CLUSTAL format seed alignment for MF_03026

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LZTS2_HUMAN           MAIVQTLPVPLEPAPEAATA-------------------PQAPVMGSVSSLISGRPCP--
G3RHD5_GORGO          MAIVQTLPVPLEPALEAATA-------------------PQAPVMGSVSSLISGRPCP--
A0A2J8XYA5_PONAB      MAIVQTLPVPLEPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
G1RXP2_NOMLE          MAIVQTLPVPLEPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
G7PDS3_MACFA          MAIVQTLPVPLEPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
F7AYC6_MACMU          MAIVQTLPVPLEPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
F7EEG2_CALJA          MAIVQTLPVPLEPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
H0X7X1_OTOGA          MAIVQTLPVPLDPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
F6ZIR0_HORSE          MAIVQTLPLPLEPAPEAATA-------------------PQAPAMGSVSSLISGRPCP--
G1PNF0_MYOLU          MAIVQTLPVPLEPAPEATTT-------------------PQAPAMGSVSSLISGRPCP--
LZTS2_BOVIN           MAIVQTLPVPLEPAPEAATA-------------------QQAPAMGSVSSLISGRPCP--
G3T4Q1_LOXAF          MAIVQTLPVPLEPTPEAATA-------------------PQTPAMGSVSSLISGRPCP--
G1MGT8_AILME          MAIVQTLPVPLEPAPEATTA-------------------PQAPAMGSVSSLISGRPCP--
LZTS2_MOUSE           MAIVHTLPVPLEPARETATA-------------------PKTPAMGSVSSLISGRPCP--
LZTS2_RAT             MAIVQTLPVPLEPARETATA-------------------PQTPAMGSVSSLISGRPCP--
G1SVA0_RABIT          MAIVHTLPVPLEPAPEAATA-------------------TQAPAMGSVSSLISGRPCP--
I3MPE6_ICTTR          MAIVHTLPVPLEPAPEATAA-------------------PQAPTMGSVSSLISGRPCP--
G5CAF0_HETGA          MAIVHTVPVPLEPTPEAATA-------------------PRVPAMGSVSSLISGRPCP--
F7CV17_MONDO          MAIVQTLAVPLEATPESAAPH-----------------PPHLPTMGSVSSLISGRPCP--
I3JM63_ORENI          MALVQPLPVSAEPHTPGLSGGARRRHPSAP-SPPINAPLATLDPMGSVGSLITTHPGPYQ
E6ZHX6_DICLA          MALVQALPISAEPRNPGLSGGARRRYPSGS-SPPNNAPPSALDPMGSVSSLIATRPGPYQ
H2M7L2_ORYLA          MALVQALPVSAEPHTPVHSRGARRRHRSGP-SPPINLPPPILNSMGSVGSLVPAHPGPYQ
H3DAA2_TETNG          MALVQALPVSAEPHN-------------RS-SPP----PSTLEPMGSVGSLVAARPGPYL
H2SEC6_TAKRU          MALVQALPISAEPHNPGLSVGARRRHPSGS-SPPINALPSTREPMGSVSSLIAARPGPYL
G3NGY7_GASAC          MALVQAPPLSAEPHNPGHIGGSRRRHPSSS-SPSTNAAPPALDPMGSVSSLVAARAAPYQ
E7EYJ6_DANRE          MALVQSLPVSIDPRLH----------------------PAELGAMGAVSSMIPNHIT--Y
B8A6E8_DANRE          MALVQALPVPTDHPKPS------TDVQQCC-SVSHSPTVDVTGTMGSVSSLISGRTYQER
H2LSV1_ORYLA          MALVQALPVSDHPNPGVDIQQCRPLSPHSP---------SSEPTMGSVSSLISGRTYQER
I3KQ33_ORENI          --------------------------------------------MGSVSSLISGRTYQER
H3CTC5_TETNG          MALVQALPVTDHPNP----------------GPVSCGPCGTGTVMGSVSSLISGRTYQER
H2U4M6_TAKRU          MALVQALPVTDHPKPGLDVQQCRPLSSHSPSGPGSCGPCGTGTAMGSVSSLISGRTYQER
G3NZ56_GASAC          --------------------------------------------MGSVSSLVSGRTYQER
LZTS2_XENLA           MAAVQALPLSIDQNTEASGSQ-SHTNTRSP---------VTENTMGSVSSLISGRTYHDK
LZTS2_XENTR           MAALQALPLSIDQNAEVSGSQ-SHTNTRSP---------VTENTMGSVSSLISGRTYHDK
H3A1M8_LATCH          MAIVQTLPVPIEQVSDADAHLLPAARSPSS---------SSQSTMGSVSSLISGRPYSDK
H9GH55_ANOCA          MAIVQTLPVSIESASEGAAQL----HNSAC---------PSPIAMGSVSSLISGR-----
                                                                  **:*.*::. :     

LZTS2_HUMAN           -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTS-----
G3RHD5_GORGO          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTS-----
A0A2J8XYA5_PONAB      -----GGPAPSRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTS-----
G1RXP2_NOMLE          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTT-----
G7PDS3_MACFA          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTS-----
F7AYC6_MACMU          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTS-----
F7EEG2_CALJA          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPVTS-----
H0X7X1_OTOGA          -----GGPAPPRHHGPSGPTFFRQQDGLLR--GGYEGQEPLCPAVPPRKAVPGTT-----
F6ZIR0_HORSE          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPGTS-----
G1PNF0_MYOLU          -----GGPAPSRHHGPPGPTFFRQQDGLLR--GGYDAQEPLCPAVPPRKTVPGTT-----
LZTS2_BOVIN           -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKAVPGTN-----
G3T4Q1_LOXAF          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYGAQEPLCPDVPPRKAVPGTS-----
G1MGT8_AILME          -----GGPAPPRHHGPPGPTFFRQQDGLLR--GGYEAQEPLCPAVPLRKAVPGTS-----
LZTS2_MOUSE           -----GGPAPQRHHGVPGPTFFRQQDGLLP--GGYEAQEPLCPAVPPRKAVPGNS-----
LZTS2_RAT             -----GGPAPQRHHGVPGPTFFRQQDGLLR--GGYEAQEPLCPAVPPRKTVPGNS-----
G1SVA0_RABIT          -----GGPAPSRHHGPPGPTFFRQQDGLLR--GSYEAQEPLCPAVPPRKTVPGAS-----
I3MPE6_ICTTR          -----GGPAPSRHHCPPGPTFFRQQDGLLR--GGYETQEPLCPAVPPRKNVPGTS-----
G5CAF0_HETGA          -----GGLAPPRHHGPSGPTFFRQQDGLLR--GTYEAQEPLCPAVPPRKVGPGPS-----
F7CV17_MONDO          -----GGGPAPCHHTPSGPPFFRQQDGLLLRGGGCRVQEPLCPPVPTRKPMGNAG-----
I3JM63_ORENI          DHRPIVELGARVRRPTPGVSCVDSE--------SPQQDLLLQSIPPIKKQSSTTSSR---
E6ZHX6_DICLA          DHRSGVELGARVRRPTPGAPCLGSE--------SPQ-DPLLQSNPPLKKQSSTSSNR---
H2M7L2_ORYLA          DHRSDIELGSRVRRPLPGAPCLELE--------SPQ-DTALQSLPSLKIQSSTASSR---
H3DAA2_TETNG          EHHAGAELGARVRRQTPGTSVPGSE--------SPQEP-LLHNLLPHKKAGST-------
H2SEC6_TAKRU          DHHSGAELGARVRRQTPGAPCLGSE--------SPQDP-LLHNILPLKKQSSTMSSR---
G3NGY7_GASAC          DYRPIGELGARVRRPTPGAPCLGSE--------SPLDPLFLQSIPPLVKQSSTASGK---
E7EYJ6_DANRE          PERADIEVSTNFRKGTPDSGRLLWD--------VPQ----AGSRTPGNRRRAIVG-----
B8A6E8_DANRE          HCRAASDFGARYRKPTPATSCFRQQEGTLR--SSSSQEQLLNSQPPLPAKNKSS------
H2LSV1_ORYLA          HCRAASEFNIKPRRSTPATNCFRIQD------KTLRSGSSLEQLLVVSNQTQPQATS---
I3KQ33_ORENI          HCRAASEFNTKPRRSTPATSCFRLHD------NTLRSGSSLEQLLA--------------
H3CTC5_TETNG          HCRAASEFPTKARRSTPATNCFRLQD------NTLRSGSSLEQLAGCQQPDPSPGP----
H2U4M6_TAKRU          HCRAASEFPTKARRSTPATNCFRLQD------NTLRSGSSLEQLLAVNNQTHPQAK----
G3NZ56_GASAC          HCRAASEFTAKSRRSTPATSCFRLQD------DTLRSGSSLEQLLVISNQTLPQAEVLPP
LZTS2_XENLA           QCRA-SEFSNKCRKPTNMPNCFKQQEGLLK--TNYSSQDFLFNGLPTKKPSTTTSGNN--
LZTS2_XENTR           QCKA-SELSNKCRKPTNMPNCFKQQEGLIK--SNYSSQDPLFNGLPTKKPSTTTSGNN--
H3A1M8_LATCH          QCKA-SEFSAKSRKPAHVPSIFRQQDGLLK--NGYS-QDPLFHGLPTKKPSSGLAGS---
H9GH55_ANOCA          ----------PCHKATPEFGPFR-----LP--GGAGSQEPLCHGLPTKKNS---------
                                  ::                                              

