CLUSTAL format seed alignment for MF_03027

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A7AMI3_BABBO      ---------------------------------------MAPS----RRKSKAKRDVAKS
Q4UBJ6_THEAN      ---------------------------------------MAKKNNTLQKSDPTDDDLNNL
BOP1_MOUSE        ----------MAGACGKPH----------------MSPASL-PGKRRLEPDQELQIQ-EP
BOP1_RAT          ----------MAGACGKHH----------------MSPGSL-PGKRRLEPDQEPQIQ-EP
BOP1_HUMAN        ----------MAGSRGAGR----------------TAAPSVRPEKRRSEPELEPEPEPEP
BOP1A_XENLA       ---------------MKRG----------------SQGEAGSPQTEEPEPLFS---EEDR
BOP1B_XENLA       ---------------MKRG----------------SKRESGGPLTEEPEPLFS---EENR
BOP1_XENTR        ---------------MKKG----------------SKREAGGPQAEQPEPLFS---GEDR
BOP1_DANRE        --------------MSKLK----------------NKKRHLEENEEEQLPIFDKDSGEDG
BOP1_AEDAE        -------MVANKDKATKRKIPAVDD--AVKVSTANGKQQTKLKEPVDDESASDYYESDEE
BOP1_CULQU        -------MVANKSKATKRKVAAAPQPPTAQDKPATNGRSTKQPEADSDQSASDYYESDEE
BOP1_ANOGA        -------MVANKERAIKRKASEGGA----KPEPITSKQEPLDESNDEDNSNESDYESDKE
BOP1_DROER        ---------MTKKLALKRK----------------GKESEPINKVVASSEASENEEEEE-
BOP1_DROYA        ---------MTKKLALKRK----------------GKDAEPTNEVVASSEASENEEEEE-
BOP1_DROME        ---------MTKKLALKRR----------------GKDSEPTNEVVASSEASENEEEEE-
BOP1_DROSE        ---------MTKKLALKRR----------------GKDSEPTNEVVASSEASENEEEEE-
BOP1_DROAN        ---------MTKKLTLKRK----------------GKEPEPTNEVAASSEASDNEEEE--
BOP1_DROMO        ---------MTKKRTVKRK----------------VKEPEPTKEQPSVSEQSENEEDED-
BOP1_DROVI        ---------MTKKQAIKRK----------------VKEPEPTNEQSSASEPSDNEEDDD-
BOP1_DROGR        ---------MAKKSAIKRK----------------VKAPESINEQASVSEQSENEEDED-
BOP1_DROPE        ---------MTKKLTIKRK----------------VKEPEPQNEAPDSHESSDNEEEEE-
BOP1_DROPS        ---------MTKKLTIKRK----------------VKEPEPQNEAPDSHESSDNEEEEEE
BOP1_DROWI        ---------MAKKQDRKRK----------------VKD-EATNDGASGSDQSDNAEEEE-
BOP1_CAEBR        ------------------------------------------------------------
BOP1_CAEEL        ------------------------------------------------------------
BOP1_BRUMA        ------------------------------------------------------------
BOP1_CHLRE        --MHIISAIYSARVQNCAA-----------------PTQPLVPSCQTHSAASHTPPGPSA
F6HCQ7_VITVI      ----------------MAK-----------------RETPRLDSLNKKKKEKEK------
BOP1_MONBE        ---MPRRVRAQKRTAGVVE-----------------DEEVKAEQVRREHKAKQK-----Q
ERB1_ASPFU        ---------------------------------------MNTSKASKKRKAVTRDVEEEA
ERB1_ASPFC        ---------------------------------------MNTSKASKKRKAVTRDVEEEA
ERB1_NEOFI        ---------------------------------------MNGSKASKKRKAVTRDVEEEA
ERB1_ASPCL        ---------------------------------------MNASKASKKRKAVTRDVEEEA
ERB1_ASPOR        ---------------------------------------MDASKSSKKRKAVTRDVEEEA
ERB1_ASPTN        --------------------------------------MVNASKVSKKRKAVTRDVEEEA
ERB1_ASPNC        ---------------------------------------MSAAKVSKKRKAVTKDVEEEA
ERB1_EMENI        ---------------------------------------MAALKASKKRKAVTRDVEEEA
ERB1_AJECN        ---------------------------------------MGDLKGSRKRKAVTRDLDEEP
ERB1_CHAGB        ---------------------------------------MGSKITDKKRKSRD------S
ERB1_PODAN        ---------------------------------------MKSKPVEKKRKVRDE----ES
ERB1_NEUCR        ---------------------------------------MGPKATEKKRKVQD------A
ERB1_MAGO7        ---------------------------------------MAPTAPAKKRKQSAE----VT
ERB1_BOTFB        ---------------------------------------MAPPTNQRKRKAVTRDEPEIS
ERB1_PHANO        ---------------------------------------MSVNSRKRKVATKAAP----V
ERB1_PYRTR        ---------------------------------------MSVNPRKRKVVTRPAP----E
ERB1_ASHGO        ------------------------------------MVHSKKDKSVMKHSDIKKRGAAVL
ERB1_KLULA        ---------------------------------------MARKNSSLNGSES----AELV
ERB1_YEAST        --------------------------------------MMAKNNKTTEAKMSKKRAASEE
ERB1_YEAS7        --------------------------------------MMAKNNKTTEAKMSKKRAASEE
ERB1_CANGA        ---------------------------------------MVKGRKSQKADKVTKAKKRVA
ERB1_CANAL        ---------------------------------------MARNSIKKS-PVVKKKDTPIV
ERB1_PICST        ---------------------------------------MSKSSKVGM-TDVSVPKSAVL
ERB1_LODEL        ---------------------------------------MAKKEVSASKPGNTKKDNVLL
ERB1_DEBHA        ---------------------------------------MARNSKATD-TPKTVVEKQSR
ERB1_PICGU        ---------------------------------------MAKKN--------TVTGSKIK
ERB1_YARLI        ---------------------------------------MVRSRSNSVKKDLKRKVDEPV
ERB1_SCHPO        ---------------------------------------METGMNRKRSRSKRANSNVGV
ERB1_COPC7        ---------------------------------------MALTDSKKKATSKRKRDEPEQ
ERB1_CRYNJ        ------------------------MAPQPLKVGTSKLSKMVKSAPKTAGKAKKRAVEQVS
ERB1_MALGO        ------------------------MAVDKGRRPVPPERRAQGRKRAEPGDVTIRETRTRP
ERB1_USTMA        ---------------MVRPSSSSSASASAARSGAAKRKRNLPTATNPTTRASVAANVKGK
BOP1_DICDI        ----------------------------MNKSKVTSKKVVAETKVVNNKKSEPIAVSEPK
A0E170_PARTE      ---------------------------------------MNQNNTINIRAIRNKKSIKKD
A0DKQ7_PARTE      ---------------------------------------MNQNNTINIRAIRNKKSIKKD
Q248A8_TETTS      --------------------------------------MSSKQNLKRPHKVLDELEQKKD
BOP1_LEIIN        -----------------------------------MTSPKGKPSPKRSAPAPTTAALTPR
BOP1_LEIMA        -----------------------------------MTSPKGKPSPKRSAPAPATAALTPC
BOP1_LEIBR        ------------------------------------------------------------
Q384Z1_TRYB2      ------------------------------------MVKKREPTSRVTSRVHKTPSPSPR
B3LAV2_PLAKH      ---------MSEEKDYLTGSTSAESYLGGGKDQ-QGEMAKTPKDGSDSKTETEQGEILDA
A5K1G8_PLAVS      ---------MSEEKDYLTGSTSAESHSGRGKDP-EGEMVSSPNSSGDSKTGIEEGGLPDA
Q7RDY8_PLAYO      -----------------------------MKSQ-KNNEKTKTKTETQSNFEENDG---NA
Q8IM36_PLAF7      --------------MNQNGEINTKNNEGKNKEQNKDGDKKKVKKLNYDKDELLENDVTKV
C4M3V4_ENTHI      ------------------------------------------------------------
V4YYZ6_TOXGV      MREVQKSLRGGRGRKTGAMKGREKTGFSPASLPVPSEDSLRGEEDFTSEESLTDVSVRSR
E2RU09_GIAIC      ---------------------------------------MSQEPSSSFSDGFMESDFSQG
                                                                              

A7AMI3_BABBO      GSDSTSST----------------------------------------------------
Q4UBJ6_THEAN      STRSNSRS----------------------------------------------------
BOP1_MOUSE        PLLSDP------------------------------DSSLSDSEE---------------
BOP1_RAT          LLLSDP------------------------------DSSLSDSEE---------------
BOP1_HUMAN        PLLCTSPLSHSTG----------------------SDSGVSDSEE---------------
BOP1A_XENLA       SLRDGN------------------------------ALDESDSEE---------------
BOP1B_XENLA       SLQDGN------------------------------PLDESDSEE---------------
BOP1_XENTR        SLSDGN------------------------------IVDESDSEE---------------
BOP1_DANRE        HLDDGDE----------------------------DPADLSDSEE---------------
BOP1_AEDAE        NLFASIDNG--------------------------NDEDSTDSEGEGEESDDEE-VQE--
BOP1_CULQU        NLLANINN---------------------------DDGDSSDSEGEGDASDGEV-QGL--
BOP1_ANOGA        NLLGSIEN---------------------------EGEDSSDSDGEYATDDDEDDVLS--
BOP1_DROER        DLLQAVKD---------------------------PGEDSTDDEG---------------
BOP1_DROYA        DLLQAVKD---------------------------PGEDSTDDEG---------------
BOP1_DROME        DLLQAVKD---------------------------PGEDSTDDEG---------------
BOP1_DROSE        DLLQAVKD---------------------------PGEDSTDDEG---------------
BOP1_DROAN        DLLQAVKD---------------------------PGEDTTDDEG---------------
BOP1_DROMO        -LLQAVKD---------------------------PGEDTTDDEG---------------
BOP1_DROVI        -LLQAVKD---------------------------PGEDTTDDEG---------------
BOP1_DROGR        -LLQAVKD---------------------------PGEDTTDDEG---------------
BOP1_DROPE        DLLQAVKD---------------------------PGEDSTDDEG---------------
BOP1_DROPS        DLLQAVKD---------------------------PGEDSTDDEG---------------
BOP1_DROWI        DLLQTVKE---------------------------PGEDSTDDEG---------------
BOP1_CAEBR        ------------------------------------------------------------
BOP1_CAEEL        ------------------------------------------------------------
BOP1_BRUMA        ------------------------------------------------------------
BOP1_CHLRE        RLPSPARP---------------------------EASTRTQGKS---------------
F6HCQ7_VITVI      KEESSKHQ---------------------------QEENVDDKQL---------------
BOP1_MONBE        AVGSDAEQ---------------------------EEEELFPDSL---------------
ERB1_ASPFU        GVFSGDE-------------------LNTGNLDGALSDNAHDLSSDEDESDSEVELI---
ERB1_ASPFC        GVFSGDE-------------------LNTGNLDGALSDNAHDLSSDEDESDSEVELI---
ERB1_NEOFI        GVFSGDE-------------------LNTDNLDGALSDNANDLSSDEDESDSEVELI---
ERB1_ASPCL        GVFSGDE-------------------LNADNLDGALSDNANDLSSDEDDSDSEIELV---
ERB1_ASPOR        GVFSGDE-------------------LQVDVLDGALSDNANDLSSDEDVSDSEIELV---
ERB1_ASPTN        GVFSGDE-------------------LNAENLDGALSDNANELSSDED--DSEVELV---
ERB1_ASPNC        GVFSGDE-------------------LNVGDIDGALSDDANDLSSDEE--DSEVELV---
ERB1_EMENI        GVFSGDE-------------------LSSKDLDGALSDNAHDLLSDEDASDSEIELI---
ERB1_AJECN        GVVSGDE-------------------LNLDALDGDLSDKSHDT---EHSSDSEIELV---
ERB1_CHAGB        ESESDDE-------------------LANGLFDGILSQSEDEEDYLPSDDDDDVED----
ERB1_PODAN        DSESDDE-------------------LANGLFDGVLEASEDEEDYIPSDEIDDVDSES--
ERB1_NEUCR        EPESDDE-------------------IAPD-FDGALSQSEDE---FDSDFDDNEHE----
ERB1_MAGO7        ELS-DDE-------------------IIDGLLDGALSQSEDDSDFVASGDEDEEDED---
ERB1_BOTFB        DVESEAE-------------------FGDGILEGILSQSEDE-----SDD----------
ERB1_PHANO        QSSSDEE-------------------LADGLLDGILSHSEDESEDD-QDAEDTDASS---
ERB1_PYRTR        PSDSEGE-------------------LGDGLLEGILSHSEDDSDNSREEEVDTDASS---
ERB1_ASHGO        EEEDVLQQDEQLLVDGATIDCDSDDDEEFQSAEEEVLSSGSESSSKEGSTPGSPVE----
ERB1_KLULA        VKKRVLE-------------------------ESELSDSEDERIEVDGLIDEEASE----
ERB1_YEAST        SDVEEDE-DKLLSVDG------------LIDAEASESDEDDDEYESAVEEKESSSD----
ERB1_YEAS7        SDVEEDE-DKLLSVDG------------LIDAEASESDEDDDEYESAVEEKESSSD----
ERB1_CANGA        DEVDESESEPELQVEG------------LIDAEAE--SEDDESFESAEENASAEED----
ERB1_CANAL        RKRKP---IQQEAEEDS----NDEESEDELNVEGLIDASDDEDEE-----EEQEQEEQ--
ERB1_PICST        KKRNQ---REVEAEVD-------ESSEEEFEMDGLLDAEASEDDE-----EDEE------
ERB1_LODEL        KKRKQQAVEKEEAEKEK----EEGVSEDEFNVQGLIDPESDSDDEGAAAAEEEEEEEE--
ERB1_DEBHA        KRKQD----VEDAEES--------SSDEELQVEGILDDAASEDEESD--SEDADKE----
ERB1_PICGU        RKRQ------DESPEV--------SESEEIDVQGLIDDEASEDSE-----DEVESE----
ERB1_YARLI        DVQDEFDVEGLIDEGDS-------------DDEDEAEQEVAQENVTKDKKNTSKTE----
ERB1_SCHPO        EKDKEKE--------------------KSKGVSNVPNEVETESSSHEPSFKKDVDE----
ERB1_COPC7        EQTHTLTSQLEM---------LTDEE---GDDDNAGDVSDDGEYDEFPEIDAESDS----
ERB1_CRYNJ        EESDEEFGDQGS---------GIDMS---DDEEEVDGDDEEDEDEAFPEFDSELEDND--
ERB1_MALGO        VHTPEPEPELLA------KDGILELE----DDDDNDDDDDDDDDDKSNHHDGAPKNED-D
ERB1_USTMA        GKTKALELDLVVSDDGE-EDGELDLESDSGDDDANDDDDNDNEQDDFPEIDLEDSDDDQD
BOP1_DICDI        KSVSKPTTTATTTVSKSPVSTITTQILGKRTKTPVVRDEENEDEKLDFGNIDLNNYNS--
A0E170_PARTE      LSLQPKNI----------------------------------------------------
A0DKQ7_PARTE      LSLQPKNI----------------------------------------------------
Q248A8_TETTS      RLLMSNKN----------------------------------------------------
BOP1_LEIIN        TEERTEGA--------------------------TSSASASASSHISSSFDSPRDDTV--
BOP1_LEIMA        AEERTEGA--------------------------TSSASASASSHISSSFDSPRDDTV--
BOP1_LEIBR        ------------------------------------------------------------
Q384Z1_TRYB2      AVDDSGKQ--------------------------KPDLSTTPPPSPGEGG----------
B3LAV2_PLAKH      EREGKSDKEGK----------------AEETAAKMKKKKKKKKNSQTEELVEAGIKAG--
A5K1G8_PLAVS      AREGKADKERN----------------AERRAAKMRKEKKKKKGG-TEERVEAGAKAGA-
Q7RDY8_PLAYO      EKSAKLDSEKT----------------NKHTMLNTAKKKKKKVET---------------
Q8IM36_PLAF7      AGEFDEEKEGNQ---------------EMKSFEKMTEKSKKKKDSKKMKNMKK-------
C4M3V4_ENTHI      ------------------------------------------------------------
V4YYZ6_TOXGV      ETRKGKSSQQRADEGIEEESEETEATTNSEEDGVTSEDEEEEEEEEEEEEEEDEDEED--
E2RU09_GIAIC      SFSASDDA----------------------------------------------------
                                                                              

