAGTAF---
RSSA_AJEDR       --------GAEEVGAAA---------IESGLV-------------GDSWEAQVAPAF---
RSSA_BLAGS       --------GAEEVGAAA---------IESGLV-------------GDSWEAQVAPAF---
RSSA_AJECG       --------GAEEVGAAA---------IESGLV-------------GDSWEAQAAPAF---
RSSA_PARBD       --------GAEEVGAAA---------IESGLV-------------GDSWQAQATPGF---
RSSA_PARBP       --------GAEEVGAAA---------IESGLV-------------GDSWQAQATPGF---
RSSA_PARBA       --------GAEEVGAGA---------IESGFV-------------GDSWQAQATPGF---
RSSA_ARTOC       --------EAEEAAPDT---------LNP----------------ADNWDAAGAVAP---
RSSA_BOTFB       --------GADEVGAAA---------VDQGFAG------------AGDWEVSGATAG---
RSSA_SCLS1       --------GADEVGAAA---------VDQGFAG------------TGDWEVSGATAG---
RSSA_PHANO       --------GADEVGPAA---------VADGF--------------TSEWEVSGASAG---
RSSA_PYRTR       --------GADEVGPAA---------VADGF--------------TSEWEVSGASAG---
RSSA_YARLI       --------TEEVVETAA---------AEAAAAT-----------NADNWDVAPDAGA---
RSSA_PNECA       --------EASGNPAGQ---------FGSVPVT-----------SDWEIAAQSTGAG---
RSSA1_SCHPO      --------AAAAEE-AQ---------VEEAVAA-----------AEFEITDSAAGSV---
RSSA1_SCHJY      --------EAEAEA-AA---------TAEA--A-----------AEFEVTDSAAGTV---
RSSA2_SCHPO      --------AAAAEEEAQ---------LAAQTAA-----------AEFEVTDSAAGTV---
RSSA2_SCHJY      -----------AEAEAP---------AVEA--------------AEFEPT--AEGAV---
RSSA3_SCHJY      --------EAAAEAATT---------AEAA--------------AEFEAV--AAGAV---
RSSA_COPC7       --------KAAAAAGA----------EEAPAGL-----------SEWDVSSAPQAGSINP
RSSA_POSPM       --------KAAAAAG-----------EAAEAPL-----------NEWDVTAAPAAGGINP
RSSA_LACBS       --------KLAAQQGVE---------TEAPAGL-----------SEWDVSSA--------
RSSA_MALGO       --------KQAAAANAM---------QESTIEQ-----------VDFAIEGAGAGGV---
RSSA_USTMA       --------AQAAKETA-----------EPTTEG-----------A-----ADVQADV---
RSSA_CRYNJ       ---------AAAQEGAD---------AEAAATS-----------AAAGVTAEYDAGN---
RSSA1_ARATH      --------EYGALPAPEYGMVG--GDQWTTAQI-----------PDAAWPGEGQA-----
RSSA_BRANA       --------EFG-LPAPEYG--G--GDQWTTAAI-----------PDAAWPGEAQA-----
RSSA2_ARATH      --------DYG--------MVG--GDQWTTAQI-----------SDAAWSGEVEQ-----
RSSA_CICAR       --------DYAIADFNVSAIPS--DGQWPAAID-----------QP--WNDAVPQ-----
RSSA_VITVI       --------DYGITDYQATALGGLGGGDWGAPIT-----------DAPQWGADVPAV----
RSSA_DAUCA       --------DY-VADYAAAPIGG--ADQWNAIPD-----------AQ--WGGDVVQ-----
RSSA_CHLRE       --------GYA----------------LPAPVG-----------AAENWGEAAAPA----
RSSA_OSTLU       --------AAPAESAGY--------NAVADAAY-----------GAESWDEQKPAEA---
RSSA_OSTTA       --------AAPAADAGY--------NAVADAAY-----------GAESWDDQ--------
RSSA_PLABA       --------TAPHLADNQ-----------YATEA-----------PYDDWNKK--------
RSSA_PLAYO       --------TAPHLADNQ-----------YATEA-----------PYDDWNKK--------
RSSA_PLACH       --------TAPHLADNQ-----------YATDA-----------PYDDWNKK--------
RSSA_PLAF7       --------TAPHLIENQ-----------YAAEA-----------PYDEWTKK--------
RSSA_PLAKH       --------AAPHLTENQ-----------FATEA-----------PYEEWNKK--------
RSSA_PLAVS       --------AAPHLAENQ-----------FATEA-----------PYEEWNKK--------