LZTS2_HUMAN           -----------------------------FTYINEDF----RTES-----PPSPSSDVED
G3RHD5_GORGO          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
A0A2J8XYA5_PONAB      -----------------------------FTYINEDF----RTES-----PPSPSSDVED
G1RXP2_NOMLE          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
G7PDS3_MACFA          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
F7AYC6_MACMU          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
F7EEG2_CALJA          -----------------------------FTYVNEDF----RTES-----PPSPSSDVED
H0X7X1_OTOGA          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
F6ZIR0_HORSE          -----------------------------FTYINEDF----RTES-----PPSPSSDIED
G1PNF0_MYOLU          -----------------------------FTYINEDF----RTES-----PSTPSSDIED
LZTS2_BOVIN           -----------------------------FTYINEDF----RTES-----PPSPSSDLED
G3T4Q1_LOXAF          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
G1MGT8_AILME          -----------------------------FTYINEDF----RTES-----PPSPSSDLED
LZTS2_MOUSE           -----------------------------FTYVNEDF----RTES-----PPSPSSDVED
LZTS2_RAT             -----------------------------FTYVNEDF----RTES-----PPSPSSDVED
G1SVA0_RABIT          -----------------------------FTYINEDF----RTES-----PPSPSSDVED
I3MPE6_ICTTR          -----------------------------FTYINEDF----RTET-----PPSPSSDIED
G5CAF0_HETGA          -----------------------------FSYINEDF----QTES-----PSSPSSDVED
F7CV17_MONDO          -----------------------------FAYINEDF----RGDS-----PSSPCSDTED
I3JM63_ORENI          -------------------GLEKETGNGNYTYLNEDY-IGDWNDN--HVTPGSPGSELDE
E6ZHX6_DICLA          -------------------GLEKESGNGNYTYLNEDY-VGDWNDN--HVTPASPASDVDE
H2M7L2_ORYLA          -------------------RLE-DSGNGYYGYLKEDY-VDDWNDN--YITTTVLGGDADE
H3DAA2_TETNG          ----------------------------NYAYLNEEY-VDDWNDN--YVMPASPGSDTDE
H2SEC6_TAKRU          -------------------GPERENANGNYAYVSEDY-VDDWNDN--YVTAASLGNDMDE
G3NGY7_GASAC          -------------------GPERESGNGSYTYLNEDY-MGDWNDD--RLARASPGSDADE
E7EYJ6_DANRE          ----------------------RAKGFGTRSYSHEDL-IRDWNDN--HMD----------
B8A6E8_DANRE          --------------------ALISAGNGNYGYLSDEP-VGDWNDN--HVSTCSPSSDTEE
H2LSV1_ORYLA          -----------------------GASNGNFGYVSDKVVVEDWNDNLML-RTTSPCSDLED
I3KQ33_ORENI          ---------------------------------SKEVVVGDWNDNLVL-TAASPCSDSED
H3CTC5_TETNG          ------------------------RCASPVAHQA------DWNDNVVVVAATSPCSDSED
H2U4M6_TAKRU          ------------------------ATNGNLGHTSNEVVVGDWNDNVVV-AATSPCSDSED
G3NZ56_GASAC          PLPTKKQPRPGNSAGASGGAPAGVATNGNLGFVSDEVVIGEWKDNSVE-ATASPCSDSED
LZTS2_XENLA           ---------------------------GNYVYVNEDF-KEEWHDA---RVPISPSSDAED
LZTS2_XENTR           ---------------------------GNYVYVNEDF-KEEWHEP---RVPISPSSDAED
H3A1M8_LATCH          ---------------------------GNFTYVTDDP-NGDWSEN---RSPSSPCSDSEE
H9GH55_ANOCA          -----------------------------FAYASE----EDWAEV---VSPISPCSDADE
                                                                 :                

LZTS2_HUMAN           AREQRAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFMGPR
G3RHD5_GORGO          AREQRAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFMGPR
A0A2J8XYA5_PONAB      AREQRAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFMGPR
G1RXP2_NOMLE          AREQQAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFMGPR
G7PDS3_MACFA          AREQRAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFMGPR
F7AYC6_MACMU          AREQRAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFMGPR
F7EEG2_CALJA          PREQRARNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPRPRGAPSLPSFMGPR
H0X7X1_OTOGA          AREQRARNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFLGPR
F6ZIR0_HORSE          AREQRARNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFLGPR
G1PNF0_MYOLU          AREQRARNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFLGPR
LZTS2_BOVIN           AREQRARNAHLRGPPPKLIPVSGKLEK-NMEKIVIRPTAFKPVLPKPRGVPSLPSFLGPR
G3T4Q1_LOXAF          AREQRAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFLGPR
G1MGT8_AILME          AQEQRARNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFLGPR
LZTS2_MOUSE           PREHQAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPGFLGPR
LZTS2_RAT             PREHQAHNAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPGFLGPR
G1SVA0_RABIT          ARGQQARSAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPALPGFLGPR
I3MPE6_ICTTR          TREQRARSAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGAPSLPSFLGPR
G5CAF0_HETGA          AREQRARNAHLRGPPPKLIPVSGKLEK-NMEKVLIRPTAFKPVLPRCRGAPSLPSFLGPR
F7CV17_MONDO          VREQ-ARSAHLRGPPPKLIPVSGKLEK-NMEKILIRPTAFKPVLPKPRGPPSLPAFLGPR
I3JM63_ORENI          LKEGL--NGNIGGPPPKLIPVSGKLEK-NMEKTVLRPTAFKPVIPKSRS--SMQ-YLSPR
E6ZHX6_DICLA          IKEGLGLNGNMGGPPPKLIPVSGKLER-NMEKTVLRPTAFKPVIPKSRT--SMQ-YLSPR
H2M7L2_ORYLA          NQEELGLNGNMGGPPPKLIPESGKLER-NMEKTVLRPTAFKPVIPKNRS--SMQ-YLSPR
H3DAA2_TETNG          MKGGAGIHENMEGPPPKLIPVSGKLEK-NMEKTVLRPTAFKPIVPKSRA--SMQ-YLSPR
H2SEC6_TAKRU          IKGGSGINGNLEGPPPKLIPVSGKLEK-NMEKTVLRPTAFKPIVPKSRA--SMQ-YLSPR
G3NGY7_GASAC          TKG-SGFIGTMGGPPPKLIPVSGKLEK-NMEKTVLRPTAFKAVIPKSRT--SMQ-YLSPR
E7EYJ6_DANRE          ----VGMTSAVDGPP-KLVPVSGQLER-NIQQAIIRPTAFKPVIPKSRN--TAQ-FLSPR
B8A6E8_DANRE          PSDNRGMNGNIGGPPPKLVPVSGRLEKVSMEKILIRPTAFKPVLPKNRN--SVQ-YLSPR
H2LSV1_ORYLA          QKDNRTLNGNISGPPPKLVPVSGQLEK-NMEKVLIRPTAFKPVVPKNRH--SVQ-YLTLR
I3KQ33_ORENI          QKDNRTLNGNIGGPPPKLIPVSGQLEK-NMEKVLIRPTAFKPVVPKNRH--SVQ-YLSPR
H3CTC5_TETNG          QRDNRTLNGNIGGPPPKLIPVSGQLEK-NMEKVLIRPTAFKPVVPKNRH--SVH-YLSPR
H2U4M6_TAKRU          QRDNRTLNGNIGGPPPKLIPVSGQLEK-NMEKVLIRPTAFKPVVPKNRH--SVH-YLSPR
G3NZ56_GASAC          QRDSR--TGNIGGPPPKLIPVSGQLEK-NMEKVLIRPTAFKPVIPKNRH--SVH-YLLPR
LZTS2_XENLA           IREERSINGNIRGPPPKLIPISGKLEK-NVEKTLIKPTAFKPVVPKKRNP-SLQ-YLVQR
LZTS2_XENTR           IREERALNGNIRGPPPKLIPVSGKLEK-NVEKTLIKPTAFKPVVPKKRNS-SLQ-YLVQR
H3A1M8_LATCH          VRDERTLNGNIRGPPPKLIPVSGKLEK-NMEKNLIRPTAFKPVVPKNRNS-SLQ-YLAPR
H9GH55_ANOCA          LQDEKPRVGTIRGPPPKLVPVSGKLEK-NIEKTLIRPTAFKPVMPKNRNP-PLQGHLALR
                                : *** **:* **:**: .::: :::*****.::*: *   .   .:  *