A7AMI3_BABBO      ------------------------------------------------------------
Q4UBJ6_THEAN      ------------------------------------------------------------
BOP1_MOUSE        -----------------SVFSGLEDLGSDS------------------SEED--------
BOP1_RAT          -----------------SVFSGLEDSGSDT------------------SDED--------
BOP1_HUMAN        -----------------SVFSGLEDSGSDS------------------SEDDDEG-----
BOP1A_XENLA       -----------------SQYSGLEDSGTDR------------------SDDEED------
BOP1B_XENLA       -----------------SQYSGLEDSGTDS------------------SDDEED------
BOP1_XENTR        -----------------SQYSGLEDSGSDS------------------TEDEEE------
BOP1_DANRE        -----------------SVFSGLEDSGSDD------------------EDDDEDDDEDDD
BOP1_AEDAE        ---------------FESADSDFEDESGKD-----------DEEEAEDEEDDADEEDADS
BOP1_CULQU        ---------------NIESDSDFEEDDQEA-----------DGE--EEEEDSADDVNSDS
BOP1_ANOGA        ---------------FESLNSDGEEEDEEEDAGTTLEEVEREAEEDDDEEDGEDDEEADS
BOP1_DROER        ------------------IDQEYHSDSSEE------------------LQFESDEEGNYL
BOP1_DROYA        ------------------IDQEYHSDSSEE------------------LQFESDEEGNYL
BOP1_DROME        ------------------IDQEYHSDSSEE------------------LQFESDEEGNYL
BOP1_DROSE        ------------------IDQEYHSDSSEE------------------LQFESDEEGNYL
BOP1_DROAN        ------------------IDQEYQSDSSED------------------LEFESDEEGNYL
BOP1_DROMO        ------------------IDQEYQSDSSED------------------LEFESDEEGNYL
BOP1_DROVI        ------------------IDQEYQSDSSED------------------LEFESDEEGNYL
BOP1_DROGR        ------------------IDQEYQSDTSDD------------------LLFESDEEGNYL
BOP1_DROPE        ------------------IDQEYQTDSSED------------------LEFESDEEGNYL
BOP1_DROPS        ------------------IDQEYQTDSSED------------------LEFESDEEGNYL
BOP1_DROWI        ------------------IDQEYQSDSSED------------------LEFESDEEGNYV
BOP1_CAEBR        ------------------------------------------------------------
BOP1_CAEEL        ------------------------------------------------------------
BOP1_BRUMA        ------------------------------------------------------------
BOP1_CHLRE        ----------------HAGAA----AAAVE-----------------GTAAPEDEAADNS
F6HCQ7_VITVI      ----------------HQGFS----GDEEE-----------------LTESESD--GPVL
BOP1_MONBE        ----------------HGPDSESDVTDDEQ-----------------IDEEARQADRDLL
ERB1_ASPFU        -------------------------DDFSD--------------------EEDEE-----
ERB1_ASPFC        -------------------------DDFSD--------------------EEDEE-----
ERB1_NEOFI        -------------------------DDFSD--------------------EDDEE-----
ERB1_ASPCL        -------------------------DEFSE--------------------DDEDD-----
ERB1_ASPOR        -------------------------DDFSD--------------------EEDGD-----
ERB1_ASPTN        -------------------------DEFSD--------------------EDDED-----
ERB1_ASPNC        -------------------------DDFSS--------------------DEDED-----
ERB1_EMENI        -------------------------DDYSS--------------------SEEED-----
ERB1_AJECN        -------------------------DDLSS--------------------DDGEE-----
ERB1_CHAGB        -------------------SENEGTGASED--------------------DDDDD-----
ERB1_PODAN        -----------------EVSEGSEDAEEEE--------------------EEEEG-----
ERB1_NEUCR        -------------------QDGEQESGSEA--------------------SDDED-----
ERB1_MAGO7        -------------------EDEDEDKDEDD--------------------EHDDK-----
ERB1_BOTFB        -------------------SAAEEDSEDEE--------------------DLDEE-----
ERB1_PHANO        ------------------VIEGLSDEDFED--------------------EEDSG-----
ERB1_PYRTR        ------------------VIEGLSDEDEEE--------------------DEDS------
ERB1_ASHGO        -----------------------GSDEEAE--------------------DEDADEEEDE
ERB1_KLULA        -----------------------NEAEEAE--------------------DDDSD-----
ERB1_YEAST        -----------------------KEAQDDS--------------------DDDSD-----
ERB1_YEAS7        -----------------------KEAQDDS--------------------DDDSD-----
ERB1_CANGA        -----------------------EEDEED---------------------EEDSD-----
ERB1_CANAL        -----------------PQEEENNSDDDDDDDDDDDDN----------NSEADSE-----
ERB1_PICST        -----------------------NSEDDE---------------------EEDSD-----
ERB1_LODEL        -----------------QQQDVKELDLDKGEVISSDSD----------AEDFDSE-----
ERB1_DEBHA        -----------------------DDEEEE--------------------LEGDSD-----
ERB1_PICGU        -----------------------DQVFEN--------------------SDADSD-----
ERB1_YARLI        -----------------------NEEDADD--------------------ESDSD-----
ERB1_SCHPO        --------------------------------------------------EIPSL-----
ERB1_COPC7        -----------------------EEEDEEE--------------------DEEDE-----
ERB1_CRYNJ        ---------------------QEEASDEEQ--------------------DEQDT-----
ERB1_MALGO        MEAFPELVSGKDKDDDGDE--DEEEDDEDE--------------------DEDAS-----
ERB1_USTMA        VEDEDEPGAQEEVDSDNNKQASTQVHDIQV--------------------EEDDS-----
BOP1_DICDI        -----------------EDDEDYESEEDDE-------------------GDDEEDVESQN
A0E170_PARTE      ------------------------------------------------------------
A0DKQ7_PARTE      ------------------------------------------------------------
Q248A8_TETTS      ------------------------------------------------------------
BOP1_LEIIN        -----------------------------------------------------------V
BOP1_LEIMA        -----------------------------------------------------------V
BOP1_LEIBR        -----------------------------------------------------------M
Q384Z1_TRYB2      ------------------------------------------------------------
B3LAV2_PLAKH      ------------------------------------------------------------
A5K1G8_PLAVS      ---------------------------------------------------KAGDKAGDK
Q7RDY8_PLAYO      ------------------------------------------------------------
Q8IM36_PLAF7      ------------------------------------------------------------
C4M3V4_ENTHI      ------------------------------------------------------------
V4YYZ6_TOXGV      --------------------EEDEEEDEEE-------------------EDGEESEEEEE
E2RU09_GIAIC      ------------------------------------------------------------
                                                                              

A7AMI3_BABBO      ----RSHSRSDSISSRGRDETVVDESITDL------------------------------
Q4UBJ6_THEAN      ----NSKTRRNTLNKKTKFNDSNELQENGLE-----------------------------
BOP1_MOUSE        --------TEGVAGSSGDEDNHRAEETSEEL-------------------------AQAA
BOP1_RAT          --------TEEVARAGCDKD-NRTEKTSEEQ-------------------------EQAV
BOP1_HUMAN        -------DEEGEDGALDDEGHSGIKKTTEEQ-------------------------VQAS
BOP1A_XENLA       -------HWSEEEE-NPGKSPKEIIKVPNRS-------------------------SKSP
BOP1B_XENLA       -------HSSEEVQ-DPGKSPKEIIKVPHRT-------------------------SKSQ
BOP1_XENTR        -------HSSEEIQQNPGKSPKEIRKVPHRP-------------------------SKSE
BOP1_DANRE        DKDGSEEKSSDAEEDKADDDDGDLKLSAKDD-------------------------VKPQ
BOP1_AEDAE        ADDVNSDSSPEPEEEESDDELEFEEDLEEPEQPKAIQKVIVGRQKKSVEATAEDEDEEDD
BOP1_CULQU        SPEEDEGESEEEEEDDDEGDLEFEEDLAEPEKPRAIKEGSKAGKKQAPEVESE---EEDD
BOP1_ANOGA        ADDVNSDSSPEEDEGDLED--SSDEELEEEEEEEEAKE---NGKEKPAKAKAE---RKQR
BOP1_DROER        GRKQS--SSAEEDE---ESSDEDDDGEEESS-------------------------DEEE
BOP1_DROYA        GRKQS--SSAEEDE---ESSDEDDDEEEGSS-------------------------DEEG
BOP1_DROME        GRKQS--SSAEEDE---ESSDEEDNEEEEST-------------------------DGEE
BOP1_DROSE        GRKQS--SSAEEDE---ESSDEEDNEEEGST-------------------------DEEE
BOP1_DROAN        GRKKGDGSSEEEDDDGDEEGEEEDEEEDDSE-------------------------DGES
BOP1_DROMO        GRKVSNEAEEGEDD---QDE-DDDEDEDEGE-------------------------DEDD
BOP1_DROVI        GRKANNEAE-GDAE---EDE-DDDEEEDEDS-------------------------DEAS
BOP1_DROGR        GRKEASSGEDEQGE---EDDNDDEEEEDEDE-------------------------EESG
BOP1_DROPE        GRK-GAEGSSGDDD---EESAEDEEEEDDAD-------------------------AKKS
BOP1_DROPS        GRK-GAEGSSGDDD---EESAEDEEEEDDAD-------------------------AKKS
BOP1_DROWI        GRKGGQQESSDEEE---VDEEEEDDDDDDDE-------------------------EEGG
BOP1_CAEBR        -----MASTSTALPVRTKRKLENGKKKPKTP-------------------------KDEF
BOP1_CAEEL        -----MASTSAATPLKNKRKFENGKKKPKTL-------------------------KDEF
BOP1_BRUMA        ---------------------MIHKRMNSTE-------------------------LERT
BOP1_CHLRE        SEEDAGPGSHGEGAGEGGGSGTWPGNGGGPQPIHR---------------------CAGS
F6HCQ7_VITVI      SEDEDYVSADGDDSLHNDPS---EENEGG-------------------------------
BOP1_MONBE        KELVTLQGLNGEDPSDADNDDDDDEEEAASDDDDE---------------------EEDA
ERB1_ASPFU        --EEDVLDSDEIPSDGEDS--AKKKSNAAPGEL--------------GAVIDDDDDDDD-
ERB1_ASPFC        --EEDVLDSDEIPSDGEDS--AKKKSNAAPGEL--------------GAVIDDDDDDDDD
ERB1_NEOFI        --EEDVLDSDEIPSDGEDL--AKKKSNTAPGEL--------------GAAMDDG------
ERB1_ASPCL        --EE--LDSDEIPSDGEDA--VKKKSVTTTDKS--------------GEIAEDA------
ERB1_ASPOR        --EEEELDSDEIPSDGGES--FKKASGTGNARD---------------------------
ERB1_ASPTN        --EEE-LDSDEIPSDGEEP--KKKSASTAVDGP--------------QADD---------
ERB1_ASPNC        --EEEELDSDEIPSDGEAP--LKKKSGTSAADL--------------EVPTNDD------
ERB1_EMENI        --DEE-LDSDEIPSEGEDEGVVKKKSTAVLDLD--------------GLEDREES----T
ERB1_AJECN        --YEDEFDSDEIPSDIESKPIREKSKPDRGVDI--------------FVRGEEVTSDGEL
ERB1_CHAGB        --DDDDILSDDIPS-DVDSEEAINRLVKQ--QE--------------ELEITEPGVDPKR
ERB1_PODAN        --DDDALLSDDIPS-DDE----MGKLSKD--AE--------------ELEITEPGVDPKP
ERB1_NEUCR        --EEGSLLSDDIPS-DAEGDKAMGKLVLEDEEE--------------ELEIEIPGVDPKR
ERB1_MAGO7        --QDIGDLQDLSLN-DLDDDAQSKELAKD----------------------GANGGSGDG
ERB1_BOTFB        --ELEALDSDEVPSENGEGEGSMTRTSLN-----------------------------KI
ERB1_PHANO        --DEAEEIRKQMRNLNTSGGSQQRKTRQP--AH--------------E-RLDDGADGELE
ERB1_PYRTR        ---DSEQIRTEMRNLNTSDGPLRKKKGVP--TH--------------DMDLDTAVTEELE
ERB1_ASHGO        DAEFNRLLAAEE-GDSEG-EYGSEDFSD----------------DNDTRPLREKLSSMQL
ERB1_KLULA        -AEFNRLLAEEE-NGQEE-EYNTSDFSE----------------EGDAFSITDKLSNVKL
ERB1_YEAST        -AELNKLLAEEE-GDGEE-DYDSSEFS------------------DDTTSLTDRLSGVKL
ERB1_YEAS7        -AELNKLLAEEE-GDEEE-DYDSSEFS------------------DDTTSLTDRLSGVKL
ERB1_CANGA        -AELNKLLAEEE-GDDSESEYNTSDFSE-----------------DDTKSMTDKLSGVKL
ERB1_CANAL        -EELNQLLGEEE-EEDPS-DYNSDEFSDEPKD--------------------DDLSRINI
ERB1_PICST        -KELNELLGEE---EDPS-DYDSENFSDEPQES-------------DTRSITDAISGVKI
ERB1_LODEL        -EELNKLLGEE---DDPS-DYSSVGFSDEPKEDGDEQDEQDAFAAADAATDDDAFGDVKL
ERB1_DEBHA        -EEFNELLGEE---EDLS-DVDSEEFSDEPRDE--------------TASITDKLSGTKI
ERB1_PICGU        -EELNNLIGEE---EDVS-DVDSEDFSDELQDD--------------SNSITDKLTNVRI
ERB1_YARLI        -AELEALIGEEEDLSGSELEDELAYFSDAGDDE------------VDPSILKHLDDGVRL
ERB1_SCHPO        ---TAELSEEEEGEYSSESGRSTPELSPD-------------------------------
ERB1_COPC7        --EDE----PDISDEE-DSDS------------------------------DESLHVFPK
ERB1_CRYNJ        --SDE----SEIVEEDSDSESGYNTSDIERMYASDDD---LSSEENKDLPVDEKLSRLIA
ERB1_MALGO        --DDEAFDSDDLENWDEEADAKYGDADLSDDDD--------------VKEGDAALERMIA
ERB1_USTMA        --SEEGYNSSDIDNSDFDDDADEGDLAYDSADEDERASAFAARSDASQTSIDEELSRMMS
BOP1_DICDI        GSIVYSESEEEEEGGINKALLEAEESLVEYQSEDD------------SGSISSKSSSSTT
A0E170_PARTE      --------HDQYYQ----------------------------------------------
A0DKQ7_PARTE      --------HDQYYQ----------------------------------------------
Q248A8_TETTS      --------QDEEDENVDEVEDQNNN-----------------------------------
BOP1_LEIIN        FTGYTAESKHNAHGYERLHDIILQDGDTGADSEDG------------RANEDNVILFPHA
BOP1_LEIMA        LTGYTAESEHSAHGYERLHDIILQGSDTDADSEDG------------RANEDDVILFPHA
BOP1_LEIBR        LPGYTAESKDGAHGYERLHDIILQDSDADG--------------------EDDVILFPHA
Q384Z1_TRYB2      -NGDEVLTSSQTNATDLRDELIWSDRESDD----------------------EVFLFPDA
B3LAV2_PLAKH      --MKQKKKRENKSERKSKNGTDEKITSQKGSEKSNCQTGKKK------SPKEGKGKLPKG
A5K1G8_PLAVS      AGMKQKKKGQNKSEGKGENGTEEKITAKKGPEKLGRRAEKKKSHKKGASKKEGKGELTNE
Q7RDY8_PLAYO      --KKKKKMGENE---------EKKEKKEKG-------------------KKEEKG--KKE
Q8IM36_PLAF7      --MKKKKKLEKMKNLINSTNNSNNEKDENDFIET--------------FKKKNKKNIKKD
C4M3V4_ENTHI      ------------------------------------------------------------
V4YYZ6_TOXGV      EEEETEEDSEENEEEGEEGGTDSVNFEAELETEEAEAKAERSGGSGASVSFADAKKGRRK
E2RU09_GIAIC      -----------ELSIPSEFAESVDELS---------------------------------
                                                                              