RSSA_TOXGO       --------HTAQADATQ-----------WGADA-----------AAADWKQAG-------
RSSA_THEAN       --------EEDLMASRP-----------NVPLH-----------PLPDWSTVD-------
RSSA_THEPA       --------DDDLLTSRP-----------TVPLH-----------PLPDWSTVD-------
RSSA_CRYHO       --------MGVDIEGAA-----------VDSAA-----------AANEWGGVS-------
RSSA_DICDI       --------AAP------------------VAAV-----------EAVEFTQQ--------
RSSA_GIAIC       ---------DEEEDEE----------FSAGNGN--------------LFDEY--------
RSSA_ENCCU       --------TTDSILNVG---------------------------KEGILSGIGTGNA---
RSSA_NOSCE       --------ENANI-TIG---------------------------EQELYEQEEFGNK---
RSSA_ENTBH       --------NEDNY--------------------------------NEIFNKFSNANE---
                                                                             

RSSA_ECHGR       ---------VSPRCWNAGARF------------RWCWWQLDSLRCKG-------------
RSSA_SCHJA       ---------IAAPGYGPVGGT------------AGGWSNLDADPTETW------------
RSSA_AEDAE       --------AAAPAAVAAAPAALP------QLVQADDWNED--------ETQTAGSWGGG-
RSSA_CULQU       --------AAAAAVPAVAGAAIP------QMIQADDWNED--------ETQTAGSWGGAT
RSSA_ANOGA       --------AVPQAKPLAVAGA------------NDDWNED--------DTAPAAPGAASW
RSSA_DROSE       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROSI       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROTE       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROYA       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROER       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROAN       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROPE       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROPS       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROWI       ---------------ENVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROMO       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROVI       ---------------ETVGG-------------VEDWN----------EDTVKTSWGSD-
RSSA_DROGR       ---------------ETVGGG------------VEDWN----------EDTVKTSWGSD-
RSSA_DIACI       --------QYAPAPQAAAAPV------------ADDWT----------TPVGADDWGQDW
RSSA_MACHI       FPASNIDEWNTTAQPAAAVKP------------SEEWN----------AGR-SGNWGTS-
RSSA_BOMMO       -PAAAPAFGAPPAQEEWSAQV------------QDEWSTTAAAPA---AATAAPSWGGS-
RSSA_URECA       --PILAGGVDAATTEDWSVPA------------QSDWTAPAANPA---NAAAAGAPAPAP
RSSA_PINFU       ------------PGQPFMPPP------------AKDWSASTTEDW---SAASGPAPQSAL
RSSA_TRIGR       ------------AGIGTYGGP------------SEDWAV--ADAP---AAPAAPTPAAPS
RSSA_ORNPR       ------------SAPAPAPA---------PAPATDDWASTGTAT-----VGPTTEWGAAT
RSSA_NEMVE       ------------ATTPAVSADWDS----VAPGATDDWGAEPAAPSSDWGTAVTMQEQAKP
RSSA_SUBDO       ------------TTATPATNT------------GSGFNQDDW----SVPTTKTKDWGADD
RSSA_TRIAD       ------------TTEWGASNT------------AAAAKS-------SWSNETGGEWGAQE
RSSA_HYDVD       ------------SVSKDWAAE------------PAGWEAD--------TTAVSGDWATPK
RSSA_CAEEL       ---------------ETKTT--------------EEWAN----------APTQSNW----
RSSA_CAEBR       ---------------EGKTAA-------------DEWATG---------AQTQSNW----
RSSA_BRUMA       ---------------LDAAQQ-------------QEWGA----------STQNSNW----
RSSA_LEIIN       ------------------------------------------------------------