LZTS2_HUMAN           AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLAFSGW
G3RHD5_GORGO          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLAFSGW
A0A2J8XYA5_PONAB      AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLAFSGW
G1RXP2_NOMLE          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLAFSGW
G7PDS3_MACFA          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLAFSGW
F7AYC6_MACMU          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLAFSGW
F7EEG2_CALJA          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLALSGW
H0X7X1_OTOGA          AA---GLSGSQGSLTQLFGAPAS------------SSSSSSSSS-----AADKPLALSGW
F6ZIR0_HORSE          AA---GLSGSQGSLTQLFGGPAS------------SSSSSSSS------AADKPLALSGW
G1PNF0_MYOLU          AT---GLSGSQGSLTQLFGGAAS------------SSSSSSSS------AADKPLALSGW
LZTS2_BOVIN           AT---GPSGSQGSLTQLFGGPAS------------SSSSSSSS------AADKPLILSGW
G3T4Q1_LOXAF          AS---GLSGSQGSLTQLFGGPAS------------SSSSSSSS------AADKPLALSGW
G1MGT8_AILME          AA---GLSGSQGSLTQLFGGPAS------------SSSSSSSS------AADKPLALSGW
LZTS2_MOUSE           AA---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLALSGW
LZTS2_RAT             AA---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLALSGW
G1SVA0_RABIT          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLALSGW
I3MPE6_ICTTR          AT---GLSGSQGSLTQLFGGPAS------------SSSSSSSSS-----AADKPLALSGW
G5CAF0_HETGA          AT---GLSGSQGSLTQLFAGAGS------------SSSSSSSSSSSSSSAADKPLALSGW
F7CV17_MONDO          AGVG-GLSGSQGSLTQLFGGPAS------------SSSSSSSSS------AEKPLTLSGW
I3JM63_ORENI          HCAN--APESQNNLNLLSP-------------THRDVSPSCSEK-----RSSYSGGRNAA
E6ZHX6_DICLA          HCAN--VPESQNNLNLLSP-------------THREVSPSCTEK-----CNLYSRARNSG
H2M7L2_ORYLA          HCAS--ALENQSNLNLLSP-------------THIDMSPSCSEK-----RSSFSGGRNVS
H3DAA2_TETNG          HTAG--APESQNNLNLLTP-------------AHRELSPCVSDK-----SALYSRSRNSV
H2SEC6_TAKRU          HSAS--VSESQNNLNLL-----------------RELSPSASEK-----SHLYSRTRNSI
G3NGY7_GASAC          HCAN--APESQNHLNLL-----------------SPAHTDASEK-----SAAYGRARVS-
E7EYJ6_DANRE          LGTG--LSGSQGNLSRFSP-------------DAEDVSHATLER-----RSSYSGARNAL
B8A6E8_DANRE          SGGS--LSESQGSLNLLLP-------------G-TGAGSGCQEK-----RNSYSGGRNAR
H2LSV1_ORYLA          AGGSN-LSESQASINLLLPLAGS-------------NGANSTSK-----HNSFTGGRNAR
I3KQ33_ORENI          PGAST-LSESQASLNLLLPHGGS-------------CSASGTN-----------------
H3CTC5_TETNG          PGGGT-LSESQASLNILLPNGASG-----TTGIVMSSSSSSEGK-----CSSYCGGQNAR
H2U4M6_TAKRU          PGGSN-LSASQASLNILLPNTAST-----TTGIVMSSSSSSEG-------------RNAR
G3NZ56_GASAC          PGGS--LTESQASLNLLLPLAGSNGGGAGANGIGGSSSSGSEGK-----RNSYSGGRNAR
LZTS2_XENLA           NGGPG-LSESQSSLNLLFN----------------GNSAGIPEK-----HNSLSCRNIAH
LZTS2_XENTR           NGGPG-LSESQSSLNLLFN----------------GNAAGIPEK-----HNLLSCRNSTH
H3A1M8_LATCH          AGGSG-LSESQSSLNLLFS----------------GNPQWGPEK-----RNSFSCRNSSN
H9GH55_ANOCA          PGGTAVLSESQASFAQLFG----------------GTHVGNTEK-----HSSLSCRTSSH
                               .*  :  :                                           

LZTS2_HUMAN           ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPG-----PARG
G3RHD5_GORGO          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPG-----PARG
A0A2J8XYA5_PONAB      ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPG-----PARG
G1RXP2_NOMLE          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPG-----PARG
G7PDS3_MACFA          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPG-----PARG
F7AYC6_MACMU          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPG-----PARG
F7EEG2_CALJA          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPATSSPGGHLPSHGSGRGALPG-----PARG
H0X7X1_OTOGA          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPATSSPGGHLSSHGPGRGAQPG-----PARG
F6ZIR0_HORSE          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPATNSPGSHLPSHGPGRGALPG-----PARG
G1PNF0_MYOLU          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPATNSPGGHLPSHGPGRGVLPG-----PARG
LZTS2_BOVIN           ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPATNSPGGHLPSHGPGRGALPG-----PARG
G3T4Q1_LOXAF          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEAATNSPGGHLPSHGPGRGPLSG-----PARG
G1MGT8_AILME          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPATHSPGGHLPSHGPGRGALPG-----PARG
LZTS2_MOUSE           ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTNSPGGHLPSHGPGRGALPG-----PARG
LZTS2_RAT             ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTANSPGGHLPSHGPGRGPLPG-----PARG
G1SVA0_RABIT          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPAASSPGGHLSSHGPARGPLPG-----PARG
I3MPE6_ICTTR          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPVTTSPGGHLPSHGSGRGALPG-----PARG
G5CAF0_HETGA          GSGCPSGTLSDSGRNSLSSLPTYSTGGADPPTSSPGGHLPAHGPGRGAVPG-----LARG
F7CV17_MONDO          ASGCPSGTLSDSGRNSLSSLPTYSTGGAEPVGGSPVGHLPSDGPGRGVLPGTG--GSHRG
I3JM63_ORENI          GGNSQSCSLSDSGRNSLASLPPYSAASYNLPPGEAS------AGHLEPMKSAPPVT----
E6ZHX6_DICLA          GGSGHSCQLSDSGRNSLASLPPYSNAGYSQASGEAS------AGHLEPMKSAPPVS----
H2M7L2_ORYLA          SSSSQSCSLSDSGRNSLSSLPPYNGANYNMATGDLS------ASHPEAARGVPLVG----
H3DAA2_TETNG          GG----MQLSDGERSSLSSLPPYSSAVYSQALGEAP------AGPLEPMKCGAPV-----
H2SEC6_TAKRU          GG----MQLSDCERSSLSSLPPYNSAIYGQAPGEAP------AGPQEPIKCAPPI-----
G3NGY7_GASAC          ------SQLTDSGRNSLSSLPPYGGG-CGLASGEAP------AGHPEPTSG---------
E7EYJ6_DANRE          FS--QSFTMTETPRGSLTNLPAYTQQHVESSK----------------------------
B8A6E8_DANRE          SS--QSCTMSDSGRNSLSSLPTYSSTGYSLTQSEVP------NGHMETTRSGV-------
H2LSV1_ORYLA          SS--QSCSMSDSGRNSLSSLPTHSSTGCSLAPSEGSNSGSGSGGQAEPVPCLGRNTSVGS
I3KQ33_ORENI          -----------SGRNSLSSLPTHSSTG------------SGSGGQLEPVSGIGRNTSGGS
H3CTC5_TETNG          SS--QSCSMSDSGRNSLSSLPTHSSTGYSLAPSEGSSSGSGSGAQLEPATALGRNPSGGS
H2U4M6_TAKRU          SS--QSCSMSDSGRNSLSSLPTHSSTGYSLAPSEGSSSGSGSGGQLEPVTGLGRNPAGGN
G3NZ56_GASAC          GS--QSYSMSDSGRNSLSSLPTHSSTGYSLAPSEGS---GSSGVQLEPAPGLGRNTSGAS
LZTS2_XENLA           SG-----TMSDSGRTSLSSLPTSNTNCSHQLDSVSVSMGHINLDNHSNLNGYSDRASRG-
LZTS2_XENTR           SG-----TMSDSGRTSLSSLPTYSTNCSHQMDPVSVSMGHINLDNHTNINGYSDRAPRG-
H3A1M8_LATCH          SG-----TMSDSGRNSLSSLPTCSTGCSQQLEPVSASMGHISLDGHGKANGFGDRGSRGP
H9GH55_ANOCA          SG-----TMSDSGRNSLSSLPTYSTGCSQQMEPVSISMGHINLDSHGS------SSSRG-
                                   * **:.**.                                      