A7AMI3_BABBO      -----------------------------------------------------------N
Q4UBJ6_THEAN      -----------------------------------------------------------S
BOP1_MOUSE        PLCSRTEEAG-----------------------------------------------ALA
BOP1_RAT          PPCPRAEEAG-----------------------------------------------ALT
BOP1_HUMAN        TPCPRTEMAS-----------------------------------------------ARI
BOP1A_XENLA       ADSAADEEDR-----------------------------------------------PNE
BOP1B_XENLA       ADSPADEEDQ-----------------------------------------------PNE
BOP1_XENTR        ANSAAAEEDK-----------------------------------------------PSA
BOP1_DANRE        VDSQNSKEKKKKKR-------------------KGKSVLKDGGEEDVASGRDEALKITSQ
BOP1_AEDAE        EETRDLLEAAQKEDEKLG---------EIDAALGI-APAKTRGVGIFPPEAKSRFKGGKN
BOP1_CULQU        LETKKLLEAAAKEDEKLA---------ALDSVLGPDGEKKTRGVGSFPPERKTGRL--KN
BOP1_ANOGA        EEQFESDDEPLPDDLKLG---------RIEDVLGT-GEKKTRGLGVFPPVPKRKGK--AA
BOP1_DROER        VED--EEKDSKLKQ-------------SDDKPSSS-GAASKKAPTTELSK------RDTS
BOP1_DROYA        EED--EEKDSKSKQ-------------ADDKPSSS-GAASKKAPTTELSK------RDTS
BOP1_DROME        VED--EEKDSKSKQ-------------TDDKPSGS-GAASKKALTAELPK------RDSS
BOP1_DROSE        VED--EEKVSKSKQ-------------SDDKPSGS-GAASKKALTAELPK------RDSS
BOP1_DROAN        ADDGDEEKPTTSKQNK-----------SEDEPSSSKVSKKTQPPTKDLVK------RDPS
BOP1_DROMO        DSDDDSEESDANEASATP---------KDDQPSSSKAAAAQTK---EPIIQIIP--RDPS
BOP1_DROVI        EDNDDAEE---------------------EKPSSSMTAAVQTKV--EPIIQIIP--RDPS
BOP1_DROGR        SSDDDAKD---------------------DQPSGSKATLSKTTGDSSNIAVAIPPRRDPS
BOP1_DROPE        SKNNDEEA---------------------ATTSKSIKKSQEKPTSSNKVVPVVPA-RDPS
BOP1_DROPS        SKNNDEEA---------------------ATTSKSIKKSQEKPTSSNKVVPVVPA-RDPS
BOP1_DROWI        KVE--------------------------DKPTTSSKAETNNEVAPLPALPA----RDPS
BOP1_CAEBR        GEKLDVKPVI-------------------------------------------------K
BOP1_CAEEL        GEKLDIKPVIV----------------------------------------------PPK
BOP1_BRUMA        SKKID-------------------------------------------------------
BOP1_CHLRE        VVAGATRGGCVAATRL-----------------------YLAAVQPSGGLSICANTKPRA
F6HCQ7_VITVI      ------------------------------------------------------SSESHQ
BOP1_MONBE        EPSSDSSNEASDAGQ------------------------EEGTTDPHTTTDDKASATTQM
ERB1_ASPFU        ESPSEEEQL---------------------------------NYRIEKDANGNDRFVYDE
ERB1_ASPFC        ESPSEEEQL---------------------------------NYRIEKDANGNDRFVYDE
ERB1_NEOFI        ESSSEGEQL---------------------------------NYRIEKDANGNDRFVYDE
ERB1_ASPCL        ESSSEEEEL---------------------------------DFRIEKDANGNDRFIYDE
ERB1_ASPOR        ESSSDEEQL---------------------------------NYRIEKDANGNDRYVYDE
ERB1_ASPTN        ESSSEDEQP---------------------------------NFRIEKDANGEDRYIYDE
ERB1_ASPNC        ESSSEEEQP---------------------------------NFRIEKDANGNDRYIYDE
ERB1_EMENI        KEEEEEEQL---------------------------------NYRIEKDANGNDRYVYDE
ERB1_AJECN        GDGYDDDKL---------------------------------NYRVTKDANGNERYIYDE
ERB1_CHAGB        EEDDGADR----------------------------------NYRIEKDANGGERYVYDE
ERB1_PODAN        KHQEEEDR----------------------------------NYKVVKDANGGERYVYDE
ERB1_NEUCR        PEKDDGDK----------------------------------NYRIEKDANGNERYVYDE
ERB1_MAGO7        PEADDEDRP---------------------------------NYRVVEDANGGIRYVYDE
ERB1_BOTFB        NADEDDDKP---------------------------------NYTVVKDANGGERYVYEE
ERB1_PHANO        GEEDESLKP---------------------------------NYTVTTDAHGQVRYLYKE
ERB1_PYRTR        --DDEDLKP---------------------------------NYTVTTDAHGNTRYIYKE
ERB1_ASHGO        KMIPDG--------------------------------ESA--SVKTRYSDGTPRIIKPE
ERB1_KLULA        TVIPETS-------------------------------DEG--IVRTKYSDGRPRILKSE
ERB1_YEAST        QTIVDP-------------------------------------NIYSKYADGSDRIIKPE
ERB1_YEAS7        QTIVDP-------------------------------------NIYSKYADGSDRIIKPE
ERB1_CANGA        TTIAEP-------------------------------------IIKTKFSDGTPRVIKPE
ERB1_CANAL        KSLSVSD-------------------------------PSIQKNSISKFSDGSIRILKPE
ERB1_PICST        RSLSDIS-------------------------------SQDKQEFHTKYSDGSERIIKPE
ERB1_LODEL        KNLSITD-------------------------------PS-KLEVRTKFSDGTPRIIKPE
ERB1_DEBHA        RSYSNAT-------------------------------EDEENEVHTKFSDGRPRIIKPE
ERB1_PICGU        RTSSQSS-------------------------------NEN---VHGLFADGTERIIKPE
ERB1_YARLI        RSLSRSSDQT---------------------------DELKDVVEIVPGADGKPRMIKKE
ERB1_SCHPO        -----------------------------------------------DFEDADDEEEFEE
ERB1_COPC7        AKTVVSD------------------------------------------ITGQQKRVYPE
ERB1_CRYNJ        KNTVKPDD------------------SIGTDDKISRAKEGVGRLVPSKHVKGSFVREYDE
ERB1_MALGO        RARVKPDE---SERTTNKLGIDTGVAARFYD-ESRNDDGSKRGRVVQSHVTGMPKVEYPP
ERB1_USTMA        RYSSKPDEHSGSLSATNKLGIPRSQAAQAFDLRVRNPDGSAKGVFKRSEITGEMKRVYPE
BOP1_DICDI        TTTTTTKKTN----------------------------------NDEEEVAPNKQWTNDP
A0E170_PARTE      ------------------------------------------------------------
A0DKQ7_PARTE      ------------------------------------------------------------
Q248A8_TETTS      -----------------------------------------------------------H
BOP1_LEIIN        EELANAA------------------------------------AGINGDDDNGRVVRLGT
BOP1_LEIMA        EELSNAA------------------------------------AGVGGDDDNGRVVRLGT
BOP1_LEIBR        EELANAA------------------------------------VGIDGDDGNGRVVRLGT
Q384Z1_TRYB2      QELVEPQ------------------------------------GGPDCD-----VIRIGA
B3LAV2_PLAKH      RKQHGGKYIK----------------------KETDYEDTTGSDLCSSSVRSENTKRGKN
A5K1G8_PLAVS      RKSRGGKHPK----------------------KGTDYEDTTGSDAFNSSVKSANTRRGKN
Q7RDY8_PLAYO      RKIK---------------------------------------------------KKNHN
Q8IM36_PLAF7      KKKT----------------------------KDTDYEDTVVSSEIHDVITGAG--DNSN
C4M3V4_ENTHI      ------------------------------------------------------MSVRDI
V4YYZ6_TOXGV      EQRAGEKGSEAESSVK----------------------GGGENAPSNRLRRFERLLEVAN
E2RU09_GIAIC      ------------------------------------------------------------
                                                                              

A7AMI3_BABBO      VESDTYFDSDEDEGQVNRIGRVPLEWYEREEHIGYTIDGEKLIKELDS--TELGKLIFKS
Q4UBJ6_THEAN      SDSDAFFDSDEEEGHLNRSGNVPIDWYETEDHIGYTVEGKKLIKELDS--TQLGQLIFNS
BOP1_MOUSE        QDEYEE-DSSDEEDIRNTVGNVPLAWYDEFPHVGYDLDGKRIYKPLRTR-DELDQFLDKM
BOP1_RAT          RDEYEE-DSSDEEDIRNTVGNVPLAWYDDFPHVGYDLDGKRIYKPLRTR-DELDQFLDKM
BOP1_HUMAN        GDEYAE-DSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTR-DELDQFLDKM
BOP1A_XENLA       IKEYEN-DSSDEEDIRNTVGNIPMEWYKDLPHIGYDLDGRKIFKPLRSK-DQLEEFLDKM
BOP1B_XENLA       IKEYEN-DSSDEEDIRNTVGNIPMEWYKDLPHIGYDLDGRKIFKPLRSK-DQLEEFLDKM
BOP1_XENTR        AKEYEN-DSSDEEDIRNTVGNIPMEWYQDFPHIGYDLDGRKIFKPLRSK-DQLEQFLDKM
BOP1_DANRE        VDEYDH-DTSDEEDIRNTVGNIPMEWYKDYPHIGYDLDGKKIFKPIRNK-DELDEFLDKM
BOP1_AEDAE        QDEYAAGDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWEGNRLIKPAKT--DAIDDFLKKM
BOP1_CULQU        SDEYAGGDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDGNRLIKPPKM--DTIDEFLKRM
BOP1_ANOGA        QDEYAAGDTSDEEDIRNTVGNIPMHWYDEYKHVGYDWDAKKIIKAKKG--DAIDDFLQRM
BOP1_DROER        KPEYQDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPQG--DQIDEFLRKI
BOP1_DROYA        KPEYQDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPQG--DQIDEFLRKI
BOP1_DROME        KPEYQDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPQG--DQIDEFLRKI
BOP1_DROSE        KPEYQDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPQG--DQIDEFLRKI
BOP1_DROAN        HPEYHDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIVKPPQG--DQIDEFLRKI
BOP1_DROMO        KPEYEESDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPKG--DQIDDFLRKI
BOP1_DROVI        KPEYEDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIVKPPKG--DQIDDFLRKI
BOP1_DROGR        KPEYENSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPKG--DQIDDFLRKI
BOP1_DROPE        KVEYADSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIVKPPKG--DQIDDFLRKI
BOP1_DROPS        KVEYADSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIVKPPKG--DQIDDFLRKI
BOP1_DROWI        KQEYEDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDGNKIIKPIKG--DQIDDFLRKI
BOP1_CAEBR        PADEYDYDSSDEEDLRNTIGNIPIQWYDDEDHIGYDKFGEKIAKPAKK--GEIETFLEKM
BOP1_CAEEL        PADEYDYDSSDEEDLRNTIGNIPIKWYDDEDHIGYDKFGEKIAKPAKK--GEIETFLEKM
BOP1_BRUMA        -----DYDSSDEEDLRNTIGNIPISWYDDFSHVGYDKDGNQIESAKKN--DDMEEFLDRM
BOP1_CHLRE        GPDPGSDSSEDERPNRNTVGNVPLVWYKDEEHIGYDIEGARITKAQRK--DRLQQLLDRN
F6HCQ7_VITVI      GIEE-SDSSEDEVAPRNTIGDVPLEWYKDEEHVGYDIAGKKIKKKVRQ--DKLDSFLASA
BOP1_MONBE        VVYSSDDDTSDEEHSLNRVGRIPMEWYEDYEHIGYDLNGKRIRKPKQK--DRLEKFLDAF
ERB1_ASPFU        INPDDNSDYSDVDENANTIGNIPLSFYDQYPHIGYDINGKKIMRPAKG--EALDALLDSI
ERB1_ASPFC        INPDDNSDYSDVDENANTIGNIPLSFYDQYPHIGYDINGKKIMRPAKG--EALDALLDSI
ERB1_NEOFI        INPDDNSEYSDIEENANTIGDIPLSFYDQYPHIGYDINGKKILRPAKG--EALDALLDSI
ERB1_ASPCL        INPDDNSEYSDVEENSNTIGDIPLSFYDQYPHIGYDINGKKILRPAKG--EALDALLDSI
ERB1_ASPOR        INPDDNSDYSDVEENANTIGNIPLSFYDQYPHIGYDINGKKIMRPATG--EALDALLDSI
ERB1_ASPTN        INPDDNSDYSDVDENANTIGNIPLKFYDEYPHIGYDINGKKIMRPAKG--EALDALLDSI
ERB1_ASPNC        INPDDNSDYSDVEENANTIGNIPLSFYDQYPHIGYDINGKKIMRPATG--EALDALLDSI
ERB1_EMENI        INPDDNSDYSDVDENSNTIGNIPLSFYDQYPHIGYDINGKKILRPAKG--EALDALLDSI
ERB1_AJECN        INPDDNSDYSEADENANTIGNIPLSFYDQYPHIGYNINGKKIMRPAMG--QALDTLLDSI
ERB1_CHAGB        IDPVYDSDDSDAKGPVNTIGDIPLSFYDSYPHIGYDINGKKIMRPATG--DALQSLLDSI
ERB1_PODAN        IDPVYDSDDSDAQGPVNTIGNIPLSFYDSYPHIGYDINGKKIMRPATG--DALQSLLDTI
ERB1_NEUCR        IDPVYDSDDSDAQEAPNTIGNIPMSFYDSYPHIGYDINGKKIMRPATG--DALDALLDSI
ERB1_MAGO7        INPVYDSDDSDKEED-NRIGDIPLSFYEAYPHVGYTIDGKKLMRPSERR-QALDSLLDSI
ERB1_BOTFB        INPVYDSDDSDAQEPTNTIGNIPLSFYDSYPHIGYDINGKKIMRPAKG--EALDALLDSI
ERB1_PHANO        IDPVYESDDSD-AEATNTIGNIPLTYYDEYPHIGYDINGKKIMRPAKG--EALDALLDSI
ERB1_PYRTR        IDPVYESDDSD-VEATNTIGNIDLKYYDEYPHIGYDINGKKIMRPAKG--EALDALLDSI
ERB1_ASHGO        ITPVYDSDDTD-VETANTIGNIPLSAYDEMPHIGYDINGKRIMRPAKG--SALDALLDTI
ERB1_KLULA        INPVYDSDDSD-AEAKNTIGNIPLSAYDEMPHIGYDINGKRIMRPAKG--SALDQLLESI
ERB1_YEAST        INPVYDSDDSD-AETQNTIGNIPLSAYDEMPHIGYDINGKRIMRPAKG--SALDQLLDSI
ERB1_YEAS7        INPVYDSDDSD-AETQNTIGNIPLSAYDEMPHIGYDINGKRIMRPAKG--SALDQLLDSI
ERB1_CANGA        INPVYDSDDSD-IESKNTIGNIPLSVYDEMPHIGYDVNGKRIMRPARA--SALDQLLDTI
ERB1_CANAL        IEPKYDSDDSD-AENFNTIGNIPISAYDEMPHIGYDINGKRIMRPAKG--SALDQLLESI
ERB1_PICST        IEPVYDSDDSD-AENFNTIGDIPLSAYDEMPHLGYDINGKRIMRPAKG--SALDQLLESI
ERB1_LODEL        IEPVYDSDDSD-AENFNTIGNIPISAYEEMPHIGYDINGKRIMRPAKG--SALDQLLESI
ERB1_DEBHA        INPIYDSDDSD-NENFNTIGNIPLSAYEEMPHIGYDINGKRIMRPAKG--SALDQLLESI
ERB1_PICGU        IEPVYDSDDSD-HENFNTIGNIPLSAYEEMPHIGYDINGKRIMRPAKG--SALDQLLESI
ERB1_YARLI        IHAVYDSDDSD-QEESNTIGNVPLSAYDQMPHIGYDINGKRIMRPATG--SALDNLLETI
ERB1_SCHPO        IDAGYSSDSST----EDVAPGLYESPYDENLYINYDIDGKKITRPATP--AALDSLIASI
ERB1_COPC7        IEPDYDSDSST-EDSPNRVGNVPMHWYDDLPHIGYDINGKRVLRPAKG--DELDKFLATI
ERB1_CRYNJ        YEAGYGSESST-EDNPNTVGNIPMEWYDDLPHIGYDVNGRKIFRPLQG--DELDKFLANV
ERB1_MALGO        IEPEYDSDSST-EDVPNRIGQVPLSWYDDLPHIGYDINGRRVLRPAQG--DELDKFLDSV
ERB1_USTMA        IDAAYDSDSST-EDPENRIGNVPLEWYDDLPHIGYDINGRKVMKPATK--DELDKFLDTV
BOP1_DICDI        NQFYDSDDSSEDESLVNRIGNIPLEWYDDYDHIGYDVDGNKIMKTESMK-DSIDKYLDQQ
A0E170_PARTE      -----ESDDSEDEKILSKIGRLQTKKYKDKDFIGYDENLNKIQKKKQFQ-DTIDEFINKT
A0DKQ7_PARTE      -----ESDDSEDEKILSKIGRLQTKKYKDKDFIGYDENLNKIQKKKQFQ-DTIDEFINKT
Q248A8_TETTS      LKDESESDDTDDEEILAKIGRVPWKWYENYKHMGYDADMKKVTKRIQ-D-DKIDEFIKKA
BOP1_LEIIN        IQHLEESDSSEDEPTLNRVGDIPLEWYKDEDHIGYDIEGKKLMKKERS---ALERLLEAT
BOP1_LEIMA        TQHLDESDSSEDEPTLNRVGDIPLEWYKDEDHIGYDIEGKKLMKKERS---ALERLLEAT
BOP1_LEIBR        TQHLDESDSSEDEATLNRVGDIPLEWYKDEKHIGYDIEGKKLMKAERS---ALERLLEAT
Q384Z1_TRYB2      TQKLDESDSSEDEATLNRVGDIPLEWYKDEAHYGYDVEGRKLMKSERS---ALERLLEAT
B3LAV2_PLAKH      IFANEEIEESDDEYNLSRLGNFDMKHYEDLDILGYDIWGNKIQKTDEN---AIDDFIESK
A5K1G8_PLAVS      IFANEEIDESDDEYNLNTLGDFDLKHYEDLDIVGYDIWGNKIQKKDEN---AIDDFLESK
Q7RDY8_PLAYO      IYINEEIDESDDEYNLNTIGNIDLKYYDDLDIIGYDIDGKKIEKTNEN---MIDDFIESK
Q8IM36_PLAF7      IYINEEIDESDDEYNINTLGNFDLKHYEDFDIIGYDIEGKKIYKSDEN---LIDDFLNSQ
C4M3V4_ENTHI      YDNENDDVNTSDEESIDTLGNIPLEWYNELEHQGYDHSGKPLPKPTKGRLDSIDQFLAMT
V4YYZ6_TOXGV      PMEEPGDLLSDEDEEENRIGNVPLWWYEKYDHIGYDRDGQRIVKQLSS--SAVDRLLAQD
E2RU09_GIAIC      ----SSSDNGDQGQPLTEPNNIPIDEDTVYNIWGQVVGTRRKDIGPDG--SSLDMFLERH
                                       .           .                  :   :   