RSSA_LEIMA       ------------------------------------------------------------
RSSA_LEIBR       ------------------------------------------------------------
RSSA_MONBE       -------------GNFAAAPA------------DGNWG-----------ATTGGDWAAAG
RSSA1_YEAST      --------NADNVEW---------------------------------------------
RSSA1_YEAS7      --------NADNVEW---------------------------------------------
RSSA1_YEAS1      --------NADNVEW---------------------------------------------
RSSA2_YEAST      --------NADNVEW---------------------------------------------
RSSA2_YEAS1      --------NADNVEW---------------------------------------------
RSSA2_YEAS7      --------NADNVEW---------------------------------------------
RSSA_CANGA       --------NADNVEW---------------------------------------------
RSSA_ZYGRC       --------TTEAVAW---------------------------------------------
RSSA1_VANPO      --------NTEAVSW---------------------------------------------
RSSA2_VANPO      --------NTENATW---------------------------------------------
RSSA_KLULA       --------QAQEEEWN--------------------------------------------
RSSA_ASHGO       --------SEEVASW---------------------------------------------
RSSA_LACTC       --------TEEVASW---------------------------------------------
RSSA_KOMPG       --------SAPPADWNDAANAEAF------------------------------------
RSSA_CANAL       --------ATPAAEDAAASNW---------------------------------------
RSSA_CANAW       --------ATPAAEDAAASNW---------------------------------------
RSSA_CANDC       --------ATPAAEDAAASNW---------------------------------------
RSSA_CANTR       --------ATPAAEDAAASNW---------------------------------------
RSSA_LODEL       --------ATPAAEDAAASNW---------------------------------------
RSSA_DEBHA       --------ATPAAEEAAASNW---------------------------------------
RSSA_PICST       --------ATPAVEDAAASNW---------------------------------------
RSSA_PICGU       --------ATPAAEEAAASNW---------------------------------------
RSSA_CLAL4       --------VTAAGEEAAASQW---------------------------------------
RSSA_NEUCR       --------ATGEWSDAAPGAA------------APNWDATAPA---T---TADWAATEAK
RSSA_PODAN       --------AAGAATGEWSEAQ------------GAQWETGTGA---P---AADWAAEPAK
RSSA_CHAGB       --------AAA--TGEWSEAQ------------PATWESGAAAATGP---STEWADSAPK
RSSA_MAGO7       ---------AAASGWDDAAAQ------------PQNWDSAAQG-------AASWDEAAAP
RSSA_NECH7       --------GATGTGWDGAAGDEW-------GAAPATTEWAASA-------APAAASGEAA
RSSA_ASPFC       --------VPGTAFSAATAAP-----TSWEAD-GGDWAASSA-APAG--ESWA-ETQPAE
RSSA_ASPFU       --------VPGTAFSAATAAP-----TSWEAD-GGDWAASSA-APAG--ESWA-ETQPAE
RSSA_NEOFI       --------VPGTAFAAATAAP-----TSWEAD-GGDWAASSA-APAG--ESWA-ETQPAE
RSSA_ASPCL       --------VPGSAFAAASAAAA----TSWEAD-GGDWAASSA-PPAG--ESWA-ETQPTE
RSSA_ASPTN       --------VPGTAFAAASAAGA----TSWEAD-GADWAASSA-AAPA--ESWAAEAQGAE
RSSA_ASPOR       --------VPGTAFAAASAAGP----TSWEAD-GADWAASSAPAAAG--ESWA-ETQPAE
RSSA_ASPFN       --------VPGTAFAAASAAGP----TSWEAD-GADWAASSAPAAAG--ESWA-ETQPAE
RSSA_ASPNC       --------VPGTAFAAASAAAGA---ASWEAE-GGDWAASSA-APAG--ESWA-EAQPTE