LZTS2_HUMAN           VPTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGTRASPDSSSCGERSP---PPPPPP
G3RHD5_GORGO          VPTGPSHSDSGR--SSSSKSTGSLGGRVAGGFLGSGTRASPDSSSCGERSP---PPPPPP
A0A2J8XYA5_PONAB      VPTGPSHSDSGR--SSSSKSTGSLGGRVAGGFLGSGTRASPDSSSCGERSP---PPPPPP
G1RXP2_NOMLE          VPTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGTRASPDSSSCGERSP---PPPPPP
G7PDS3_MACFA          VPTGPSHSDSGR--SSSSKSTGSLGGRVAAGLLGSGTRASPDSSSCGERSP---PPPPPP
F7AYC6_MACMU          VPTGPSHSDSGR--SSSSKSTGSLGGRVAAGLLGSGTRASPDSSSCGERSP---PPPPPP
F7EEG2_CALJA          APTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGTRVSPDSSSCGERSP---PPPPPP
H0X7X1_OTOGA          APTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGPRASPDNSSCGERSP---PPPPPP
F6ZIR0_HORSE          APTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGPRGSPDSSSCGERSP---PPPPPP
G1PNF0_MYOLU          APTGPSHSDSGR--SSSSKSTGSLGGRMAGGLLGSGPRASPDSSSCGERSP---PPPPPP
LZTS2_BOVIN           APTGPSHSDSGR--SSSSKSTGSLGGRLAGGLLGSGPRASPDSSSCGERSP---PPPPPP
G3T4Q1_LOXAF          APAGPSHSDSGR--SSSSKSTGSLGGRMAGGLLGSGPRASPDSSSCGERSP---PPPPPP
G1MGT8_AILME          APTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGARAP--------------------
LZTS2_MOUSE           VPTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGARASPGSSSGGDRSP---PPPPPP
LZTS2_RAT             VPTGPSHSDSGR--SSSSKSTGSLGARVAGGLLGSGARASPGSSSGGDRSP---PPPPPP
G1SVA0_RABIT          APTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGARASPDSSSCGERSP---PPPPPP
I3MPE6_ICTTR          APTGPSHSDSGR--SSSSKSTGSLGGRVAGGLLGSGPRASPDSS-CGDRSP---PPPPPP
G5CAF0_HETGA          APTEPSHSDSGR--SSSSKSTGSMGGRMAGGPVGRGPQASPDSGSCGDRSP---PPPP--
F7CV17_MONDO          VPIGPSNSDSGR--SSSSKSTGSRGGLLSGG----GTRVSPDSGSCGDRSPLPGPPPPPP
I3JM63_ORENI          -VHGHSNSDSGRSSSSKSTGSGSISGR---------GQPLSDSGSGG---R-------SP
E6ZHX6_DICLA          -GHGHSNSDSGRSSSSKSTGSGSISGR---------GQPLSDSGSSG---R-------SP
H2M7L2_ORYLA          -AHGHSNSDSGRSSSSKSTGSGSLSGR---------GQPLSDSGSSG---R-------SP
H3DAA2_TETNG          --SGHSNSDSGR-SSSKSTGSGSISGR---------AQPLSDSGSGG---R-------SP
H2SEC6_TAKRU          --GGHSNSDSGR-SSSKSTGSGSISGR---------GQPLSDSGSSG---R-------SP
G3NGY7_GASAC          --HGHSNSDSGR-SSS-SKSTGSMSGR---------GQPPSDSGSSG---R-------SP
E7EYJ6_DANRE          -LPGNCSSDSGR--SSSSKSTGSLGGR---------GHMLSDRGSAG---P-------SP
B8A6E8_DANRE          -GHGHSNSDSGR--SSSSKSTGSLSGR---------GQPLSDSGSCG---R-------SP
H2LSV1_ORYLA          GSHGHNNSDSGRSSSSKSTGSGSLSGR---------GQPLFDSGSCG---H-------ST
I3KQ33_ORENI          GSHGHSNSDSGRSSSSKSTGSGSLSGR---------GQPLSDSGSCG---H-------SP
H3CTC5_TETNG          GSHSHTNSDSGRSSSSKSTGSGSLSGR---------GQPLSDSGSCG---H-------SS
H2U4M6_TAKRU          GSHSHTNSDSGRSSSSKSTGSGSLSGR---------GQPLSDSGSCG---H-------SS
G3NZ56_GASAC          GSHGHTNSDSGRSSSSKSTGSGSLSGR---------GQPLSDSGSCG---H-------SP
LZTS2_XENLA           -RTRPSNSDSGR--SSSSKSTGS-------------------------------------
LZTS2_XENTR           -RTRPTNSDSGR--SSSSKSTGSLSGR---------GNPSSDSGSCD------------R
H3A1M8_LATCH          -AGGLSNSDSGR--SSSSKSTGSLNGR---------GHPLSDSGSCG------------R
H9GH55_ANOCA          -LTGPSNSDSGR--SSSSKSTGSLNGR---------GHHSSDSGSCGGHSP-------VH
                             *****  ** *..:**                                     