A7AMI3_BABBO      E-NPDAWRTIVDVRNNRTVRLSD-DDLKLISRIRKGMYPQENYDQEDLYVEFDNEDA---
Q4UBJ6_THEAN      E-NPDAWRTIIDPRNNRTIRLTD-DDLKIIRRIRKGLYPSETYDPEAVTVEFDNKDS---
BOP1_MOUSE        D-DPDFWRTVQDKMTGRDLRLTD-EQVALVHRLQRGQFGDSGFNPYEPAVDFFS--GDIM
BOP1_RAT          D-DPDFWRTVQDKMTGSDLRLTD-EQVALVHRLQRGQFGDSGFDPYEPAVDFFS--GDIM
BOP1_HUMAN        D-DPDYWRTVQDPMTGRDLRLTD-EQVALVRRLQSGQFGDVGFNPYEPAVDFFS--GDVM
BOP1A_XENLA       E-NPDYWRTIHDKKTGQDIKLTD-EQVDLVERLQKGQFGDINYDPYQPAIDFFT--HETM
BOP1B_XENLA       E-NPDYWRTVHDKKTGQDIKLTD-EQVDLVERLQKGQFGDLNYDPYQPAIDFFT--HETM
BOP1_XENTR        E-NPDYWRTVHDKKTGQDVRLTD-EQVDLVERLQRGQFGDINYDPYQPSIDFFT--HETM
BOP1_DANRE        E-NPDYWRTVQDKMTGADIRLSD-EQVDLVHRLQQGKFGDVNFNEYEPAVDFFS--NEVM
BOP1_AEDAE        E-DPNFWRTVKDPQTGQNVVLTD-EDIGLIKRIMAGKNPDEQYSDYEPWIEWFT--SEVE
BOP1_CULQU        E-DPNFWRTVKDPQTGQNVVLSD-EDVGLIKRIMAGRNPDQQYNDYEPWIEWFT--SEVE
BOP1_ANOGA        E-DPNFWRTVTDPQTGQKVVLSD-EDIGLIKRIMSGRNPDAEYDDYEPFIEWFT--SEVE
BOP1_DROER        E-DPDFWRTVKDPLTGQDVRLTD-EDIALIKRIVSGRIPNKDHEEYEPWIEWFT--SEVE
BOP1_DROYA        E-DPDFWRTVKDPLTGQDVRLTD-EDIALIKRIVSGRIPNKDHEEYEPWIEWFT--SEVE
BOP1_DROME        E-DPDFWRTVKDPLTGQDVRLTD-EDIALIKRIVSGRIPNKDHEEYEPWIEWFT--SEVE
BOP1_DROSE        E-DPDFWRTVKDPLTGQDVRLTD-EDIALIKRIVSGRIPNKDHEEYEPWIEWFT--SEVE
BOP1_DROAN        E-DPNFWRTVKDPQTGQEVLITD-EDIALIKRIISGRIPNKDHNEYEPWVEWFT--SEVE
BOP1_DROMO        E-DPNFWRTVKDPMTGQEVLLTD-EDIALIKRVNSSRIPNPEHDEYAPWIEWFT--SEVE
BOP1_DROVI        E-DPNFWRTVKDPQTGQEVLLTD-EDIALIKRVNSGRIPNAEHDEYAPWIEWFT--SEVE
BOP1_DROGR        E-DPDFWRTVKDPQTGQEVLLTD-EDIALIKRVNSARIPNPEHNEYEPWIEWFS--SQVE
BOP1_DROPE        E-DPNFWRTVKDPLTGQEVLLTD-ADIALIKRINSGRIPNEEHDEYAPWIEWFT--SEVE
BOP1_DROPS        E-DPNFWRTVKDPLTGQEVLLTD-ADIALIKRINSGRIPNEEHDEYAPWIEWFT--SEVE
BOP1_DROWI        E-DPDFWRTVKDPQTGQEVVLSD-ADIALIKRINSARIPNAEHEEYEPWIEWFT--SEVE
BOP1_CAEBR        E-DPDYWRKVFDKQTGTDVKLTD-EQIEKIHNIASGKYPTIGYNPYEPFLDIYS--SQKE
BOP1_CAEEL        E-DPDYWRKVFDKQTGTDVKLTD-EQIEKIHNIATGKYPTIGYNPYEPFLDIFS--SQKE
BOP1_BRUMA        D-DSNYWRRVYDRQSGGFVTLND-EEVKKLNALDASKYPLVGYNPYQPFLDIFS--SQTE
BOP1_CHLRE        D-SKKALRTIYDPYNDEEVTLSK-EELAMVMRIRAGQFPHLEVNPHETEHTWFTDPRDAE
F6HCQ7_VITVI      D-DSKNWRKIYDEYNDEEVELTK-RETRLIRRLLKGKAPHAEFDPYAPYVDWFK--WDDA
BOP1_MONBE        E-AGNNGRTIYDPVTGKEIELTD-DDINMIKRIQSGQLPDTGINPYEDYVDFFT--HEKM
ERB1_ASPFU        E-IPKGWTGLTDPSTGKPLELSQ-EELELLRKVQMNEIPEDGYNPYEPIVEWFTSQQ--E
ERB1_ASPFC        E-IPKGWTGLTDPSTGKPLELSQ-EELELLRKVQMNEIPEDGYNPYEPIVEWFTSQQ--E
ERB1_NEOFI        E-IPKGWTGLTDPSTGKPLELSQ-EELELLRKVQMNEIPEDGYNPYEPTVEWFTSQQ--E
ERB1_ASPCL        E-IPKGWTGLTDPSTGKPLELSQ-DELELLRKVQMNEIPEEGYNPYEPTVEWFTSQQ--E
ERB1_ASPOR        E-IPKGWTGLTDPSTGKPLELSQ-DELELLRKVQMNEIPEEGYNPYEPTVEWFSSKQ--E
ERB1_ASPTN        E-IPKGWTGLTDPSTGKPLELSQ-DELELLRKVQMNEIPEEGYDPYEPLMEWFSNKQ--E
ERB1_ASPNC        E-IPKGFTGLTDPSTGKPLELSQ-DELELLRKVQMNEIPEEGYNPYEPLMEWFSNKQ--E
ERB1_EMENI        E-IPKGWTGLTDPSTGKPLELSQ-DELELLRKVQMNEIPDEEYNPYEPLTEWFTTEK--E
ERB1_AJECN        E-LPKGFTGLTDPSTGKPLELNQ-DELELLRKVQMNEITEDGYDPYQPTIEYFTSKL--E
ERB1_CHAGB        E-VPKGWTGLTDVDTGNPLNLTQ-DELELVRRVQMGLLPTDLQDPYPDTVEYFTSIE--E
ERB1_PODAN        E-VPKGWTGLTDVNTGNPLNLTQ-EELELVRRVQHGLVPDEGYDPYPDTVEWFTSKQ--E
ERB1_NEUCR        E-VPKGWTGLTDIHTGNPLNLND-DELELVRRVQMGMIPNELENPYPETVEYFTGIE--E
ERB1_MAGO7        E-IPKGWTGLTDPTTGKPLNLSQ-DELELLKRVQMNEIPEEGYDPYPDTVEYFTGIE--E
ERB1_BOTFB        D-IPKGWTGLTDPSTGKPLNLTQ-EELEVLRRIQTNEVPEDGYDPYPDYVPYFSGVE--E
ERB1_PHANO        D-IPKGWTGLTDPQTGKPLNLSE-EELDVLKRLTRNEVVEDGYDPYPEMVAYFSGKQ--E
ERB1_PYRTR        D-IPKGWTGLTDPQTGKPLNLSE-EELDVLKRLTRNEVVEDGYDPYPEMVAYFSGKQ--E
ERB1_ASHGO        E-LPEGWTGLLDQNTGSSLNLTP-EELDLISKIQKNEQVDDSVDPYEPYVDWFTRHE--E
ERB1_KLULA        E-LPEGWTGLLDKDSGASLNLTE-EELELINKLQNNQQTDESVNPYEPLIDWFTRHE--S
ERB1_YEAST        E-LPEGWTGLLDKNSGSSLNLTK-EELELISKIQRNEQTDDSINPYEPLIDWFTRHE--E
ERB1_YEAS7        E-LPEGWTGLLDKNSGSSLNLTK-EELELISKIQRNEQTDDSINPYEPLIDWFTRHE--E
ERB1_CANGA        E-LPEGWTGLLDKESGASLNISK-EELELISKIQRNEQTDESTNPYEPLIDWFTRHE--E
ERB1_CANAL        D-LPEGWTGLLDQNTGTSLKLTD-EELELIRKIQQQENTDENINPYEPLIDWFTKDE--E
ERB1_PICST        D-LPQGWTGLLDQNTGSSLNLTD-EELELIRKIQQQENTDANIDPYEATIEWFTSKV--E
ERB1_LODEL        D-LPQGWTGLLDQNTGAPLKITD-EELELIRKIQQQENTDENINPYEPLNDWFTKNQ--E
ERB1_DEBHA        D-LPEGWTGLFDQNTGTSLKITD-DELELIRKIQAQESTDENINPYEPTIEWFTSKT--E
ERB1_PICGU        D-LPEGWTGLLDQNTGSSLKLTD-EELELIRKIQHNENTDDNINPYEPTIEWFTSKT--E
ERB1_YARLI        D-LPEGWTGLLDKSTGKGLNISK-EELELIKRIQKNETTDDASNPYEDLVEWFSSKT--E
ERB1_SCHPO        D-KDKGWTGIVDPMTGKPVNLTT-EELGLLKRLAQSEIPDENFDPYPDYDDFFTNTV--R
ERB1_COPC7        E-DPDSWTSAFDKKMQMDKPLTS-EELDIIQRLYAGENPDATYDPYEPMVEWFTGKGKEE
ERB1_CRYNJ        E-DPSAWTSAEDKLLQQNVQLSD-KELDIIRRLERAENPDADFDPYQPTIEWFTGEGKER
ERB1_MALGO        EGEGDGWFSAHDKTSGQDVKLTD-EELDIIQRLERAQIPVEAYDPYEPATDWFTQHQ--Q
ERB1_USTMA        DGDGEAWFSARDKSTGKDVRLSD-EELAIIRKLQNAEIPDDAYDPYEDYVDWFTGEDKVM
BOP1_DICDI        D--PNFWRTVYDKVNDKKVVLSD-DDMALLKSIQNKHFI-PGYDPYADWYDSGNN-HPDS
A0E170_PARTE      E-NKDWWRVVRDELNNQDVVLSD-KQLQLLDRIRTGKTAIKL--SDDYYFEHEDF----N
A0DKQ7_PARTE      E-NKDWWRVVRDEMNNQDVVLSD-KQLQLLDRIRTGKTAIKL--ADDYYFEHEDF----N
Q248A8_TETTS      E-DPNWWRTIQDELNQREIVLTD-EQLKLLERIRKGKFASKAIASNDYTVEYEYD----G
BOP1_LEIIN        D-DPNAMRTIYDALHDEKKTLSN-ADLQLIFNLQRNRTTNPNYDMYSEVQEDTVVFDPLN
BOP1_LEIMA        D-DPNAMRTIYDALHDEKKTLSN-ADLQLIFNLQRNRTTNPNYDMYSEVQEDTVVFDPLN
BOP1_LEIBR        D-DPNAMRTIYDALHDEKKTLSN-ADLQLIFNLQRNRTTNSNYDMYSGVQEDTVVFDPLN
Q384Z1_TRYB2      D-DPNAMRTIYDALHDEKKVLSN-ADLQMIFNLQRNRTPNPNYNMYEDVAVDTVEFDPLN
B3LAV2_PLAKH      T-DKNAWRKIKDKKNNRIVELTN-QDLEIIRSIRQNKVAKYLNEENYVYE------NEKE
A5K1G8_PLAVS      R-DQNAWKKIKDKKNNRVVELTN-QDLEIIRSIRQGKVAKRMNEENYVYE------NEKE
Q7RDY8_PLAYO      K-DVDAWRKIKDKKNNRVVTLTD-ADLEIIRKIRENSVAKYIDESSYIYE------NDGE
Q8IM36_PLAF7      R-DENHWRKIKDVKNNRVVQLTD-ADLQIIKSIRENKVATILNDANYIYE------NDKE
C4M3V4_ENTHI      D-DPNYYKTVYDEY-GNATVLNA-DDIRLVNAIISNKSDAQLEKDFPAVSYAYDD----W
V4YYZ6_TOXGV      D--PEGWRTIVDVKNNKKYRLTD-TDLEIIRRIRSGAFPAPTHDDEEVLIESDLEDS---
E2RU09_GIAIC      KDTNEFFRTVYDPAKGYKRANLTPEEEEMIRNVMVSRPYNDAPGLSRMNIQSTLVNKNIM
                      .      *             :   :  :                           