RSSA_EMENI       --------------PAAFAAAGA---TSWEAD-GGDWAASSAPAPGG--ENWA-EAQPAE
RSSA_PENRW       --------NPGTAFAAASAATGAAAATSWDAE-GADWAASSA--APT--TEWA-EAQPAA
RSSA_TALMQ       --------APGAAFAAASATAG----ATWEAEASGDWAAESAQPNPE--TKW--------
RSSA_TALSN       --------APGSAFAAASATAG----ATWEAEAGGDWAAESAQPNPE--TKW--------
RSSA_COCIM       --------AAAASTTAPPN---------WEATGG-DWATSTAPAE-----GWAGDAPAG-
RSSA_COCP7       --------AAAASTTAPPN---------WEATGG-DWATSTAPAE-----GWAGDAPAG-
RSSA_UNCRE       --------GAAAATTTTTNPATA--TATWEATGG-DWA-SSAPAE-----GWAGEAPAT-
RSSA_AJEDR       --------AATGAAVPAGA------APGWEAEAAGEWAASSGAAAGAA-ETWATDTAAPD
RSSA_BLAGS       --------AATGAAVPAGA------APGWEAEAAGEWAASSGAAAGAA-ETWATDTAAPD
RSSA_AJECG       --------A--GAGVPAGA------APGWEAEGGVDWAASSAAPA----DTWAGESGNPD
RSSA_PARBD       --------SA-GVAVPGTA------VPGWEADVSTDWAASSAPAA----ETLADPAADP-
RSSA_PARBP       --------SA-GVAVPGTA------VPGWEADVSTDWAASSAPAA----ETLADPAADP-
RSSA_PARBA       --------SA-GVAAPGTA------VPGWEAEVSTDWAASSAPAA----ETLADPAADP-
RSSA_ARTOC       --------ATFGGTPAAGN---------WEAS-GADWATAAPAGG----ESWAADAPAAT
RSSA_BOTFB       --------AFTAASNTAAAGG-----ASWDAAEPSDWAAA---PAAAG-----QEWAASG
RSSA_SCLS1       --------AFTAASNTAAAGG-----ASWDAAEPSDWAAT---PAAAG-----QEWAASG
RSSA_PHANO       --------AFTSQA--AAAT------TSWDAEPSTDWAATTGGEAATG-EGWGAETTGAQ
RSSA_PYRTR       --------AFTAQA--AAAPG-----ASWDAD-TTDWAAS--GEAQTGNEGWGTEAAAPA
RSSA_YARLI       --------GAADWA--ATD----------------DWSESAPAPVAA-------------
RSSA_PNECA       --------IITNVASNVQSVGNWDENFGVETGVPSDWAADSIQ------------QSEIQ
RSSA1_SCHPO      -------DPNVLAAATAGQVGE----NTWEGA--GDWNTTGAAQTSDWTAAAEAQ-----
RSSA1_SCHJY      -------DPSVLAAATAGQVGE----SSWEEA--GDWNTTGAAQTSDWAATAEAQ-----
RSSA2_SCHPO      -------DPTILDNATAGQVGQ----TTWEGD--AEWNITGAA-PSEWA-----------
RSSA2_SCHJY      -------DPSILAAATAGQVGQ----SAWDEE--GDWNTTGAAQTSDWANTVA-------
RSSA3_SCHJY      -------DADVLAAATAGQVGE----GAWDEAATGDWSTVGAS-TSDWTATAAQ------
RSSA_COPC7       ALVSGEG-ALDWSAD--NAGP-----SDWAADTTTAAGWG-AETTGTGGWD---------
RSSA_POSPM       GLVAAEGGALDWSAEPAAAGP-----TDWAAEPTGASGWG-AEPTGPSGWD---------
RSSA_LACBS       ---------LDWAADPAPGTT-----TDWSAEPAAAAGGGWGADTGTAGWD---------
RSSA_MALGO       --------NPSVAANLPAGGEQ----VDWSADAAQDWAADTGAAPAASSWD---------
RSSA_USTMA       --------PLAVAANLATETGN----VDWSAEGAQDWAADGAAEQATSSWE---------
RSSA_CRYNJ       --------AADAVLAAQPTETA----LDWSDEPVAGDWAAEPAADAQGGW----------
RSSA1_ARATH      ----------PISAAPAAASWSD---SAA-APADGGWEAAAPPSG----------APAAG
RSSA_BRANA       ----------PISAAPAAGSWND---SAAPAAAEGGWDAAVPPT-----------TAVTN
RSSA2_ARATH      ----------PISAAPAVG-----------VTVAAGWEAASVPA--------------AG
RSSA_CICAR       ----------PIPAVPAVNW-------AAPEAVAGDWGEAVPPPQQIPTAGIESVPA-TG
RSSA_VITVI       ---------APIPAVPGSNWGDAAPMPSAVPIATDGWDAAAAPPVAVPPPVVEGVPPPAG
RSSA_DAUCA       ---------PANSAVPAGTW------TDAGPIAGDGWDAAAAPP--VPGAVGLDVPAPTG
RSSA_CHLRE       ---------PEAAGYDGAAA-------AGGFEAAAGFEAAAPPVA------GYVAPEAFG
RSSA_OSTLU       ---------FPTGGFAPAAG------NWSEAPAPTGWDAQQGGD----FGSGFGAMPPQG
RSSA_OSTTA       ----------AGAGFGAQAG------NWSEAPAPTGWDAQQGGD----FGQGFGAMPPQG