LZTS2_HUMAN           P--SDEALLHCVLEGKLRDR----EAELQQLRDSLDENEATMCQA---------------
G3RHD5_GORGO          P--SDEALLHCVLEGKLRDR----EAELQQLRDSLDENEATMCQA---------------
A0A2J8XYA5_PONAB      P--SDEALLHCVLEGKLRDR----EAELQQLRDSLDENEATMCQA---------------
G1RXP2_NOMLE          P--SDEALLHCVLEGKLRDR----EAELQQLRDSMDKNEATMCQA---------------
G7PDS3_MACFA          P--SDEALLHCVLEGKLRER----EAELQQLRDSLDENEATMCQA---------------
F7AYC6_MACMU          P--SDEALLHCVLEGKLQER----EAELQQLRDSLDENEATMCQA---------------
F7EEG2_CALJA          P--SDEALLHCVLEGKLRDR----EAEFQQLRDGLEENEATLCQA---------------
H0X7X1_OTOGA          PP-SDEALLHCVLEGKLRDR----EAELQQLRDNLDESEATMCQA---------------
F6ZIR0_HORSE          PPPSDEALLHCVLEGKLRDR----EAELQQLRDSLDESEVTVCQG---------------
G1PNF0_MYOLU          PPPSDEALLHCALEGKLRDR----EAELQQLRDSLDESEVTMCQV---------------
LZTS2_BOVIN           PPPSDEALLHCVLEGKLRDR----EAELQQLRDSLDESEVTMCQV---------------
G3T4Q1_LOXAF          PP-SDEALLHCVLEGKLRDRDR--EAELQQLRDSLDESEVTVCQA---------------
G1MGT8_AILME          ----DEALLHCVLEGKLHDR----EAELQQLRDSLDESEVTMCQV---------------
LZTS2_MOUSE           PP-SDEALLHCVLEGKLRDR----EAELQQLRDSMDESEATVCQA---------------
LZTS2_RAT             PP-SDEALLHCVLEGKLRDR----EAELQQLRDSVDESEAAVCQA---------------
G1SVA0_RABIT          PP-SDEALLHCVLEGKLRDR----EAELQQLRDSLDEGEATVCQV---------------
I3MPE6_ICTTR          PP-SDEALLHCVLEEKLRDRDRDREADLQQLRDSLDESEATMCQA---------------
G5CAF0_HETGA          ---SDEALLHCVLEGKLRAR----EAELQQLRDSLEESEATECQA---------------
F7CV17_MONDO          PPLPDESLLRCALQEKLRER----EAELQQLRDSLDENEAAICQV---------------
I3JM63_ORENI          GPVEGYEGVVRDLEDKLRER----ELELQQLRDNLDENEAAICQV---------------
E6ZHX6_DICLA          GPVEGYEGVVRDLEDKLRER----ELELQQLRDNLDENEAAICQV---------------
H2M7L2_ORYLA          APVEGYEGVVRDLEDKLRER----EMELLQLKDNLDENEAAICQV---------------
H3DAA2_TETNG          GPVEGYEGVVRDLEDKLRER----DLELQTLRDNLDENEAAICQV---------------
H2SEC6_TAKRU          GPVEGYEGVVRDLEDKLRER----ELELQQLRNNLDDNEAAICQV---------------
G3NGY7_GASAC          GPAEGYEGLVRDLEDKLRER----ELELLQLRDNLDENEAAICQV---------------
E7EYJ6_DANRE          PPIEAYEAIVRDLEEKLRER----ELELQRLRENLDENEAAICQV---------------
B8A6E8_DANRE          APGEGYEGVIRELEEKLRER----DLELQQLRDNLDENEAAICQVMILDFYQFLQQFDRK
H2LSV1_ORYLA          PSAEGYEVVVRELEDKLRER----DLELQQLRENLDENEAAICQV---------------
I3KQ33_ORENI          PPVEGYEAVVRELEEKLRER----DLELQQLRENLDENEAAICQV---------------
H3CTC5_TETNG          PPVEGYEVVVRELEDKLRER----DLELQQLRENLDENEAAICQV---------------
H2U4M6_TAKRU          PPVEGYEGVVRELEEKLRER----DLELQQLRENLDENEAAICQV---------------
G3NZ56_GASAC          PLVEGYEAVVRELEEKLRER----DLELQQLRENLDENEAAICQV---------------
LZTS2_XENLA           -PILNDEILIRELEEKLKDR----EMELQQLKENLDENEAAICQV---------------
LZTS2_XENTR           SPILSDEILIRELEEKLKDR----EMELQQLKENLDENEAAICQV---------------
H3A1M8_LATCH          SPVTSDDIIVRELEEKLREK----EAELLQLRESLDENEAAICQV---------------
H9GH55_ANOCA          GSGVDEALLVHELEEKLRER----EAELQHLRESLDENEVAICQV---------------
                              :   *: **: :    : ::  *::.::..*.: **                

LZTS2_HUMAN           ----------------YEERQRHWQREREALREDCAAQAQ----RAQRAQQLLQLQVFQL
G3RHD5_GORGO          ----------------YEERQRHWQREREALREDCAAQAQ----RAQRAQQLLQLQVFQL
A0A2J8XYA5_PONAB      ----------------YEERQRHWQREREALREDCAAQAQ----RAQRAQQLLQLQVFQL
G1RXP2_NOMLE          ----------------YEERQRHWQREREALREDCAAQAQ----RAQRAQQLLQLQVFQL
G7PDS3_MACFA          ----------------YEERQRHWQREREALREDCAAQAQ----RAQRAQQLLQLQVFQL
F7AYC6_MACMU          ----------------YEERQRHWQREREALREDCAAQAQ----RAQRAQQLLQLQVFQL
F7EEG2_CALJA          ----------------YEERQRHWQREREALREDCAAQAQ----RAQRTQQLLQLQVFQL
H0X7X1_OTOGA          ----------------YEER-RHWQREREALREDCTAQAQ----RAQRAQQLLQLQVFQL
F6ZIR0_HORSE          ----------------YEDRQRHWQREREALREDGTAQAQ----RAQRAQQLLQLQVFQL
G1PNF0_MYOLU          ----------------YEDRQRHWQREREALREDGAAQAQ----RAQRAQQLLQLQVFQL
LZTS2_BOVIN           ----------------YEERQRHWPREREALREDGVA-------RAQRAQQLLQLQVFQL
G3T4Q1_LOXAF          ----------------YEDRQRHWQREREALREDSAAQAQQAAQRAQRAQQLLQLQVFQL
G1MGT8_AILME          ----------------YEERQRHWPREREALRDDGVAQAQ----RAQRAQQLLQLQVFQL
LZTS2_MOUSE           ----------------FGARQRRWPRERG---EDCAAQAQQATQRVQRAQQLLQLQVFQL
LZTS2_RAT             ----------------FGARQRRWPGER----EDCASHAQQATQRVQRAQQLLQLQVFQL
G1SVA0_RABIT          ----------------WSAAERGACGRGE---TEREAQAQQAAQRAQRAQQLLQLQVFQL
I3MPE6_ICTTR          ----------------FGERQRHWPREREALREDCTAQAQQAAQRAQRTQQLLQLQVFQL
G5CAF0_HETGA          ----------------FSERSRHWRREREAPREDCVAQAQ----RARRTQQLLQLQGLQL
F7CV17_MONDO          ----------------YEEKQRRWQREREELQEGCVAQVKQATQRAQRAQQLLQLQVFQL
I3JM63_ORENI          ----------------YEEKQKRFELELEELRQGCATRMQVASQKAQRAQQVLQLQVFQL
E6ZHX6_DICLA          ----------------YEEKHKRFELELEELRQGCATRMQVASQKAQRAQQVLQLQVYQL
H2M7L2_ORYLA          ----------------YEEKQKRFELELEELRQSCATRMQVASQKAQRAQQILQLQVHQL
H3DAA2_TETNG          ----------------YEEKQKRFELELEELRQSCATRMQAASQKAQRAQQVLQLQIYQL
H2SEC6_TAKRU          ----------------YEEKQKRFELELEELRQGCATRMQVASQKAQRAQQVLQLQIYQL
G3NGY7_GASAC          ----------------YEEKQKRFELELEELRQGCATRMQGASQKAQRAQQVVQLQVFQL
E7EYJ6_DANRE          ----------------YEERQKRTELEIEEFRQMCAAKMQKASQKAQREQQMLQMQVFQM
B8A6E8_DANRE          LSYTIQLKSSVFSMQVYEEKQKRCEQEMEDLRQSCASKMKQVQLKAQRAQQVLQLQVFQL
H2LSV1_ORYLA          ----------------YEEKQRRCERELEELRQTCAAKMKQTSQKAQRSQQVLQLQVFQL
I3KQ33_ORENI          ----------------YEEKQRRCEREMEELRQSCATKMKQASQKAQRAQQVLQLQVFQL
H3CTC5_TETNG          ----------------YEEKQRRCEREMEELRQSCAAKMKQASQKAQRSQQVLELQVFQL
H2U4M6_TAKRU          ----------------YEEKQRRCEREMEELRQCCASKMKQASQKAQRSQQVLELQVFQL
G3NZ56_GASAC          ----------------YEEKQRRCEREMEELRQSCALKMKQASQKAQRAQQVLQLQVFQL
LZTS2_XENLA           ----------------YEEKQKRCEQEMEELRQSCALKMKQAAQKAQRLQQVLQLQIFQL
LZTS2_XENTR           ----------------YEEKQKRCEQEMEELRQSCALKMKQAAQKAQRLQQVLQLQIFQL
H3A1M8_LATCH          ----------------YEEKQKRYEQEMEEVRQSCTSKVKQASQKSQRAQQVLQLQVFQL
H9GH55_ANOCA          ----------------YEEKQRRCEEEMEGLRQGYTAKLQQSAQKAQRSQQVLQLQIFQL
                                      :    :    .                 : :* **::::*  *:

LZTS2_HUMAN           QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G3RHD5_GORGO          QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGQRLEETKWEVCQKSGEISLLKQQL
A0A2J8XYA5_PONAB      QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G1RXP2_NOMLE          QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G7PDS3_MACFA          QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQL
F7AYC6_MACMU          QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQL
F7EEG2_CALJA          QQEKRQLQDDFAQLLQEREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQL
H0X7X1_OTOGA          QQEKRQLQDDFAQLLQEREQLERRCATLEREQQELGPRLEETKWEVCQKSGEISLLKQQL
F6ZIR0_HORSE          QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G1PNF0_MYOLU          QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
LZTS2_BOVIN           QQEKRQLQDDFAQLLQEREQLERRCAAFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G3T4Q1_LOXAF          QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G1MGT8_AILME          QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
LZTS2_MOUSE           QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
LZTS2_RAT             QQEKRQLQDDFAQLLQEREQLERRCATFEREQQELGPRLEETKWEVCQKSGEISLLKQQL
G1SVA0_RABIT          QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
I3MPE6_ICTTR          QQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQL
G5CAF0_HETGA          QQEKRQLQDDFAQLLQEREQLERRCATLEQEQRELGPRLEETKWEVCQKSGEISLLKQQL
F7CV17_MONDO          QQEKRQLQDDFAQLLQEREQLERRCAAFEREQNELGPRLEETKWEVCQKSGEISLLKQQL
I3JM63_ORENI          QQEKKKLQEDFAQLLKEREQLEERCTSYEHEKIQLGPRLEETKWEVCQKSGEISLLKQQL
E6ZHX6_DICLA          QQEKKKLQEDFAQLLKEREQLEERCTSYEHEKIQLGPRLEESKWEVCQKSGEISLLKQQL
H2M7L2_ORYLA          QQEKKKLQEDFTQLLKEREQLEERCSSYEHEKIQLGPRLEETKWEVCQKSGEISLLKQQL
H3DAA2_TETNG          QQDKKKLQEEFAQLLKEREQLEERCTSYEHEKIQLGPRLEESKWEVCQKSGEISLLKQQL
H2SEC6_TAKRU          QQDKKKLQEEFAQLLKEREQLEERCTSYEHEKIQLGPRLEESKWEVCQKSGEISLLKQQL
G3NGY7_GASAC          QQEKKKLQEDFSQLLKEREQLEERCTSFEREKIQMGPRLEESKWEVCQKSGEISLLKQQL
E7EYJ6_DANRE          QQEKKKHQEEMTQILKERQRLEERCSSFEREHTQLGPRLEETKWEVCQKSGEISLLKQQL
B8A6E8_DANRE          QQEKKKLQEDFSQLLQEREALEKRCASFEREQTQFGPRLEETKWEVCQKSGEISLLKQQL
H2LSV1_ORYLA          QQEKKKLQEDFSSLLQDRETLEKRCATIQREQTQLGPRLEETKWEVCQKSGEISLLKQQL
I3KQ33_ORENI          QQEKKKLQEDFSSLLQDRETLERRCATIQREQTQLGPRLEETKWEVCQKSGEISLLKQQL
H3CTC5_TETNG          QQEKKKLQEDFSSLLQNKEMLEKRCATIQREQTQLGPRLEETKWEVCQKSGEISLLKQQL
H2U4M6_TAKRU          QQEKKKLQEDFSSLLQNKEMLEKRCATIQREQTQLGPRLEETKWEVCQKSGEISLLKQQL
G3NZ56_GASAC          QQEKKKLQEDFSSLLQDRETLERRCATIQREQTQLGPRLEETKWEVCQKSGEISLLKQQM
LZTS2_XENLA           QQEKKKLQEDFSQLLQERELLEKRCASFEREQTEFGPRLEETKWEVCQKSGEISLLKQQL
LZTS2_XENTR           QQEKKKLQEDFSQLLQERELLEKRCASFEREQTEFGPRLEETKWEVCQKSGEISLLKQQL
H3A1M8_LATCH          QQEKKKLQEDFAQLLQERETLERKCTSIQREQTELGPRLEETKWEVCQKSGEISLLKQQL
H9GH55_ANOCA          QQEKKKLQEDFSQLLAERELLEKRCASFEREHTELGPRLEETKWEVCQKSGEISLLKQQL
                      **:*:: *::::.:* ::: **.:*:: ::*: ::******:*****************:

LZTS2_HUMAN           KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
G3RHD5_GORGO          KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
A0A2J8XYA5_PONAB      KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
G1RXP2_NOMLE          KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
G7PDS3_MACFA          KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
F7AYC6_MACMU          KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
F7EEG2_CALJA          KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
H0X7X1_OTOGA          KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARARELELEACSQELQRHR
F6ZIR0_HORSE          KESQAELVQKGSELVALRVALREARAALRVSEGRARGLQEAARARELELEACSQELQRHR
G1PNF0_MYOLU          KESQAELVQKGSELVALRVALREARAALRVSEGWVRGLQEAARARELELEACSQELQRHR
LZTS2_BOVIN           KESQSELVQKGSELVALRVALREARAALRVSEGRARGLQEAARTRELELEACSQELQRHR
G3T4Q1_LOXAF          KESQAELVQKGSELVALRVALRETRAALRVSEGRARGLQEAARARELELEACSQELQRHR
G1MGT8_AILME          KESQAELVQKGSELVALRVALREARAALRVSEGRARGLQEAARARELELEACSQELQRHH
LZTS2_MOUSE           KESQAELVQKGSELVALRVALREARATLRVSEGRARGLQEAARAREQELEACSQELQRYR
LZTS2_RAT             KESQAELVQKGSELVALRVALREARAALRVSEGHARGLQEAARARELELEACSQELQRYR
G1SVA0_RABIT          KESQAELVQKGSELVALRVALREARAALRVSEGRARGLQEAARARELELETCSQELQRHR
I3MPE6_ICTTR          KESQAELVQKGSELVALRVALREARAALRVSEGRARGLQEAARARELELETCSQELQRHR
G5CAF0_HETGA          KESQAELVQKGSELVSLRVALREARAALRVSEGRARGLQDAARARELELETCSQELQRHR
F7CV17_MONDO          KESQAELVQKGSELAALRVALREARASLRASEGRARGLQEAARARELELEVCTHELHRRK
I3JM63_ORENI          KEVQSELAQRVGEIVSLRGQLRETRGELTNTQVLLQEAHGTIRTRTLELEVCENELQRRK
E6ZHX6_DICLA          KEVQGELAQRVGEIVSLRGQLRETRGELTNTQVLLQEAHGTTRTRTLELEVCENELQRRK
H2M7L2_ORYLA          KEVQNELAQRVGEIVSLRGQLRETRGELTNTQVLLQEAHGTTRTRTMELEVCENELQRRK
H3DAA2_TETNG          KEVQGELAQRVGEIVSLRGQLRETRGELTNTQVLLQEAHGTTRTRTLELEVCENELQRRK
H2SEC6_TAKRU          KEVQGELSQRVGEIVSLRGQLRDTRGELTNTQVLLQEAHGTTRTRTLELEVCENELQRRK
G3NGY7_GASAC          KEVQGELAQRVGEIVLLRGQLRETRGELTNTQVLLQEATGAARTRSLELEVCENELQRRK
E7EYJ6_DANRE          KDLQADLAQRVGELVTVRGQLREVRSELQTSQNQLQEANTTSRTRILELEVCQNELQRRK
B8A6E8_DANRE          KDVQADLGQKASEIVALKAQLREARSELQASQARSQEAHATARTRTLELEVCENELQRRK
H2LSV1_ORYLA          KEIQSELSQKAGDIVVLKAQLREARSELQASQARSQEAQTALRTRSLELEVCENELQRRK
I3KQ33_ORENI          KEIQSELSQKAGDIVVLKAQLREARSELQASQARSQEAQTALRTRSLELEVCENELQRRK
H3CTC5_TETNG          KEIQSELSQKAGDIVVLKAQLREARSEMQASQARFQEAQAALRTRSLELEVCENELQRRK
H2U4M6_TAKRU          KEIQSELSQKAGDIVVLKAQLREARSEMQASQARFQEAQAALRTRTLELEVCENELQRRK
G3NZ56_GASAC          KEIQSELSQKAGDIVVLKAQLREARSELQASQARSHEAAAALRTRSLELEVCENELQRRK
LZTS2_XENLA           KDSQAELAQKSNEILLLRSQFREARCDLQISEEQVQELQDTAHTKTLEMEVCENELQRKK
LZTS2_XENTR           KDSQAELAQKSNEILLLRAQVREARSDLQISEEQVQELQDTAHTKTLELEVCENELQRKK
H3A1M8_LATCH          KDSQVELAQKGNEILSLKAQLRGVRAELQACEDQLQELQEAAHTKTLELEVCENELQRKK
H9GH55_ANOCA          KESQSEVAQRSNELILLRAQLREARAELQASEDQALGLQEMARTKALELEVCANELARRK
                      *: * :: *: .::  ::  .* .*  :   :          :::  *:*.* :** * :