A7AMI3_BABBO      IHPVAYVPRPKANFMPSKF---EAAKIRRLVKLIKSGKLVVKD-----EPDELPE-EPPE
Q4UBJ6_THEAN      IHPVSFELPPKNRFLPSKW---EAMKVAKLVKLIKSGKIYTSEQKRLNELKKLEELERVE
BOP1_MOUSE        IHPVTNRPADKRSFIPSLV---EKEKVSRMVHAIKMGWIKPRRPHDPT--------PSFY
BOP1_RAT          IHPVTNRPADKRSFIPSLV---EKEKVSRLVHAIKMGWIKPRRPPDST--------PSFY
BOP1_HUMAN        IHPVTNRPADKRSFIPSLV---EKEKVSRMVHAIKMGWIQPRRPRDPT--------PSFY
BOP1A_XENLA       IHPVTNRPADKRSFIPSLI---EKEKVSKLVHAIKMGWIQPRKPREDT--------ATYY
BOP1B_XENLA       IHPVTNRPADKRSFIPSLI---EKEKVSKLVHAIKMGWIQPRKPRDDA--------PTYY
BOP1_XENTR        IHPVTNRPADKRSFIPSLI---EKEKVSKLVHAIKMGWIQPRKPRDDS--------PAYY
BOP1_DANRE        IHPVTNRPQDKRSFIPSLI---EKEKVGKLVHAIKMGWIKPRRPKETT--------PQYY
BOP1_AEDAE        KMPIRNIPDHKRSFLPSKS---EKQKVGRLVHALKMGWIKTRAETERLAA--LSKGPKFY
BOP1_CULQU        KMPIRNIPDHKRSFLPSKS---EKQKIGRLVHALKMGWVKTRAETERLAA--AAKGPKFY
BOP1_ANOGA        KMPIRNIPESKRSFLPSKA---EKHKIGRYVHALKMGWMKTMAEKRRLEA--IRRQPKFY
BOP1_DROER        KMPIKNVPDHKRSFLPSVS---EKKRVSRMVHALKMGWMKTTEEVEREKQ--AKRGPKFY
BOP1_DROYA        KMPIKNVPDHKRSFLPSVS---EKKRVSRMVHALKMGWMKTTEEVEREKQ--AKRGPKFY
BOP1_DROME        KMPIKNVPDHKRSFLPSVS---EKKRVSRMVHALKMGWMKTTEEVEREKQ--AKRGPKFY
BOP1_DROSE        KMPIKNVPDHKRSFLPSVS---EKKRVSRMVHALKMGWMKTTEEVEREKQ--AKRGPKFY
BOP1_DROAN        KMPIKNVPDHKRSFLPSVS---EKKRVGRMVHALKMGWMKTTEEVEREKQ--AKRGPKFY
BOP1_DROMO        KMPIKNVPDHKRSFLPSVS---EKKKVSRMVHALKMGWMKTTEEVEREKQ--QKRGPKFY
BOP1_DROVI        KMPIKNVPDHKRSFLPSVS---EKKKVSRMVHALKMGWMKTTEEVEREKQ--KKRGPKFY
BOP1_DROGR        KMPIKNVPDHKRSFLPSVS---EKKKVSRMVHALKMGWMKTTEEVERDKQ--QKRGPKFY
BOP1_DROPE        KMPIKNVPDHKRSFLPSGS---EKKTVSRMVHALKMGWMKTTEEVQREKQ--EKRGPKFY
BOP1_DROPS        KMPIKNVPDHKRSFLPSGS---EKKTVSRMVHALKMGWMKTTEEVQREKQ--EKRGPKFY
BOP1_DROWI        KMPIKNVPDHKRSFLPSVS---EKKRVSRMVHALKMGWMKTTEEVEREKQ--QKRGPKFY
BOP1_CAEBR        IHPIDNRPEPKARFIPSKD---EMRMVSRMVHAIKMGWAKGPKNKKEE--------PKAY
BOP1_CAEEL        IHPIDNRPEPKSRFIPSKD---EMRMVSRMVHAIKMGWAKGPRAKKEE--------HKSY
BOP1_BRUMA        IHPISNRPDSKRSFIPSLD---EKRLVGKMVHAIKMGWVRPSRPKQIE--------KRVY
BOP1_CHLRE        VMPIVDRPEPKSRFVPSKW---EEQKIVKLVRAIRKGWIKKTPEQEEEER--AAG-PPAY
F6HCQ7_VITVI      KHPLSNAPEPKRRFIPSKW---ESKKVVEYVRAIRKGLIKFDKPKEE---------PRVY
BOP1_MONBE        QTPVVDKPEPKRRFVPSKW---EHKKIMKIVRSIRKGLIKLPTSDDEKDK--SSEEEQYY
ERB1_ASPFU        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPFKPPTEEDE--EDDTIVKY
ERB1_ASPFC        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPFKPPTEEDE--EDDTIVKY
ERB1_NEOFI        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPFKPPTEEDE--EDDTIIKY
ERB1_ASPCL        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPFKPPTEEDK--EEDNVINY
ERB1_ASPOR        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPYKPPTEEED--KEQDVVNY
ERB1_ASPTN        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIKEGRILPYKPPTEED---EDKDVINY
ERB1_ASPNC        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPYKPPSEEKE--EDLELINY
ERB1_EMENI        IMPLSAAPEPKRRFVPSKH---EAKRVMKIVKAIREGRILPFKPQTQEDE--EDKDVIKY
ERB1_AJECN        IMPLNAAPEPKRRFVPSKH---EAKRVMKLVKAIREGRILPYKPLTEKAE--AEEGVWTY
ERB1_CHAGB        KMPLSSAPEPKRRFLPSKN---EAKQIMKLVRAIREGRILPYKPPEEREREEEEQEEVHF
ERB1_PODAN        TMPLSAAPEPKRRFLPSKN---EAKQVMKLVRAIREGRILPYKPPEEREREEEEKEEVQF
ERB1_NEUCR        KMPLSAAPEPKRRFLPSKN---EAKKIMKLVRAIREGRILPYKPPEEREKEEEE-EEQYF
ERB1_MAGO7        KMPLSAAPEPKRRFIPSKH---EAKRVMKLVRAIREGRIQPYKSKEEREKEEEGKEEKYY
ERB1_BOTFB        IMPLSSAPEPKRRFLPSKH---EAKRIMKIVRAIREGRILPYKPPQERE---EEEEEHHY
ERB1_PHANO        IMPLSAAPEPKRRFIPSKH---EAKRVMKIVKAIREGRIKPYKAPEERE---ED-EQISY
ERB1_PYRTR        IMPLSAAPEPKRRFIPSKH---EAKRVMKLVKAIREGRIQPYRAPEEQE---EEQDAFNF
ERB1_ASHGO        IMPVTAIPEPKRRFVPSKH---EAKRIMKIVKAIREGRIIPPNKLRELREQEQ-ANNFSY
ERB1_KLULA        VMPVTAVPEPKRRFVPSKH---EAKRVMKIVKAIREGRIIPPKKLKELREKEE-QDSHNY
ERB1_YEAST        VMPLTAVPEPKRRFVPSKN---EAKRVMKIVRAIREGRIIPPKKLKEMKEKEK-IENYQY
ERB1_YEAS7        VMPLTAVPEPKRRFVPSKN---EAKRVMKIVRAIREGRIIPPKKLKEMKEKEK-TENYQY
ERB1_CANGA        VMPLSAAPEPKRRFVPSKN---EAKRIMKIVKAIREGRIIPPKKMKELREKEK-SEDFNY
ERB1_CANAL        IMPVTAVPEPKRRFVPSKH---EAKRVMKIVKAIREGRIIPPNKVKQQLTEEEEEDQFNF
ERB1_PICST        VMPLTAVPEPKRRFVPSKH---EAKRVMKIVRAIREGRIIPPSKVKEQIEEE----RLNY
ERB1_LODEL        VMPLTAVPEPKRRFVPSKH---EAKRVMKIVKAIREGRILTPEKAKELKEKE--TEEMNY
ERB1_DEBHA        VMPLTAVPEPKRRFVPSKH---EAKKVMKIVRAIREGRIVPPNKVKEQQEEE----KYNF
ERB1_PICGU        VMPLTAVPEPKRRFVPSKH---EAKRIMKIVRAIRDGRIVPPEKRKEQQDEE----QYNF
ERB1_YARLI        IMPLSAAPEPKRRFIPSKH---EAKRVMKMVQAIRQGKLLTKPK-----EDPD--ARPNY
ERB1_SCHPO        ETPLSSAPEPKRRFAPSKH---EQKRILQLAYAIRKGRILTSEQRAERER-ESQSNYADH
ERB1_COPC7        IMPLSAAPEPKRRWVRSKW---EKQKIMKIVRAIRQGRIVPNKPKTSSK------QFEFY
ERB1_CRYNJ        VMPLSAAPEPKRRFVPSKW---EHKKIMKIVKAIREGRIIPNKP--SAE------KPRFY
ERB1_MALGO        TTPLTARPEPKRRFVPSKW---EHKKIMKIVRAIRQGRIVAHAPGRE--------RPAFY
ERB1_USTMA        QTALSGRPEPKSRFVPSKW---EHKKVMKIVRAIREGRIVPGAAANKDA------KPKFY
BOP1_DICDI        IHPMHNAPVPKRSFFPNGTD--EEREIRRLTKAIRMGWIKLNKKGKKGEK---DKKDGNF
A0E170_PARTE      QFDLLSSYNPKRRFLPSKW---ERIKINKLVQGIKLGRIVLN---------PPQKVEKMF
A0DKQ7_PARTE      QFDLLSSYNPKRRFLPSKW---ERIKINKLVQGIKLGRIVLN---------PPQKVEKIF
Q248A8_TETTS      TMPLSSAPIPKRRFMPSKN---ERIKVNKLVQAIQLGRIDPKKYLEDQEK-EEEQEEMLF
BOP1_LEIIN        HPLARSGGPSKRAFVPALH---DMKVIAKMVRRLRKEEAERKLRPGKEEKE-----EEDQ
BOP1_LEIMA        HPLARSGGPSKKAFVPALH---DMKVIAKMVRRLRKEEAERRLRPAKEEKE-----EEDQ
BOP1_LEIBR        HPLARSSGPSKKAFVPALH---DTKVIAKMVRRLRKEEAESKLRPATEEKE-----DEDQ
Q384Z1_TRYB2      HPLARSAGPSKRKFLPSDR---DMKTIAKMVRRMMKEDKEKENKP-KDETE-----SETT
B3LAV2_PLAKH      EYKLGVKEPSNRKYKQSAE---EKRKIEQIIMHLMDKEKNPEKYKKEDD-----EYKLLY
A5K1G8_PLAVS      EYKLGVKEPANRKYKQSAE---EKKKIQQLIMHLMDKEKNPEKYKKEED-----EFKLLY
Q7RDY8_PLAYO      EYKLPTNFNVNKNNKVSKG---EKKKILKLMKYLIDKEKHPEKYKNNQNSN--QEELTLY
Q8IM36_PLAF7      EYKLYPSGIINQKKNEENGSVHERKKISKIMNYLRNKEKYPERYKDKKEN----DEDYIY
C4M3V4_ENTHI      MIPLNDYTPPKQRFIPSQK---EHIRIKKLAAKLRKQFITLPQNVTKKAR--------VK
V4YYZ6_TOXGV      IFPMHNKPVPKSRFLPSKH---EQKKITHLVHQIRSGRLLKEAQRQRAEA----SPAAVF
E2RU09_GIAIC      RTALTSDIVGPKEKYASKA---IVRKIEKLREGIERGEIVYDPNRYKVDEN-RGLVVGNR
                                            : .    :                          

A7AMI3_BABBO      DIWGDCI-Y-QYDPKTARRGRHEEITAPKAPLPTHSESYNPPEEYLFDDKEKEEWL--ET
Q4UBJ6_THEAN      DIWKDSI-Y-DVDPTSAKRSYKHEIKPPKIALPTNSESYNPPEEYLLNEEETKEWK--ET
BOP1_MOUSE        DLWA------QEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLPTEEERSAWM--QQ
BOP1_RAT          DLWA------QEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLPTEEERLAWM--QQ
BOP1_HUMAN        DLWA------QEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLLSEEERLAWE--QQ
BOP1A_XENLA       DLWA------KEDPNSILGRHKMHVPAPKLPLPGHEQSYNPPPEYLMSEEERLSWE--QQ
BOP1B_XENLA       DLWA------KEDPNAILGRHKMHVPAPKLPLPGHEQSYNPPPEYLMSEEERLAWE--QQ
BOP1_XENTR        DLWA------KEDPNAILGRHKMHVPAPKLPLPGHEQSYNPPPEYLMSEEERLAWE--QQ
BOP1_DANRE        DLWA------KEDPNSILGRHKMHVPAPKMKLPGHEESYNPPPEYLLSEEERLAWA--AQ
BOP1_AEDAE        MIWE------SDHGKEEMRRIHDHVVAPKRPLPGHAESYNPPPEYLFNEQELAEWNSHEE
BOP1_CULQU        MVWD------SDHGKEDIRRIHDHVVAPKRPLPGHAESYNPPPEYLFNERELAEWNSHEE
BOP1_ANOGA        MLWT------TDHGKEEMRRIHDHVAAPKRMLPGHAESYNPPPEYLFDEKELEEWNKLAN
BOP1_DROER        MLWE------TDTSREHMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDAKETKEWLKLKD
BOP1_DROYA        MLWE------TDTSREHMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDAKETKEWLKLKD
BOP1_DROME        MLWE------TDTSREHMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDAKETKEWLKLKD
BOP1_DROSE        MLWE------TDTSREHMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDAKETKEWLKLKD
BOP1_DROAN        MLWE------TDTSREHMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDERETKEWLKLKD
BOP1_DROMO        MLWE------TDTGREHMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDEKETKEWLKLKD
BOP1_DROVI        MLWE------TDTGRESMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDEKETKEWLKQKD
BOP1_DROGR        MLWE------TDTGREHIRRIHDPVSAPKRDLPGHAESYNPPPEYLFDAKEMKEWLKYKD
BOP1_DROPE        MLWE------TDTSREQMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDEKEAKEWHKLKD
BOP1_DROPS        MLWE------TDTSREQMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDEKEAKEWHKLKD
BOP1_DROWI        MLWE------TDTGREQMRRIHDPVSAPKRDLPGHAESYNPPPEYLFDEKETKQWLKLKD
BOP1_CAEBR        DLWASEDAL-DNVTKSQLSRMRVHMPAPKVALPTHAESYNPPEEYLFDDEERKKWE--EA
BOP1_CAEEL        DLWASEDAL-DNVTKSQLSRMRVHMPAPKVALPTHAESYNPPEEYIFDDEERKKWE--EA
BOP1_BRUMA        DLWA-DNPC-SEKTKTELARIRMHFPAPKVPLPGHAESYNPPAEYLCDEEELKKWE--ET
BOP1_CHLRE        LLWADDG-L-TDEAAAKAGSGLTYIPAPKLQLPGHADSYNPPAEYLPTEEEVAAWQ--MA
F6HCQ7_VITVI      HLWGDD-----SSSTEKAGHGLAYIPAPKSKLPGHEESYNPSLEYIPTQEEINSYQ--LM
BOP1_MONBE        DVWGNED-D-PNDPRIKVRQA-NHIAAPKVALPHHAESYNPPEEYLPTDAEAEKWR--NA
ERB1_ASPFU        DLWADE-------AERKDH--PMHIPAPKLPPPGYEESYHPPPEYLPSRKERKTWE--EA
ERB1_ASPFC        DLWADE-------AERKDH--PMHIPAPKLPPPGYEESYHPPPEYLPSRKERKTWE--EA
ERB1_NEOFI        DLWADE-------AERKDH--PMHIPAPKLPPPGYEESYHPPPEYLPSQKERKAWE--EA
ERB1_ASPCL        DLWADE-------AERPDH--IMHIPAPKLPPPGYEESYHPPPEYLPDKKERKAWE--EA
ERB1_ASPOR        DLWADE-------TERPDH--PMHIPAPKLPPPGYEESYHPPPEYLPDKKERKAWE--EA
ERB1_ASPTN        DLWADE-------AERPDH--PMHVPAPKLPPPGYEESYHPPPEYLPDKKERKAWE--ET
ERB1_ASPNC        DLWADE-------AERPDH--PMHVPAPKLPPPGYEESYHPPPEYLPDNKERKAWQ--EA
ERB1_EMENI        DLWADE-------AERPDH--PMHVPAPKLPPPGYEESYHPPPEYLPDKKERKAWE--DA
ERB1_AJECN        DLWANE-------TPRADH--PMHIPAPKLPPPGYEESYHPPPEYLPDEKEKAAWL--NT
ERB1_CHAGB        DLWQNE-------EPQAPN--PMHIPAPKLAPPGYDLSYNPPEEYLPSKEEREEWE--NA
ERB1_PODAN        DIWQDE-------EPAAPN--PMHIPAPKLPPPGYEMSYNPPEEYLPTEEEREEWE--KT
ERB1_NEUCR        DIWQDE-------VPQEVN--PLHIPAPKLPPPGFDMSYNPPAEYLPTKEEREEWE--KL
ERB1_MAGO7        DVWQDE-------QPRDPH--VMHIPAPKLAPPGYDMSYNPPPEYLPTKAEREEWE--KM
ERB1_BOTFB        DIWQNE-------EAQPDH--IMKIPAPKPPPPGYDLSYNPPPEYLPSKAERKEWE--AT
ERB1_PHANO        DVWADE-------KPRPEH--SMHIPAPKLPPPGYEASYHPPPEYLPDKAEEEAWL--QA
ERB1_PYRTR        DVWADE-------KPRPDN--SMHIPAPKLPPPGYEASYHPPPEYLPDKAEEQAWL--EA
ERB1_ASHGO        DLWGDS-------EETNEH--IMNLRAPKLPPPTNEESYNPPEEYLLTPEERAEWE--KM
ERB1_KLULA        DLWGDA-------EEISEH--VMNLRAPKLPPPTNEESYNPPEEYLLTPEEIDAWE--KM
ERB1_YEAST        DLWGDS-------TETNDH--VMHLRAPKLPPPTNEESYNPPEEYLLSPEEKEAWE--NT
ERB1_YEAS7        DLWGDS-------TETNDH--VMHLRAPKLPPPTNEESYNPPEEYLLSPEEKEAWE--NT
ERB1_CANGA        DLWGDS-------TETNDH--IMNLRAPKLPPPTNEESYNPPAEYLPTEEEIKEWE--NT
ERB1_CANAL        DLWQDE-------IEISDH--IMNLRAPKLPPPTNEESYNPPEEYLLTEEEKSKWL--QE
ERB1_PICST        DLWNDDD------IAVEDH--IMNLRAPKLPPPTNEESYNPPEEYLLTEEEKKQWE--SL
ERB1_LODEL        DLWQNE-------SEVPDH--IMNLRAPKLPPPTNEESYNPPEEYLLNEEEKQKWL--EQ
ERB1_DEBHA        DLWNDNE------SETKDH--IMNLRAPKLPPPTNEESYNPPEEYLMDEEEKKKWL--EM
ERB1_PICGU        DLWDDNT------DEPNEH--IMNLRAPKLPPPTNEESYNPPEEYLMTEEERKKWE--ET
ERB1_YARLI        DVWADNL------TDVQDH--VMTLRAPKMPPPTHDESYNPPAEYLPTEEEIAEWN--AL
ERB1_SCHPO        DLWADDD------QATVNQRKLDYAPAPKLPPPSHEESYNPPEEYLKQSSD---------
ERB1_COPC7        SIWS-SE------PSSSQ---PPPLPAPKRPLPTNAESYNPPEEYLPTEEEKQEWL--KQ
ERB1_CRYNJ        PIWSDAD------QHNPH---VMYMPAPQLPPPKTAESYNPPEEYLPTEEEKAEWE--AM
ERB1_MALGO        NLWSDAD------EARADHP-MH-MPAPKLPLPSHVESYNPPAEYLFGDDEKAEWE--AA
ERB1_USTMA        NIWADAH------ENDTRSP-WAVMAAPKLALPGHAESYNPPAEYLFNEQEQKEWQ--EA
BOP1_DICDI        DLWADEG------EEKEKTKGIRRIAAPKQKLPGNVESFNPPEEYLLNENELKAWH--LM
A0E170_PARTE      DIWENVA-----EDQVLSKYLPARIPASKAQLPSNVASYNPPEEYLFTEQEKQQWL--QT
A0DKQ7_PARTE      DIWENVA-----EDQVLSKYLPARIPASKAQLPSNVASYNPPEEYLFTEQEKQQWL--QT
Q248A8_TETTS      DIWEGTK-----DQDEIQKKLPPAISAPKVKPPGHNESYNPPSEYLMSEKEKKEWQ--NA
BOP1_LEIIN        LLWDDGH---VEMDTHTHFKYFNRVPKPKLPPPGTFESYRPPPEYLPSERAKQRQA--RL
BOP1_LEIMA        LLWDDSH---VEMDTHTHFKYFNRIPKPKLPPPGTFESYRPPPEYLPSERAKQRQA--RL
BOP1_LEIBR        LLWDDGH---VEMDTHTHFKYFNRVPKPKVPPPGTFESYRPPPEYLPSERAKQRQA--RL
Q384Z1_TRYB2      ILWDDGK---VVMDTHTHFKYHNRVPKPKAAPPGTYESYRPPPEYLPSERAKERFA--RL
B3LAV2_PLAKH      DLWRNKI--------YDDFNNFNEMNLPNI-LPGHKYSYNPPPELMYNSAERRKILK---
A5K1G8_PLAVS      DLWKHKI--------YDDFNNVNEMNLPNI-LPGHKYSYNPPPELMYNSADRRKILK---
Q7RDY8_PLAYO      DMWNNKI--------YDEYSNMNEINLPNI-LPGHKYSYNPPPELIYTNSDEKNILK---
Q8IM36_PLAF7      DLWNNRI--------YDEFNNINEISLPHI-LPGHKYSYNPPPELMLSSSEKRKLLK---
C4M3V4_ENTHI      DIWGAGV-----------HKKKYHLPLPPVKLPGNSASYHPAPEYK--------------
V4YYZ6_TOXGV      DLWGTSVYVDRSGGDRRKKGLPVALPAPKLALPGHAESYNPPEEFLFNDDEKKQWE--AM
E2RU09_GIAIC      DLWADVDETEDPSMRIPKGRGEMYMNPTKPKLPGHALSYNPPLEYLNIDGDGSQQK----
                   :*                        .    *    *:.*. *                