RSSA_PLABA       ---------------DDWND-----------NANEEWKNPITVDEW--------------
RSSA_PLAYO       ---------------DDWND-----------NANEEWKNPITVDEW--------------
RSSA_PLACH       ---------------DDWND-----------NANEEWKNPIAVDEW--------------
RSSA_PLAF7       ---------------EEWND-----------NTNEDWKNPIAAEEW--------------
RSSA_PLAKH       ---------------EEWND-----------NANEEWKNPIAAEEW--------------
RSSA_PLAVS       ---------------EEWND-----------NANEEWKNPIAADEW--------------
RSSA_TOXGO       ---------------ADWTGPAA-------GGAGGEWDQSAVAAEGEWGGGRPGVAVGEP
RSSA_THEAN       ---------------PSHAN-------------SSDWKVMAAGHEEWGSFVDTRAQWQ--
RSSA_THEPA       ---------------PAHAN-------------SSDWKVMAAGHEEWGSFVDTRAQWQ--
RSSA_CRYHO       ---------------GNWGG-----------SAADEWRNAP-------------------
RSSA_DICDI       --------------------------------PIAEWSAPDN------------------
RSSA_GIAIC       ------------------------------------------------------------
RSSA_ENCCU       ----------------------------------DEWNSF--------------------
RSSA_NOSCE       ----------------------------------AGWGIEPSLVSTEAVSEFSDNWKN--
RSSA_ENTBH       ----------------------------------DEFGKIIYK-----------------
                                                                             

RSSA_ECHGR       ---------------------
RSSA_SCHJA       ---------------------
RSSA_AEDAE       ------GGF------------
RSSA_CULQU       ------GGF------------
RSSA_ANOGA       ------GGAAF----------
RSSA_DROSE       ------GQF------------
RSSA_DROSI       ------GQF------------
RSSA_DROTE       ------GQF------------
RSSA_DROYA       ------GQF------------
RSSA_DROER       ------GQF------------
RSSA_DROAN       ------GQF------------
RSSA_DROPE       ------GQF------------
RSSA_DROPS       ------GQF------------
RSSA_DROWI       ------GQF------------
RSSA_DROMO       ------GQF------------
RSSA_DROVI       ------GQF------------
RSSA_DROGR       ------GQF------------
RSSA_DIACI       S--NSTSQW------------
RSSA_MACHI       ----ATGNW------------
RSSA_BOMMO       -----AQDWSAA---------
RSSA_URECA       AAATTTESWGGSGAENWG---
RSSA_PINFU       NGRWHLRNWG-----------
RSSA_TRIGR       QEFTATDDWGGAASNDWAISS
RSSA_ORNPR       -----DNSWAS----------
RSSA_NEMVE       -----STDWA-----------
RSSA_SUBDO       -----GGEWGNTEPKASTGNW
RSSA_TRIAD       -----GGEWGS----------
RSSA_HYDVD       -----TEDWA-----------
RSSA_CAEEL       ---------------------
RSSA_CAEBR       ---------------------
RSSA_BRUMA       ---------------------
RSSA_LEIIN       ---------------------
RSSA_LEIMA       ---------------------
RSSA_LEIBR       ---------------------
RSSA_MONBE       -----GEEWTN----------
RSSA1_YEAST      ---------------------
RSSA1_YEAS7      ---------------------
RSSA1_YEAS1      ---------------------
RSSA2_YEAST      ---------------------
RSSA2_YEAS1      ---------------------
RSSA2_YEAS7      ---------------------
RSSA_CANGA       ---------------------
RSSA_ZYGRC       ---------------------
RSSA1_VANPO      ---------------------
RSSA2_VANPO      ---------------------
RSSA_KLULA       ---------------------
RSSA_ASHGO       ---------------------