LZTS2_HUMAN           QEAEQLREKAGQLDAEAAGLR--EPPVPP-------------------------------
G3RHD5_GORGO          QEAEQLREKAGQLDAEAAGLR--EPPVPP-------------------------------
A0A2J8XYA5_PONAB      QEAEQLREKAGQLDAEAAGLR--EPPVPP-------------------------------
G1RXP2_NOMLE          QEAEQLREKAGQLDAEAAGLR--EPHVPP-------------------------------
G7PDS3_MACFA          QEAERLREKAGQLDAEAAGLR--EPAVPP-------------------------------
F7AYC6_MACMU          QEAERLREKAGQLDAEAAGLR--EPAVPP-------------------------------
F7EEG2_CALJA          QEAERLREKAGQLDAEAAGLR--EPPMPP-------------------------------
H0X7X1_OTOGA          QEAERLREKAGQLDAEAAGLR--EPLVPP-------------------------------
F6ZIR0_HORSE          QEAERLREKAGQLDTEAAGLR--EPPVPP-------------------------------
G1PNF0_MYOLU          QEAERLREKAGQLDTEAAGLR--EPPVPP-------------------------------
LZTS2_BOVIN           QEAERLREKAGQLDSEAAGLR--EPPVPP-------------------------------
G3T4Q1_LOXAF          QEAERLREKAGQLDAEVAGLR--DPPVPP-------------------------------
G1MGT8_AILME          QEAERLREKAGQLDTEAAGLR--EPPLPP-------------------------------
LZTS2_MOUSE           QEAERLREKAGHLDAEASGLR--DPPVPP-------------------------------
LZTS2_RAT             QEAEQLREKARHLDAEAAGLR--EPPVPP-------------------------------
G1SVA0_RABIT          KEAERLREKAGQLDAEAAGLR--EPPAPP-------------------------------
I3MPE6_ICTTR          QEAERLREKAGQLDAEAAGLR--EPPVPP-------------------------------
G5CAF0_HETGA          QEAERLREKAGQLDVEVAGLR--GPSVPP-------------------------------
F7CV17_MONDO          NEAEWLREKAGQLDVAVAGLRGAQEPLPV-------------------------------
I3JM63_ORENI          SEAELLREKVGRLEGEMAHLR--DALANQ-----------------------GPGNRQCQ
E6ZHX6_DICLA          SEAELLREKVGRLEAELTHLR--EALANQ-----------------------GPGNRQCQ
H2M7L2_ORYLA          SEAELLREKVACLEGELAHLK--ETLASQ-----------------------GPGNRQCQ
H3DAA2_TETNG          SEAELLREKAGRLEAELAHLK--DALASQ-----------------------GPGNRQCQ
H2SEC6_TAKRU          SEAELLREKVGRLETELAHLR--DAPAGQ-----------------------GPGHRQCQ
G3NGY7_GASAC          SEAELLREKVGRLEGELFRLR--DALANQ-----------------------GPGNRQCQ
E7EYJ6_DANRE          SENELLREKISHLEEDSSQMR--DALNAA-----------------------ASG-----
B8A6E8_DANRE          SEAELLREKMGRLEEESLRLK--EAMAVPTPQTLPSKGQSMSLPLPQSRGGIGHGISPAF
H2LSV1_ORYLA          SEAELLREKVRSLEEESTRLR--EGLSNH------------------CGPYLPGNMKAHC
I3KQ33_ORENI          SEAELLREKVGRLEEETARLR--DALTGH------------------SGPTLPGNAAMK-
H3CTC5_TETNG          SEAELLREKLGRVEEELSRLR--DALSNH------------------SALVG--------
H2U4M6_TAKRU          SEAELLREKLGRVEEELTRLR--DALSNH------------------GVLSVSGREEHHL
G3NZ56_GASAC          SEAELLREKLGRLEEESARLR--DTLSNY------------------GVHSLPANLTTDA
LZTS2_XENLA           NEAELLREKVSKLDQEVASLR--EAAVASLRH-------------------------GLC
LZTS2_XENTR           NEAELLREKASKLDQEVAGLR--EAAVANLRH-------------------------GLC
H3A1M8_LATCH          NEADLLREKVGKLEREVAGLR--EMVARSRQ-----------------------------
H9GH55_ANOCA          SEAELLREKVGRLEREFEGLR--SASRDLCP-----------------------------
                      .* : ****   ::     ::                                       

LZTS2_HUMAN           ---ATADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
G3RHD5_GORGO          ---ATADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
A0A2J8XYA5_PONAB      ---AAADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
G1RXP2_NOMLE          ---ATADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
G7PDS3_MACFA          ---ATADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
F7AYC6_MACMU          ---ATADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
F7EEG2_CALJA          ---ATADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRVELQRERQRGEEQRDSFEGER
H0X7X1_OTOGA          ---ATADPFLLAESDEAKVQRAAAGVVGGSLRAQVERLRVELQRERRRGEEQRDSFEGER
F6ZIR0_HORSE          ---AMADPFLLAESDEAKAQRAAAGV-GGSLRAQVERLRAELQRERRRGEEQRDSFEGER
G1PNF0_MYOLU          ---ATADPFLLAESDEAKAQRVAAGV-GGSLRAQVERLRAELQQERRRGEEQRDSFEGER
LZTS2_BOVIN           ---ATADPFLLAESDEAKAQRAAAGV-GGSLRAQVERLRAELQRERRQGEEQRDSFEGER
G3T4Q1_LOXAF          ---ATADPFLLAESDEAKAQRAAAGV-GGSLRAQVERLRAELQQERRRGEEQRDNFEGER
G1MGT8_AILME          ---ATADPFLLAESDEAKVQRAATGV-GGSLRAQVERLRAELQRERRRGEEQRASFEGER
LZTS2_MOUSE           ---ATTDPFLLAESDEAKVQRAAAGA-GGSLRAQVERLRQELQREQRRGDEQRDSFEGER
LZTS2_RAT             ---ATTDPFLLAESDEAKVQRAAAGT-GGSLRAQVERLRQELQREQRRGDEQRNSFEGER
G1SVA0_RABIT          ---AAADPFLLAESDEAKVQRAAAGV-GGSLRAQVERLRAELQRERRRGEEQRDSFDGER
I3MPE6_ICTTR          ---ATTDPFLLAESDEAKVQRAAAGA-GGSLRAQVERLRVELQRERRRGEEQRDSFEGER
G5CAF0_HETGA          ---PAADPFLLAESDEAKVQRAAAGA-GGSLRAQVERLRGELQRERRRGEEQRDSFEGER
F7CV17_MONDO          ---PAPDPFLMSESDEAKAQRAAAAGAGGSLRAQVERLRAELQQERRRAEEQQGGFESER
I3JM63_ORENI          VFQEAEEQLLAYESDEAKAQRKSNTEALQSMKVQMDRMRSELAFERQKAEQQLGSFEEER
E6ZHX6_DICLA          VFQEAEEHLLAYESDEAKAQRQSSTEALQNMKAQMDRMRAELTFERQRGEQQTGSFEEER
H2M7L2_ORYLA          VFQDAQEQLLAYESDEAKAQRQSEVETQQNMKAQMDRMRSELAYECKKVEQQAASFEQER
H3DAA2_TETNG          VFPEDQEQLLA------RAQEPSGGEVLQNMSVKMDRMRAELSYEHQRAEQQMSSFEEER
H2SEC6_TAKRU          VFPQDEEQRLAYQSDEARALEQASGEVLQNMTVKMDRMRAELSFEHQRAEQQMSSFEEER
G3NGY7_GASAC          VFQEAEEHLLAYESDGAKAQRQGGAEALQSAKVQADRMRAELDYERQRAEQQAGGFEEER
E7EYJ6_DANRE          -----KEQRLAEETEELKTSRQ-----------QADRLKAELAYERQRFSDQAAAFESER
B8A6E8_DANRE          RDNSSEEQLLAYESDEAKAQRQS-VDVLHGLRQQVDRLRAELMYERRRSEDQLEGFEDER
H2LSV1_ORYLA          MSHSLQGRVWSGESDEAKAQRQN-AEIVLGLRQQVDRLKAELMYERRAGEEQLSRFEEER
I3KQ33_ORENI          -----------GKGTKHDTLKQ------------VDRLKAELMYERRTGEEQLSRFDEER
H3CTC5_TETNG          -----------GESDEAKAQRQN-AETVLGLRQQVDRLKAELIYERRTSEEHLSRFEDER
H2U4M6_TAKRU          --------VWGGESDEAKAQRQN-AETVLALRQQVDRLKAELLYERRTSEEHLSHFEEER
G3NZ56_GASAC          EESHV---VWGGESDEAKAQRQN-AEAVLGFRQQVDRLKAELMYERRTNEEQLSRFEDER
LZTS2_XENLA           FCHEKEDPFLLYESDEAKAQRQN-ADNLQGLQQYVERLREALASERSRYQEQAEHFEDER
LZTS2_XENTR           LCHEKEDPFLLYESDEAKAQRQN-ADNLQGLQQYVERLREALTSERRRYQEQADSFEDER
H3A1M8_LATCH          -SQEQEDAFLLYESDEAKAQRQN-ADTLLGLRQQVERLKAELLYERRRSEDQLEGFEEER
H9GH55_ANOCA          ---------LLSECDEAKAQRQA-ADTLQGLRAQAERLRAELLCERRRGEEQREAFQAER
                                        . .              :*::  *  *    .::   *: **