A7AMI3_BABBO      DPEERKIDYLPQQHECLRRVGSYQNLILERFRRCLQLYLCPRAVKLKMNVD-PESLYPKL
Q4UBJ6_THEAN      PEHERSVNYLPTQYSSMRLVPVYPNLIVERFNRCLQLLMCPRAVKLKMNVD-PESLLPKL
BOP1_MOUSE        EPVERKLNFLPQKFPSLRTVPAYSRFIQERFERCLDLYLCPRQRKMRVNVD-PEDLIPKL
BOP1_RAT          EPIERKLNFLPQKFPSLRTVPAYGRFIQERFERCLDLYLCPRQRKMRVNVD-PEDLIPKL
BOP1_HUMAN        EPGERKLSFLPRKFPSLRAVPAYGRFIQERFERCLDLYLCPRQRKMRVNVD-PEDLIPKL
BOP1A_XENLA       DPEDRKLPFLPQRFNCLRAVPGYARFIHERFERCLDLYLCPRQRKMRVNVD-PEDLIPKL
BOP1B_XENLA       DPEDRKLPFLPQRFNCLRAVPGYARFIHERFERCLDLYLCPRQRKMRVNVD-PEDLIPKL
BOP1_XENTR        DPEDRKVPFLPQRFPCLRAVPGYARFIHERFERCLDLYLCPRQRKMRVNVD-PEDLIPKL
BOP1_DANRE        DPEDRKLSFLPQKFSCLRAVPAFSRFIHERFERCLDLYLCPRQRKMRVNVN-PEDLIPKL
BOP1_AEDAE        EPWKRKLHYVPQKFNSLREVPYYDKYIRERFLRCLDLYLCPRGKRTRVTVG-PEYLIPKL
BOP1_CULQU        EPWRRKLHYIPQKFNSLREVPYYAQYVRERFLRCLDLYLCPRGKRTRVTVG-PEYLIPKL
BOP1_ANOGA        QPWKRKRAYVPQKYNSLREVPGYTRYVKERFLRCLDLYLAPRMRRSRVAVG-AEYLIPKL
BOP1_DROER        EPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROYA        EPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROME        EPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROSE        EPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROAN        EPHKRKLHFMPQKFTSLRAVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROMO        EPHKRKLHFMPQKYKSLRAVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROVI        EPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROGR        EPHKRKLHFMPQKFKSLREVPAYSRFLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROPE        EPHRRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROPS        EPHRRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_DROWI        EPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLCPRAKRVKLNID-AEYLIPKL
BOP1_CAEBR        EKEDRVLNFMPSKYDALRKVPQYDKFITERFERCLDLYLAPRQRKMRIHAD-PTDLLPDL
BOP1_CAEEL        EKEDRVLNFMPSKYDALRKVPQYDKFITERFERCLDLYLAPRQRKMRIHAD-PTDLLPDL
BOP1_BRUMA        DPEDRRLDFIPKKYDCLRKVPAYDRFYNDRYQRCLDLYLAPRQRKMKLNID-HTELLPEL
BOP1_CHLRE        DPEDRPK-ALPQAFTSLRAVPAYTDFIKERFERCLDLYLCPRVRRKRLDIKSPEQLVPQL
F6HCQ7_VITVI      YEEDRPK-FIPRRFLSLRSVPAYENAVKESFDRCLDLYLCPRARKKRINID-PESLKPKL
BOP1_MONBE        HEDDRERNYLPHKYGSLRLVPAYDQYIQERFHRCLDLYLCPRARRIRMNVD-PEDLLPKL
ERB1_ASPFU        DPEDRDREFLPNDFGSLRRVPGYENFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_ASPFC        DPEDRDREFLPNDFGSLRRVPGYENFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_NEOFI        DPEDRASEFLPNDFGSLRRVPGYENFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_ASPCL        DPEDREQEFLPNDFGSLRRVPGYENFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_ASPOR        DPEDREREYLPNDFGSLRKVPGYESFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_ASPTN        DPEDREQEFLPNDFGSLRKVPGYENFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_ASPNC        DPEDREREYLPTDFGSLRKVPGYGEFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_EMENI        DPEDREREFLPQDFGSLRRVPGYENFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_AJECN        DPEDREREYLPADYDALRKVPGYDSFVKEKFERCLDLYLAPRVRRSKLNID-PESLLPKL
ERB1_CHAGB        DPEDREKEYLPQKHNALRKVPAWGNLVKERFERCMDLYLAPRIRKNRLNID-PNSLLPKL
ERB1_PODAN        DPEDREKEFLPQKFNSLRKVPAWGTLVKERFERCMDLYLAPRVRKNRLNID-PNSLLPKL
ERB1_NEUCR        DPEEREKEYLPQKYDSLRKVPGYGEIVKERFERCMDLYLAPRVRKNRLNID-PNSLLPKL
ERB1_MAGO7        DPEDREKEYLPQKFDALRKVPGYETFVKERFERCLDLYLAPRVRKNRLNID-PASLLPKL
ERB1_BOTFB        DPEDREKEYLPTAYDSLRKVPGYDKFINERFERSLDLYLAPRVRKNRLNID-PASLLPKL
ERB1_PHANO        DEEDREKDFLPKNYEALRKVPGYETFVKERFERSLDLYLAPRVRRNRLNID-PESLLPKL
ERB1_PYRTR        DEEDREREFLPKNYDALRKVPGYETFVKERFERSLDLYLAPRIRRNRLNID-PESLLPKL
ERB1_ASHGO        DPSDRKRNFLPQKYGSLRKVPGYGESVRERFERSLDLYLAPRVRKNKLNID-PESLIPEL
ERB1_KLULA        EPSERERNFVPHKFAALRKVPGYSESVRERFERSLDLYLAPRVRKNKLNID-PESLIPEL
ERB1_YEAST        EYSERERNFIPQKYSALRKVPGYGESIRERFERSLDLYLAPRVRKNKLNID-PNSLIPEL
ERB1_YEAS7        EYSERERNFVPQKYSALRKVPGYGESIRERFERSLDLYLAPRVRKNKLNID-PNSLIPEL
ERB1_CANGA        EYSERERNFVPKKYDSLRKVPGYTESVRERFERSLDLYLAPRMRKNKLNID-PESLIPEL
ERB1_CANAL        SPIDRERNFLPQKYNSLRQVPGYQDSVRERFERSLDLYLAPRVRHNKLNID-PDSLIPDL
ERB1_PICST        DPADRERNFLPQKFGALRKVPGYQESVRERFERCLDLYLAPRVRHNKLNID-PESLIPEL
ERB1_LODEL        DPVDRERNFIPQKYSSLRLVPGYQDSVRERFERSLDLYLAPRLRKNKLNID-PESLIPEL
ERB1_DEBHA        EPEDRDKNYIPQKYNSLRKVPGYQEGLRERFERCLDLYLAPRTRHNKLNID-PDSLIPEL
ERB1_PICGU        DPSERETNFIPQKYGSLRKVPAYQENLRERFERSLDLYLAPRVRHNKLNID-PDSLIPDL
ERB1_YARLI        APSERERNYVPKKYTALRHVPGYSESVRERFERSLDLYLAPRVRKNKLNID-PDSLIPDL
ERB1_SCHPO        ---------FPKKYKSLRVVPAYSNLIKEKFERCLDLYLAPRVRRTKLNID-PESLLPKL
ERB1_COPC7        DPEDRERDFLPQKFSSLRHVPAYDQFIKERFNRQLDLYLAPRIQRVKLNID-PNSLIPKL
ERB1_CRYNJ        DKEDRKTDFLPEKYDALRKVPGYKNLVQEKFERCLDLYLAPRTRRVKLNID-PDSLIPKL
ERB1_MALGO        EPEDRKLPFLPAKYAALRLVPGYDQALHERFQRCLDLYMAPRMRRKRLDIDDPDQLLPKL
ERB1_USTMA        EAEDRKQNFLPTKHDSLRRVGAYQNFVQERFERCLDLYLAPRMMRKKLDIHNPENLLPKL
BOP1_DICDI        DPRERPHNFIPQKYQSLRQLPIYNKLIKERFERCLDLYLCPRTTRVKQFTKDPTKFLPTL
A0E170_PARTE      DPEDREIPFIPQKFKHLRNVPSSEQLAKDLFNRCLDLYLAPRIRRKKLMMK-STDFLPEI
A0DKQ7_PARTE      DPEDREIPFIPQKFKHLRNVPSSEQLAKDLFNRCLDLYLAPRIRRKKLMMK-STDFLPEI
Q248A8_TETTS      HPEDREIPFIPKKYDCLRHVEFYQGLITERFERQLDLYLCPRIRKKKLDID-PETLVPSI
BOP1_LEIIN        RAIDRKEHFLPQSFDALRHVPFYHHTIQDRYQRCLDLAFFPRAQRTRLVVD-PDKLLPEL
BOP1_LEIMA        RTIDRKEHFLPQSFDALRHVPFYHHTIQDRYQRCLDLAFFPRAQRTRLVVD-PDKLLPEL
BOP1_LEIBR        RTIDRREHFLPQSFDALRHVPFYHHTIQDRYQRCLDLAFFPRAQRTRLVVD-PDKLLPEL
Q384Z1_TRYB2      RAIDKKEHFLPRAFDALRHVPFYNHTIQDRYQRCLDLAFFPRAQRTRLVVD-PSKLLPEL
B3LAV2_PLAKH      ---QNNDAFIPQNFEKIRNIEFYKKTYFELYQRCLDLYLCSRSLKNVLHIK-KEDLLPKL
A5K1G8_PLAVS      ---QNSDAFIPQNFEKIRNIEFYKKTYFELYQRCLDIYLCSRSLKNVLHIK-KEDLLPKL
Q7RDY8_PLAYO      ---NNKDAFIPKNWEKITNIEYYKKTYYDLYQRCLDIYLCSRSVKSVLDIK-KEDLLPKL
Q8IM36_PLAF7      ---NNKDAFIPQNFKNIRNIEYYKKTYFDLYQRCLDIYLCSRTLKNVLHIN-KEDLLPKL
C4M3V4_ENTHI      -------NENNTNYDRLMDIPQYSNLLNDVYSRCLQLYVAPR-RLVKVPEHRDPLKELIL
V4YYZ6_TOXGV      APEDRPLSFLPQRHSALRLVGAYKDLILERFNRCLDLYLCPRSLKMAMNVD-PESLLPQL
E2RU09_GIAIC      -------------LQSLRQIKTYTNFVKDQFDRCVTLYLNPRQRLRKEEDM--DSMLPTL
                                  :  :        : : * : : . .*                 :

A7AMI3_BABBO      PDIDSLRPFPTRLSVEY--------------R--------------VKGVRKLSVDS---
Q4UBJ6_THEAN      PSPSELGPYPKIVSVEY--------------R--------------FKGLKRLSVDC---
BOP1_MOUSE        PRPRDLQPFPVCQALVY-----------RGH---------------SDLVRCLSVSP---
BOP1_RAT          PRPRDLQPFPVCQALVY-----------RGH---------------SDLVRCLSVSP---
BOP1_HUMAN        PRPRDLQPFPTCQALVY-----------RGH---------------SDLVRCLSVSP---
BOP1A_XENLA       PKPRDLQPFPTIQSLIY-----------KGH---------------KDLVRCISVSP---
BOP1B_XENLA       PKPRDLQPFPTIQSMIY-----------KGH---------------KDLVRCISVSP---
BOP1_XENTR        PKPRDLQPFPTVQSLIY-----------RGH---------------KDLVRCISVAP---
BOP1_DANRE        PKPKDLQPFPTTQSLVY-----------RGH---------------SSLVRSISVSP---
BOP1_AEDAE        PSPKDLQPFPTLQNLIY-----------KGH---------------TDMIRSVSIEP---
BOP1_CULQU        PSPKDLQPFPTLQNLVY-----------RGH---------------TDMIRTISIEP---
BOP1_ANOGA        PSPRDLQPFPTLQNLIY-----------TGH---------------TSLIRCISVEP---
BOP1_DROER        PSPRDLQPFPTVESMVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROYA        PSPRDLQPFPTVESMVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROME        PSPRDLQPFPTVESMVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROSE        PSPRDLQPFPTVESMVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROAN        PSPRDLQPFPTIESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROMO        PSPRDLQPFPTVESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROVI        PSPRDLQPFPTVESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROGR        PSPRDLQPFPTVESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROPE        PSPRDLQPFPTVESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROPS        PSPRDLQPFPTVESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_DROWI        PSPRDLQPFPTVESLVY-----------RGH---------------TDLVRSVSVEP---
BOP1_CAEBR        PNPNDLRPFPTTLAFYM-----------RGH---------------TGQVRAISVEPV--
BOP1_CAEEL        PNPNDLRPFPTTLAFYM-----------RGH---------------TGQVRAITVEPE--
BOP1_BRUMA        PNLTDMRPFPTTQSFLM-----------LGH---------------SGQVRSLSFEPE--
BOP1_CHLRE        PKPRDLQPFPTTLALAY-----------EGH---------------MGPVASIAPDPW--
F6HCQ7_VITVI      PSRKDLKPYPVTCYLEY-----------KGH---------------KGAVMSIATEA---
BOP1_MONBE        PKPEDLQPFPSAPSLVY-----------RGH---------------KARVTSISCDP---
ERB1_ASPFU        PSPEELKPFPTACATVF-----------RGH---------------KGRVRTLAVDP---
ERB1_ASPFC        PSPEELKPFPTACATVF-----------RGH---------------KGRVRTLAVDP---
ERB1_NEOFI        PSPEELKPFPTACATVF-----------RGH---------------KGRVRTLAVDP---
ERB1_ASPCL        PSPEELKPFPTACATVF-----------RGH---------------KGRVRSLAVDP---
ERB1_ASPOR        PSPEELKPFPTACATVF-----------RGH---------------KGRVRTLAVDP---
ERB1_ASPTN        PSPEELKPFPTTCATVF-----------RGH---------------KGRVRTVSVDP---
ERB1_ASPNC        PSPEELKPFPSVCATVF-----------RGH---------------KGRVRSLAVDP---
ERB1_EMENI        PSPEELKPFPTACAAVF-----------RGH---------------KGRVRSLAVDP---
ERB1_AJECN        PSPEELKPFPSTCATLF-----------RGH---------------SGRVRTLAIDP---
ERB1_CHAGB        PSPSELKPFPTVAQTIF-----------RGH---------------EGRVRSVSVDP---
ERB1_PODAN        PSPAELKPFPTVVQTIF-----------RGH---------------EGTVRSIAIDP---
ERB1_NEUCR        PSPSELKPFPTVAQTVF-----------RGH---------------DGRVRSVAIDP---
ERB1_MAGO7        PRPEELKPFPTVCQAIF-----------RGH---------------EGRVRSSAIDP---
ERB1_BOTFB        PKPEELKPFPTVTQTLF-----------RGH---------------DGRVRSLAIDP---
ERB1_PHANO        PDPEDLKPFPTTCAAIF-----------RGQ---------------EGRVRCVSVDP---
ERB1_PYRTR        PNPEDLKPFPTTCAAIF-----------RGQ---------------EGRVRCVSIDP---
ERB1_ASHGO        PSPKDLRPFPIRCSTVY-----------AGH---------------KGKIRTLSIDP---
ERB1_KLULA        PSTKDLRPFPIRCSTVY-----------VGH---------------KGKIRTMSIDP---
ERB1_YEAST        PSPKDLRPFPIRCSTIY-----------AGH---------------KGKVRTLSIDP---
ERB1_YEAS7        PSPKDLRPFPIRCSTIY-----------AGH---------------KGKVRTLSIDP---
ERB1_CANGA        PSPKDLRPFPIRCSTIY-----------SGH---------------EGKIRTLSIDP---
ERB1_CANAL        PSPKDLRPFPIRCSTIY-----------EGH---------------TGKIRTISIDP---
ERB1_PICST        PSPKDLRPFPIRCSTVY-----------QGH---------------TDKIRTISIDP---
ERB1_LODEL        PSPKDLRPFPIKCSTVY-----------EGH---------------TGKIRTLSIDP---
ERB1_DEBHA        PSPKDLRPFPIRCSTIF-----------QGH---------------TEKIRTLSISP---
ERB1_PICGU        PSPKDLRPFPIKCSTIF-----------QGH---------------IGRVRTLSIDP---
ERB1_YARLI        PSPKDLMPFPIRCATTY-----------KGH---------------KGKVRAISVDP---
ERB1_SCHPO        PTPSELRPFPTRCTNVF-----------IGH---------------KGRVRCLSVHV---
ERB1_COPC7        PSPSSLKPFPNYRSLLF-----------THP---------------KGRARCVSVSP---
ERB1_CRYNJ        PAPKELKPFPIASTVQY-----------RHPG--------------DTRVRSVSTSP---
ERB1_MALGO        PAPRDLRPFPTHTDVVY-----------AHAP--------------W-RIRTVSIDP---
ERB1_USTMA        PSPKELRPFPITTSVVY-----------VHPD--------------GGRVRCLSVDP---
BOP1_DICDI        PKPQDLRPFPSHEEIQF-----------LGH---------------KARVRSISISP---
A0E170_PARTE      PKPEELKPFPTKLNFEFGQI--------DTTK--------------SGQVKQISISQ---
A0DKQ7_PARTE      PKPEELKPFPTRLNFEFGQI--------DTTK--------------SGQVKQISISQ---
Q248A8_TETTS      PKPQELRPYPTSLNIQY------------KAH--------------KGRVRGISVLY---
BOP1_LEIIN        PDPKDLRPYPEKLSFHY-----------KGH---------------TATVRSVSVSP---
BOP1_LEIMA        PDPKDLRPYPEKLSFHY-----------KGH---------------TATVRSVSVSP---
BOP1_LEIBR        PNPKDLRPYPEKLSFHY-----------KGH---------------TATVRSVSVSP---
Q384Z1_TRYB2      PDPRDLRPYPERLSFQY-----------KGH---------------TATVRSVAVNP---
B3LAV2_PLAKH      PSTQSLKPYPQYPFVKYNMD--------E-------------AINGDKNKYLNQIDVM--
A5K1G8_PLAVS      PSTQSLKPYPQHPFVKYIMD--------D-------------PLSGDKNKYLSQIDVS--
Q7RDY8_PLAYO      PTTQSLKPYPQYPFIKYNIN--------D-------------KIKNEDN-GHNYICLN--
Q8IM36_PLAF7      PSKKSLKPYPECAFVHYVSN--------VEEDEKTVDDINKKKMNKNISSYLYPIDIN--
C4M3V4_ENTHI      PPLEELRPFPSNRNGVVKV---------------------------KEVMRCIVVDP---
V4YYZ6_TOXGV      PSPNELRPFPTHRRVDYLPLSLYCQFQPQALPLLTLSEARRRAREEQGSVHAASSKSGDA
E2RU09_GIAIC      PNRSLLTPYPTFCAMTIRTG--------------------------TRRINGLTFSP---
                  *    : *:*                                                  