RSSA_LACTC       ---------------------
RSSA_KOMPG       ---------------------
RSSA_CANAL       ---------------------
RSSA_CANAW       ---------------------
RSSA_CANDC       ---------------------
RSSA_CANTR       ---------------------
RSSA_LODEL       ---------------------
RSSA_DEBHA       ---------------------
RSSA_PICST       ---------------------
RSSA_PICGU       ---------------------
RSSA_CLAL4       ---------------------
RSSA_NEUCR       ESS-W----------------
RSSA_PODAN       ESS-W----------------
RSSA_CHAGB       DTAGW----------------
RSSA_MAGO7       KEGQW----------------
RSSA_NECH7       KETTW----------------
RSSA_ASPFC       --AKW----------------
RSSA_ASPFU       --AKW----------------
RSSA_NEOFI       --AKW----------------
RSSA_ASPCL       --AKW----------------
RSSA_ASPTN       G-AKW----------------
RSSA_ASPOR       --GKW----------------
RSSA_ASPFN       --GKW----------------
RSSA_ASPNC       --AKW----------------
RSSA_EMENI       G-AKW----------------
RSSA_PENRW       GEAKW----------------
RSSA_TALMQ       ---------------------
RSSA_TALSN       ---------------------
RSSA_COCIM       -ETKW----------------
RSSA_COCP7       -ETKW----------------
RSSA_UNCRE       -EAKW----------------
RSSA_AJEDR       AGVKW----------------
RSSA_BLAGS       AGVKW----------------
RSSA_AJECG       AGVKW----------------
RSSA_PARBD       -SVKW----------------
RSSA_PARBP       -SVKW----------------
RSSA_PARBA       -SVKW----------------
RSSA_ARTOC       -EPKW----------------
RSSA_BOTFB       -TEQW----------------
RSSA_SCLS1       ATEQW----------------
RSSA_PHANO       PATQW----------------
RSSA_PYRTR       ATTQW----------------
RSSA_YARLI       ---------------------
RSSA_PNECA       HAQNWN---------------
RSSA1_SCHPO      ---------------------
RSSA1_SCHJY      ---------------------
RSSA2_SCHPO      ---------------------
RSSA2_SCHJY      ---------------------
RSSA3_SCHJY      ---------------------
RSSA_COPC7       ---------------------
RSSA_POSPM       ---------------------
RSSA_LACBS       ---------------------
RSSA_MALGO       ---------------------
RSSA_USTMA       ---------------------
RSSA_CRYNJ       ---------------------
RSSA1_ARATH      WE-------------------
RSSA_BRANA       WE-------------------
RSSA2_ARATH      WE-------------------
RSSA_CICAR       WE-------------------
RSSA_VITVI       WE-------------------
RSSA_DAUCA       WE-------------------
RSSA_CHLRE       GAF------------------
RSSA_OSTLU       Y--------------------
RSSA_OSTTA       Y--------------------
RSSA_PLABA       ---------------------
RSSA_PLAYO       ---------------------
RSSA_PLACH       ---------------------
RSSA_PLAF7       ---------------------
RSSA_PLAKH       ---------------------
RSSA_PLAVS       ---------------------
RSSA_TOXGO       W--------------------
RSSA_THEAN       ---------------------
RSSA_THEPA       ---------------------
RSSA_CRYHO       ---------------------
RSSA_DICDI       ---------------------
RSSA_GIAIC       ---------------------
RSSA_ENCCU       ---------------------
RSSA_NOSCE       ---------------------
RSSA_ENTBH       ---------------------