LZTS2_HUMAN           LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
G3RHD5_GORGO          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
A0A2J8XYA5_PONAB      LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
G1RXP2_NOMLE          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
G7PDS3_MACFA          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELAELGLAEQAPCIC
F7AYC6_MACMU          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELAELGLAEQAPCIC
F7EEG2_CALJA          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
H0X7X1_OTOGA          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
F6ZIR0_HORSE          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
G1PNF0_MYOLU          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
LZTS2_BOVIN           LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
G3T4Q1_LOXAF          QAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
G1MGT8_AILME          LAWQAEKEQVIRYQKQLQHNYVQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
LZTS2_MOUSE           LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAESAPCIC
LZTS2_RAT             LAWQAEKEQVIRYQKQLQHNYVQMYRRNRQLEQELQQLSLELEARELADLGLSEPAPCIC
G1SVA0_RABIT          LAWQAEKEQVIRYQKQLQHNYIQMCRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
I3MPE6_ICTTR          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCIC
G5CAF0_HETGA          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELAALGLAEPAPCIC
F7CV17_MONDO          LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELRHLSLELEARDLADYSLPETPPCVH
I3JM63_ORENI          KIWQEEKDKVIRYQKQLQQNYVQMYRRNRELEQLLQELSLELESRD-DDEGS---GNEIN
E6ZHX6_DICLA          RIWQEEKDKVIRYQKQLQENYVQMYRRNRELEQLLQELSQELESRE-EDEGS---GNEIN
H2M7L2_ORYLA          RIWQEEKDKVIRYQKQLQENYVQMYRRNRELEQQLQELSLELESRE-EDEGS---GNEIN
H3DAA2_TETNG          RIWQEEKDKVIRYQKQLQQNYVQMYRRNRELEQLLQELSQELESRE-EDEGS---GNEIT
H2SEC6_TAKRU          QIWQEEKDKVIRYQKQLQQNYVQMYRRNRELEQLLQELSQELESRE-EDEGS---GNEIN
G3NGY7_GASAC          RIWQEEKDKVIRYQQQLQQNYVQMYGRNRELEQLLRELSQELESRE-EDEGS---GNEII
E7EYJ6_DANRE          KSWEEEKDKVIRYQKQLQQNYVQMYKRNRDLERSLRELSLELESREQDDDSS---GNEVT
B8A6E8_DANRE          RVWQEEKDKVIRYQKQLQQNYIQMYRRNRDLERVMRELSLELENRDMEEFDMR--SNEIH
H2LSV1_ORYLA          RVWHEEKEKVIRYQKQLQQNYIHMYRRNRDLERVMRELSLELENRDVEDYEVHSGSNDIH
I3KQ33_ORENI          RVWQEEKEKVIHYQKQLQQNYIQMYRRNRDLERVMRELSLELENRDMEDYEVRSGSNDIH
H3CTC5_TETNG          RVWQEEKEKVIRYQKQLQQNYIQMYRRNRELERVMRELSLELESRDMEDYEVRSGSNDIH
H2U4M6_TAKRU          RVWQEEKEKVIRYQKQLQQNYIQMYRRNRDLERVMRELSLELESRDMEEYEVHSGSNDIH
G3NZ56_GASAC          RVWHEEKEKVIRYQKQLQQNYIQMYRRNRDLERVMRELSLELENRDMEDYEVHSGSNDIH
LZTS2_XENLA           RKWQEEKEKVIRYQKQLQHNYIQMYQQNRELERDIKQLTVELDAREFNEFDLH-GAE-IH
LZTS2_XENTR           RIWQEEKEKVIRYQKQLQHNYIQMYQQNRELERDIKQLSLELEARELDEFDLH-GAE-IQ
H3A1M8_LATCH          RTWHEEKEKVIRYQKQLQHNYIQMYRQNRELEREMRQLNLELEARDIDDFDIQ-SAE-IR
H9GH55_ANOCA          ITWQSEKDRVIRYQKQLQHNYIQMYRHNRDLECQLRHLSLELEARDLDEYEMH-GGEGIC
                        *. **::**:**:***.**::*  :**:**  ::.*. **: *:            : 

LZTS2_HUMAN           LEEITATEI
G3RHD5_GORGO          LEEITATEI
A0A2J8XYA5_PONAB      LEEITATEI
G1RXP2_NOMLE          LEEITATEI
G7PDS3_MACFA          LEEITATEI
F7AYC6_MACMU          LEEITATEI
F7EEG2_CALJA          LEEITATEI
H0X7X1_OTOGA          LEEITATEI
F6ZIR0_HORSE          LEEITATEI
G1PNF0_MYOLU          LEEITATEI
LZTS2_BOVIN           LEEITATEI
G3T4Q1_LOXAF          LEEITATEI
G1MGT8_AILME          LEEITATEI
LZTS2_MOUSE           LEEITATEI
LZTS2_RAT             LEEITATEI
G1SVA0_RABIT          LEEITATEI
I3MPE6_ICTTR          LEEITATEI
G5CAF0_HETGA          LEEITATEI
F7CV17_MONDO          LEEITATEI
I3JM63_ORENI          FDEIAATEI
E6ZHX6_DICLA          FDEIAATEI
H2M7L2_ORYLA          FDDVAATEI
H3DAA2_TETNG          FDEVAATEI
H2SEC6_TAKRU          FDEIAATEI
G3NGY7_GASAC          FDEIAATEI
E7EYJ6_DANRE          FDDIAATEI
B8A6E8_DANRE          FEEITATEI
H2LSV1_ORYLA          FEEITATEI
I3KQ33_ORENI          FEEITATEI
H3CTC5_TETNG          FEEITATEI
H2U4M6_TAKRU          FEEITATEI
G3NZ56_GASAC          FEEITATEI
LZTS2_XENLA           FEEITATEI
LZTS2_XENTR           FEEITATEI
H3A1M8_LATCH          FEEITATEI
H9GH55_ANOCA          FEEIAATEI
                      :::::****