A7AMI3_BABBO      ----------TGHWIVLASES-SLSLCNLLDGRVFDSIEGMNSIF---------------
Q4UBJ6_THEAN      ----------TGRFLALSSSE-LINICDVLTGRPFLTLE-FHDIH---------------
BOP1_MOUSE        ----------GGQWLASGSDDGTLKLWEVATARCMKTVHVGG------------------
BOP1_RAT          ----------GGQWLASGSDDGTLRLWEVATARCMKTVRVGG------------------
BOP1_HUMAN        ----------GGQWLVSGSDDGSLRLWEVATARCVRTVPVGG------------------
BOP1A_XENLA       ----------SGQWLVSGSDDCSVRFWEVSTGRCMKSVVLEG------------------
BOP1B_XENLA       ----------SGQWLVSGSDDCSVRFWEVSTGRCMKSVVLEG------------------
BOP1_XENTR        ----------SGQWLVSGSDDCTVRFWEVGTGRCMKSVLLEG------------------
BOP1_DANRE        ----------SGQWLVSGSDDCTVRFWEVSTARCLKTVQVGG------------------
BOP1_AEDAE        ----------KGEYLVTGSDDQTVKIWEVSTARCIRTIPTGD------------------
BOP1_CULQU        ----------KGEYLVTGSDDKTIKIWEVSTARCIKTIPTGD------------------
BOP1_ANOGA        ----------KGEYIVTGSDDMTVKIWEISTARCIRTIPTGD------------------
BOP1_DROER        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETDE------------------
BOP1_DROYA        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETDE------------------
BOP1_DROME        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETDE------------------
BOP1_DROSE        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETDE------------------
BOP1_DROAN        ----------KGEYIVSGSDDKTVKIWEIATGRCIRTIETED------------------
BOP1_DROMO        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETND------------------
BOP1_DROVI        ----------KGEYMASGSDDKTVKIWEIATGRCIRTIETND------------------
BOP1_DROGR        ----------KGEYIVSGSDDKTVKIWEIATGRCIRTIETND------------------
BOP1_DROPE        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETED------------------
BOP1_DROPS        ----------KGEYLVSGSDDKTVKIWEIATGRCIRTIETED------------------
BOP1_DROWI        ----------KGEYMVSGSDDKTVKIWEIATGRCIRTIETED------------------
BOP1_CAEBR        ----------HGELLASGGEDGTVRIWMMATGRCIKTFQMDG------------------
BOP1_CAEEL        ----------RGELLASGGEDGTVRIWMIATGRCIKTFQMDG------------------
BOP1_BRUMA        ----------STEIFASGGEDGTLRLWSICDGRCLKTTSLDG------------------
BOP1_CHLRE        ----------TGQWLLSGGQDGTLRLWEVRTGRCWRTWVLEG------------------
F6HCQ7_VITVI      ----------SGQWIASGSIDGSVRVWEVETGRCRRVWEIGE------------------
BOP1_MONBE        ----------TGQWLVSGSDDKTIRVWEISTGRCVRVVTVDA------------------
ERB1_ASPFU        ----------SGLWLASGGDDGTVRVWELLTGRQLWSVKLSE------------------
ERB1_ASPFC        ----------SGLWLASGGDDGTVRVWELLTGRQLWSVKLSE------------------
ERB1_NEOFI        ----------SGLLLATGGDDGTVRVWELLTGRQLWSVKLSE------------------
ERB1_ASPCL        ----------SGLWLATAGDDGTVRVWELLTGRQLWSVKLSE------------------
ERB1_ASPOR        ----------SGLWLATGGDDGTARVWELLTGRQLWSVKLSE------------------
ERB1_ASPTN        ----------SGVWLATGGDDGTLRVWELLTGRQLWTVKLSD------------------
ERB1_ASPNC        ----------TGVWLATGGDDGTVRVWELLTGRQLYSVKVGE------------------
ERB1_EMENI        ----------TGIWLATGGDDGTVRVWELITGRQLWSVKLGE------------------
ERB1_AJECN        ----------TGVWLASGGDDGTVRVWELLTGRQIWSVKLSD------------------
ERB1_CHAGB        ----------TGVALATGGDDGTVRVWELLTGRQVWSVKLNS------------------
ERB1_PODAN        ----------TGVALATGGSDGTVRVWELLTGRQVWSVKLSS------------------
ERB1_NEUCR        ----------TGVAVASGGDDGTVRVWELLTGRQVWSVKLSS------------------
ERB1_MAGO7        ----------TGLWLATGGDDGYVRIWLINPARQVWAVKLSS------------------
ERB1_BOTFB        ----------SGTWLATGGDDGTVRVWELLTGKQLWSAQIGD------------------
ERB1_PHANO        ----------QGIFVASGGDDGYVRIWELLTGRQVWNAKLSD------------------
ERB1_PYRTR        ----------NGIFVASGGDDGYVRIWELLTGRQVWNAKLSD------------------
ERB1_ASHGO        ----------SGLWLATGSDDGTVRVWEILTGREVYKATIVDIKNNQ-------------
ERB1_KLULA        ----------TGLWLATGSDDGTVRVWEILTGREVYQVTILNAEENN-------------
ERB1_YEAST        ----------SGLWLATGSDDGTVRVWEILTGREVYRTTLIDDEENP-------------
ERB1_YEAS7        ----------SGLWLATGSDDGTVRVWEILTGREVYRTTLIDDEENP-------------
ERB1_CANGA        ----------TGIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNP-------------
ERB1_CANAL        ----------QGLWLATGSDDGSVRIWEILTGRQVYKIQLINKEINN-------------
ERB1_PICST        ----------QGLWLATGSDDGSVRIWEILTGRQVFNVQLINKEIND-------------
ERB1_LODEL        ----------QGLWLATGSDDGSVRIWEVLTGRQVFKAQLVNKEHNG-------------
ERB1_DEBHA        ----------DGLWLATGSDDGSVRIWEILTGRQVYKTVLVADDNT--------------
ERB1_PICGU        ----------SGLWLATGGDDGTVRVWEILTGRQVYHCDVVDKKKD--------------
ERB1_YARLI        ----------SGEFLATGGDDGTLRVWEVLTGRELYRCRLVASIDAQ-------------
ERB1_SCHPO        ----------SGNWLASGGDDGVLRIWEVMTGRCVWKCSLDSFGNAHNIDSDEDAVNESL
ERB1_COPC7        ----------DGAWAVSGDEDGVVSLWEVNVGCEIRRWKFE-------------------
ERB1_CRYNJ        ----------DGQWIASGSEDGVVRVWDLGNGREVWRWDLHA------------------
ERB1_MALGO        ----------SGAWLLTGPDDGHVRLWDAALGRCVATWDMNAGVARAD------------
ERB1_USTMA        ----------TGNWLVTGGDDGRARLWDVAIGRCTASWDVCEGMPKAE------------
BOP1_DICDI        ----------NGQWLASGSDDCTIKIWEVSSTRCLYSLEVES------------------
A0E170_PARTE      ----------DGQLLGVCYEFAIAFFDTKTSKCLYTKWQSDD------------------
A0DKQ7_PARTE      ----------DGQILGVCYEYAVAFFDAKTTKCLLTKWQSED------------------
Q248A8_TETTS      ----------DGQFMASCDEKGEVIVWEVNTARIVWRQAYRS------------------
BOP1_LEIIN        ----------NGQYLATGCDDHLVRVFEVQTGRLMKRYDMGA------------------
BOP1_LEIMA        ----------NGQYLATGCDDHLVRVFEVQTGRLMKRYDMGA------------------
BOP1_LEIBR        ----------NGQYLATGCDDHLVRVYEVQTGRLMKRYDMGA------------------
Q384Z1_TRYB2      ----------NGQYLATACDDHLVRVYEVMTGRLMKRYDMGA------------------
B3LAV2_PLAKH      ----------EDHHIVYVVQCGKLYIFDILTSYNIAVIDLAYYYGATLPRAKGGE-----
A5K1G8_PLAVS      ----------EDHHVVYTVQCGKLYIFDVLTSYNIAMIDLAYYYGAALPKGKGAE-----
Q7RDY8_PLAYO      ----------ENDHIFYVIKNNKLYIFDILTSYNIDVIDLESYFNSALSPNKNDK-----
Q8IM36_PLAF7      ----------ENDHCVYTIYHNKLYIFDILTSYNIATIDLLHYFKSVVPLKTKKK-----
C4M3V4_ENTHI      ----------SGEYVASGGDDGSILITEALTGMEVKQINFPE------------------
V4YYZ6_TOXGV      AELSACCVDYTGQWVAVGGADQTLRVVELLTGKQFLSFRLQQPVTALAFHPRLPLLAAAI
E2RU09_GIAIC      ----------KGMFFAVGGRDCILRVFETYSGRQVRAIPVLSTKKLEKK-----------
                                           .                                  

A7AMI3_BABBO      ----------DICWHPHLPILIVSHGNT---LSFIAVELPNMR-----------------
Q4UBJ6_THEAN      ----------DLLWHPKFQVIIVSHENY---VSALPVDLPNKF-----------------
BOP1_MOUSE        -------VVRSIAWNPNPTICLVAAAM----DDAVLLLNPALG-----------------
BOP1_RAT          -------VIRSIAWNPNPTICLVAAAM----DDAVVLLNPALG-----------------
BOP1_HUMAN        -------VVKSVAWNPSPAVCLVAAAV----EDSVLLLNPALG-----------------
BOP1A_XENLA       -------AVKSISWNPNPGLVLVAACV----DRSVVLINPGLG-----------------
BOP1B_XENLA       -------AVKSISWNPNPVLVLVAACV----DRSVVLINPGLG-----------------
BOP1_XENTR        -------AVKSISWNPNPGLVLVAACV----EHSVVLINPGLG-----------------
BOP1_DANRE        -------AVKGVAWNPNPSICLVAVSY----EDSVLLLNPALG-----------------
BOP1_AEDAE        -------VVRSVAWCPNSKISLIAVAS----GKRVLLINPQVG-----------------
BOP1_CULQU        -------VVRSVAWCPNVKISLIAVAS----GKRTLLINPHVG-----------------
BOP1_ANOGA        -------IVRSVAWCPNSKISLVAAAS----GKRVLLINPKVG-----------------
BOP1_DROER        -------VVRCVAWCPNPKLSIIAVAT----GNRLLLVNPKVG-----------------
BOP1_DROYA        -------VVRCVAWCPNPKLSIIAVAT----GNRLLLVNPKVG-----------------
BOP1_DROME        -------VVRCVAWCPNPKLSIIAVAT----GNRLLLVNPKVG-----------------
BOP1_DROSE        -------VVRCVAWCPNPKLSIIAVAT----GNRLLLVNPKVG-----------------
BOP1_DROAN        -------VVRCVAWCPNAKLSIIAVAT----GNRLLLINPKVG-----------------
BOP1_DROMO        -------VVRCVAWCPNAKLSIIAVAT----GSRLLLINPKVG-----------------
BOP1_DROVI        -------VVRCVAWCPNAKLSIIAVAT----GSRLLLINPKVG-----------------
BOP1_DROGR        -------VVRCVAWCPNAKLSIIAVAT----GTRLLLINPKVG-----------------
BOP1_DROPE        -------VVRCVAWCPNAKLSIIAVAT----GSRLLLVNPKVG-----------------
BOP1_DROPS        -------VVRCVAWCPNAKLSIIAVAT----GSRLLLVNPKVG-----------------
BOP1_DROWI        -------VVRCVAWCPNAKLSIIAVAT----GSRLLLVNPKVG-----------------
BOP1_CAEBR        -------EVTSVAFSPVADRTLLAVAYE---GKYVAILNTGCG-----------------
BOP1_CAEEL        -------EVTSVSFSPVADRTLLAVAYE---GKYVAILNTGCG-----------------
BOP1_BRUMA        -------SITSVAYCPLAKWTLLAVTME---SNKMILTNSYCG-----------------
BOP1_CHLRE        -------PVSAVAWCPQAGLRLVSAAV----GNCVVLLPSGTG-----------------
F6HCQ7_VITVI      -------AVHYVAWNPLPGLHILAVSS----GQDVLLLNTGLG-----------------
BOP1_MONBE        -------EVNMVAWCPNAGVSIVAVAH----GHTVSLICPRVA-----------------
ERB1_ASPFU        -----EDPVNVVRWRPGKDALILAAAAG---DDIFLAVPP--------------------
ERB1_ASPFC        -----EDPVNVVRWRPGKDALILAAAAG---DDIFLAVPP--------------------
ERB1_NEOFI        -----EDPVNVVRWRPGKDALILAAAAG---DDIFLAVPP--------------------
ERB1_ASPCL        -----EDPVNVVRWRPGKDALILAAAAG---DDIYLAVPP--------------------
ERB1_ASPOR        -----EDPVNVVRWRPGKDAVILAAAAG---DDIFLAVPP--------------------
ERB1_ASPTN        -----EDAVNVVRWRPGKDAVVLAAGVG---DDIFLAVPP--------------------
ERB1_ASPNC        -----EDPVNVVRWRPSKDAVVLAAAAG---DDIYLIVPP--------------------
ERB1_EMENI        -----DEPVNVVRWRPGKDAVILAAAAG---DDIFLAVPP--------------------
ERB1_AJECN        -----EEPVNVIRWRPSKDAVVLAAATG---DSIHLIVPP--------------------
ERB1_CHAGB        -----EEPVNAVRWRPTKDAFVLAAAAG---EDIFLMVPTHA------------------
ERB1_PODAN        -----EDPVYTVRWRPTKDAFVLAASAG---EDVFLMVPPHS------------------
ERB1_NEUCR        -----EEAVNTVRWRPAKDSFILSAAVG---EDVYLMVPTHA------------------
ERB1_MAGO7        -----DEAVNAVRWRPTKDTMILAAAAG---EEIFLMVPP--------------------
ERB1_BOTFB        -----EEAVNVVKWRPAKDAIILSAAAG---DDIFLMVPT--------------------
ERB1_PHANO        -----EEAVDAVQWRPTKDASVLAAASG---EHVYLIVPF-T------------------
ERB1_PYRTR        -----EEAVDAVQWRPKKDASVVAAACG---ENVFLIVPF-T------------------
ERB1_ASHGO        -----DDHIETVEWNPDKTVGLLAVAAG---ENIYLLVPP--------------------
ERB1_KLULA        -----DDHIDVVEWNPDSTTGILAVTAG---ENIFLLVPP--------------------
ERB1_YEAST        -----DYHIECIEWNPDANNGILAVAVG---ENIHLIVPP--------------------
ERB1_YEAS7        -----DDHIECIEWNPDANNGILAVAVG---ENIHLIVPP--------------------
ERB1_CANGA        -----EDNIHSVEWNPDGSVGILAVAVG---NNIFLIVPP--------------------
ERB1_CANAL        -----EDHIECLEWNPDSSCGILAVCVG---ENIYLIVPP--------------------
ERB1_PICST        -----EDHIESLEWNPDSQTGILAVCAG---ENIYLVVPP--------------------
ERB1_LODEL        -----EDHIESLEWNPNAQTGILAVCAG---ENIYLLVPP--------------------
ERB1_DEBHA        -----DDNIESLEWNPDSNSGILAAIAG---EHIYLIVPP--------------------
ERB1_PICGU        -----DDNIDSLEWNPDASVGILAVAAG---ESVYLLVPT--------------------
ERB1_YARLI        -----DDSVECVQWNP-AVPGMLAASAG---EHIFLIVPPT-------------------
ERB1_SCHPO        SHSTKSSIIQSLAWGPLSDSPVLAVAVD---ETVYFITPP--------------------
ERB1_COPC7        ------GKIGSLEWCPRADACYFAVGIE---ETIHFLIP---------------------
ERB1_CRYNJ        ------GPIQYVEWSPSREESLLVALVA---GKIAVLSPLAL------------------
ERB1_MALGO        -----RSPVYCVQWCPNRTFGIAAAVSV---GRVTLLAPPQC------------------
ERB1_USTMA        -----RSAVHSIAWCPTKNYSLFTAVVH---GRVAVIAPPQTQN----------------
BOP1_DICDI        -------EVQTVAWNPNPIYNILAVGYS---NKIIIITPPLFG-----------------
A0E170_PARTE      -------KQFLGLDFSSSGLICILQS------NGFIILNSYID-----------------
A0DKQ7_PARTE      -------KQFLGLDFSQSGLICILQS------NGFIILNSYID-----------------
Q248A8_TETTS      -------ICYSVQFQPQKGLLVVANEDKIYIYNIKKILPSNIY-----------------
BOP1_LEIIN        -------PVQQVEFCPSTSLNILAAAVEYSLVFIVPTFAAHTLV----------------
BOP1_LEIMA        -------PVQQVEFCPSTSLNILAVAVEYSLVFIVPTFAAHTLV----------------
BOP1_LEIBR        -------PVQQVEFCPSKSLNILAAAVEYSLVFVVPTFAAHALV----------------
Q384Z1_TRYB2      -------PVQQVEFCPVKTLNILAVAVEYSLVFIVPRFAAHELV----------------
B3LAV2_PLAKH      KKGGISFDNIRIKANKAYDIVAVSFGNTIFLFHYENFIPPAKSS----ADNIEEVYRTDS
A5K1G8_PLAVS      KSGGTAYENIRIKANKAYDIVAVSFANTILLFHYENFIPPAKSG----ADNIEEVYRMDS
Q7RDY8_PLAYO      QNN----KNLMIKINKTYSLLAISWGNVIILLQYESYIPPIKSN----TIDVEQIYYDIK
Q8IM36_PLAF7      SIEEDIHNNIIIKVNKAYSILAISYTNVVFILHYESYVPPLKSKCETFVDNIYDTTNSDV
C4M3V4_ENTHI      -------AIRDIQWGKDDVLFIAVGEFV--------------------------------
V4YYZ6_TOXGV      EDQLLLLVLDLPLFDQTTASQLTQASERGEAKAGEAKKHRACGS----------------
E2RU09_GIAIC      SINFLNLEINCCKWCPRTDVSIIAVCAG----DELIFVDAGICE----------------
                                                                              

A7AMI3_BABBO      ------------------------------------------------------------
Q4UBJ6_THEAN      ------------------------------------------------------------
BOP1_MOUSE        ------------------------------------------------------------
BOP1_RAT          ------------------------------------------------------------
BOP1_HUMAN        ------------------------------------------------------------
BOP1A_XENLA       ------------------------------------------------------------
BOP1B_XENLA       ------------------------------------------------------------
BOP1_XENTR        ------------------------------------------------------------
BOP1_DANRE        ------------------------------------------------------------
BOP1_AEDAE        ------------------------------------------------------------
BOP1_CULQU        ------------------------------------------------------------
BOP1_ANOGA        ------------------------------------------------------------
BOP1_DROER        ------------------------------------------------------------
BOP1_DROYA        ------------------------------------------------------------
BOP1_DROME        ------------------------------------------------------------
BOP1_DROSE        ------------------------------------------------------------
BOP1_DROAN        ------------------------------------------------------------
BOP1_DROMO        ------------------------------------------------------------
BOP1_DROVI        ------------------------------------------------------------
BOP1_DROGR        ------------------------------------------------------------
BOP1_DROPE        ------------------------------------------------------------
BOP1_DROPS        ------------------------------------------------------------
BOP1_DROWI        ------------------------------------------------------------
BOP1_CAEBR        ------------------------------------------------------------
BOP1_CAEEL        ------------------------------------------------------------
BOP1_BRUMA        ------------------------------------------------------------
BOP1_CHLRE        ------------------------------------------------------------
F6HCQ7_VITVI      ------------------------------------------------------------
BOP1_MONBE        ------------------------------------------------------------
ERB1_ASPFU        ------------------------------------------------------------
ERB1_ASPFC        ------------------------------------------------------------
ERB1_NEOFI        ------------------------------------------------------------
ERB1_ASPCL        ------------------------------------------------------------
ERB1_ASPOR        ------------------------------------------------------------
ERB1_ASPTN        ------------------------------------------------------------
ERB1_ASPNC        ------------------------------------------------------------
ERB1_EMENI        ------------------------------------------------------------
ERB1_AJECN        ------------------------------------------------------------
ERB1_CHAGB        ------------------------------------------------------------
ERB1_PODAN        ------------------------------------------------------------
ERB1_NEUCR        ------------------------------------------------------------
ERB1_MAGO7        ------------------------------------------------------------
ERB1_BOTFB        ------------------------------------------------------------
ERB1_PHANO        ------------------------------------------------------------
ERB1_PYRTR        ------------------------------------------------------------
ERB1_ASHGO        ------------------------------------------------------------
ERB1_KLULA        ------------------------------------------------------------
ERB1_YEAST        ------------------------------------------------------------
ERB1_YEAS7        ------------------------------------------------------------
ERB1_CANGA        ------------------------------------------------------------
ERB1_CANAL        ------------------------------------------------------------
ERB1_PICST        ------------------------------------------------------------
ERB1_LODEL        ------------------------------------------------------------
ERB1_DEBHA        ------------------------------------------------------------
ERB1_PICGU        ------------------------------------------------------------
ERB1_YARLI        ------------------------------------------------------------
ERB1_SCHPO        ------------------------------------------------------------
ERB1_COPC7        ------------------------------------------------------------
ERB1_CRYNJ        ------------------------------------------------------------
ERB1_MALGO        ------------------------------------------------------------
ERB1_USTMA        ------------------------------------------------------------
BOP1_DICDI        ------------------------------------------------------------
A0E170_PARTE      ------------------------------------------------------------
A0DKQ7_PARTE      ------------------------------------------------------------
Q248A8_TETTS      ------------------------------------------------------------
BOP1_LEIIN        ------------------------------------------------------------
BOP1_LEIMA        ------------------------------------------------------------
BOP1_LEIBR        ------------------------------------------------------------
Q384Z1_TRYB2      ------------------------------------------------------------
B3LAV2_PLAKH      KRRK--------NSAEDDEEYSRCDDTLSEERDSEGEAAHLSG---DDD-DGHFEGSL--
A5K1G8_PLAVS      KRRK--------NSVGDGEEDSRGDETL-EERDSEGDAAQLSD---DDDFEGSLDGGD--
Q7RDY8_PLAYO      KRKS--------DSVNDTSKNDE------HNESSKDGAEFETD---QDDDNQIFEDDW--
Q8IM36_PLAF7      KRKKPKNGEGNINKANKSKNDALEEESILEGDINDKDGSYHGNNNSDDDGDDNFDDDDEN
C4M3V4_ENTHI      ------------------------------------------------------------
V4YYZ6_TOXGV      ------------------------------------------------------------
E2RU09_GIAIC      ------------------------------------------------------------
                                                                              

A7AMI3_BABBO      -------------------------------------------------SSLDVRGTKRT
Q4UBJ6_THEAN      -------------------------------------------------QTDSVECNDTT
BOP1_MOUSE        -------------------------------------------------DRLLVGSTDQL
BOP1_RAT          -------------------------------------------------DRLLVGSTDQL
BOP1_HUMAN        -------------------------------------------------DRLVAGSTDQL
BOP1A_XENLA       -------------------------------------------------DRLLCSATDQH
BOP1B_XENLA       -------------------------------------------------DRLLCSATDQH
BOP1_XENTR        -------------------------------------------------DRLLCGATDQH
BOP1_DANRE        -------------------------------------------------DRLLCTATDQL
BOP1_AEDAE        -------------------------------------------------DSLLVKKTDDL
BOP1_CULQU        -------------------------------------------------DCLLSKKTDDL
BOP1_ANOGA        -------------------------------------------------DYMLVKKTDDL
BOP1_DROER        -------------------------------------------------DKVLVKKTDDL
BOP1_DROYA        -------------------------------------------------DKVLVKKTDDL
BOP1_DROME        -------------------------------------------------DKVLVKKTDDL
BOP1_DROSE        -------------------------------------------------DKVLVQKTDDL
BOP1_DROAN        -------------------------------------------------DKVLVKKTDDL
BOP1_DROMO        -------------------------------------------------DKLLIKKTDDL
BOP1_DROVI        -------------------------------------------------DKLLIKKTDDL
BOP1_DROGR        -------------------------------------------------DKLLVKKTDDL
BOP1_DROPE        -------------------------------------------------DKLLVKKTDDL
BOP1_DROPS        -------------------------------------------------DKLLVKKTDDL
BOP1_DROWI        -------------------------------------------------DKLLIKKTDDL
BOP1_CAEBR        -------------------------------------------------DRLHVQQTETL
BOP1_CAEEL        -------------------------------------------------DRLHVQQTEAL
BOP1_BRUMA        -------------------------------------------------DRHRITTTTEY
BOP1_CHLRE        -------------------------------------------------PEEAEEAAAEA
F6HCQ7_VITVI      -------------------------------------------------NDEEQKNIEQL
BOP1_MONBE        -------------------------------------------------TAAIDKATAVL
ERB1_ASPFU        ----------------------------------------IVDPAMEKASLDILDAGWGY
ERB1_ASPFC        ----------------------------------------IVDPAMEKASLDILDAGWGY
ERB1_NEOFI        ----------------------------------------IVDPAIEKASLDILDAGWGY
ERB1_ASPCL        ----------------------------------------IVDPEVEKASLDILDAGWGH
ERB1_ASPOR        ----------------------------------------IADPKIEKTSLEIIDAGWGY
ERB1_ASPTN        ----------------------------------------IVDPELEKASLELIDAGWGY
ERB1_ASPNC        ----------------------------------------ILDPELEQASLDLLDAGWGY
ERB1_EMENI        ----------------------------------------IADPETEKASLDLLDAGWGY
ERB1_AJECN        ----------------------------------------ILDPEMEKASLDIVDAGWGY
ERB1_CHAGB        ----------------------------------------SVTPALDQASRDILATGFGY
ERB1_PODAN        ----------------------------------------SVTPTLDQASRDVLAAGFGY
ERB1_NEUCR        ----------------------------------------SVTPALDQASRDILSAGFGY
ERB1_MAGO7        ----------------------------------------DIDPEVEQTSRAVLDAGFGH
ERB1_BOTFB        ----------------------------------------IIDPVAESNSRELLDAGFGY
ERB1_PHANO        ----------------------------------------LLSPDVEQSSRDVLDAGWGY
ERB1_PYRTR        ----------------------------------------LLSPDVEQASREVLDAGWGY
ERB1_ASHGO        ----------------------------------------IFGFEVENNSRLKIENGYGF
ERB1_KLULA        ----------------------------------------IFGFEIENTGKSKIEYGFGF
ERB1_YEAST        ----------------------------------------IFGYDIENNGKTKIEDGFGY
ERB1_YEAS7        ----------------------------------------IFGYDIENNGKTKIEDGFGY
ERB1_CANGA        ----------------------------------------IFGYDIENAGKVRIEHGFGY
ERB1_CANAL        ----------------------------------------IFGFDIENSGKLRIESGWGY
ERB1_PICST        ----------------------------------------IFGFDIENMGRLRIESGWGY
ERB1_LODEL        ----------------------------------------IFGFEIENTGKLRIESGWGY
ERB1_DEBHA        ----------------------------------------IFGFDIENNGRLRIESGWGY
ERB1_PICGU        ----------------------------------------ILGYEIENAGRSKIEVGWGY
ERB1_YARLI        ----------------------------------------LFDFDIENTGREKIEQGWGF
ERB1_SCHPO        ----------------------------------------IFSDEQIEASKELFTSAPYQ
ERB1_COPC7        -------------------------------------------PNLDPTVLALTQTLLAP
ERB1_CRYNJ        -----------------------------------------VAPHIAAQTLTHSNTAFAT
ERB1_MALGO        -------------------------------------------------GKTMYEASLAH
ERB1_USTMA        ------------------------YAKTSANAISSKSASSSSGATATSTASFLYATSAAA
BOP1_DICDI        ------------------------------------------------TQTEHSPETEKI
A0E170_PARTE      -----------------------------------------------KRQHPNVEDGEKA
A0DKQ7_PARTE      -----------------------------------------------KRQHPNVEDGEKA
Q248A8_TETTS      -----------------------------------------------KQNEETLEESKKS
BOP1_LEIIN        ------------------------NDHTIRFLRAPGLSAGQREAAHALGAVDTLGGRAVT
BOP1_LEIMA        ------------------------NDHTIRFLRAPGLSAGQREAAHALGAVDTLGGRAVT
BOP1_LEIBR        ------------------------NDHTIRFLRAPGLSAGQREAAHALGAVDTLGGRAVT
Q384Z1_TRYB2      ------------------------NENTLRHLRAPGTAVNNTEVEQVVGGEVSLGGGGIT
B3LAV2_PLAKH      --DDDEDDEDN----DDEDDENHGDDE-------LDKNEEDAEEKHSGKKCEQLSKTMAY
A5K1G8_PLAVS      --DDDDASEDGSDQGDDDEEEDHSDEE-------LGKNEEETGETPSRRKCGPLSRTMAY
Q7RDY8_PLAYO      --DDEDVSDDE----NGENDESDENGE-------NGENDE-SDNNLKKKKNSDLSKNMIY
Q8IM36_PLAF7      FDDDDDYFDEDDYENFDEDDDNFQSDESYDAGTNNNTENTNNDDISKKKKQVHINRNMVY
C4M3V4_ENTHI      --------------------------------------------YGMKLDIRDVDSDYSI
V4YYZ6_TOXGV      ------EGADAESEHPAQDESEGDMRRADLAKAKALLKRVHEVVESDEEGTEEESSKAEK
E2RU09_GIAIC      ---------------------------------------SGNYNEVRERTRFLLNARPET
                                                                              

A7AMI3_BABBO      GSSEEGKT--------------------------------------------AYEKALSL
Q4UBJ6_THEAN      D----------------------------------------------------YEKAVKY
BOP1_MOUSE        LEAFTP--------------------------------------------------PEEP
BOP1_RAT          LETFTP--------------------------------------------------PEEP
BOP1_HUMAN        LSAFVP--------------------------------------------------PEEP
BOP1A_XENLA       ISGYQP--------------------------------------------------PEEE
BOP1B_XENLA       ISGYQP--------------------------------------------------PEEE
BOP1_XENTR        IGGYQP--------------------------------------------------PEEE
BOP1_DANRE        ISSYAE--------------------------------------------------PEEV
BOP1_AEDAE        LAEAPK----------------------------------------------SETVDNER
BOP1_CULQU        LAEAPK----------------------------------------------HEVVDNER
BOP1_ANOGA        LTEAPR----------------------------------------------SDTVDSER
BOP1_DROER        LAEAPS----------------------------------------------QDVIESER
BOP1_DROYA        LAEAPS----------------------------------------------QDVIESER
BOP1_DROME        LAEAPS----------------------------------------------QDVIESER
BOP1_DROSE        LAEAPS----------------------------------------------QDVIESER
BOP1_DROAN        LAEEPS----------------------------------------------SDVIESER
BOP1_DROMO        LAESPN----------------------------------------------LDIIESER
BOP1_DROVI        LAASPS----------------------------------------------LDVIDNER
BOP1_DROGR        LAEAPS----------------------------------------------SDVIESER
BOP1_DROPE        LAEAPV----------------------------------------------LDVIENER
BOP1_DROPS        LAEAPV----------------------------------------------LDVIENER
BOP1_DROWI        LAEEPSN---------------------------------------------QDIIDNER
BOP1_CAEBR        LAETPT--------------------------------------------------ESQE
BOP1_CAEEL        LAETPT--------------------------------------------------DAQE
BOP1_BRUMA        LSKLRC--------------------------------------------------ESSE
BOP1_CHLRE        LRVRG---------------------------------------------------PGR-
F6HCQ7_VITVI      LRIET---------------------------------------------------PGSM
BOP1_MONBE        CNQSIEKP--------------------------------------------SQGAEEGM
ERB1_ASPFU        AASVPPPT----------------------------------------------PAEANK
ERB1_ASPFC        AASVPPPT----------------------------------------------PAEANK
ERB1_NEOFI        AASVPPPT----------------------------------------------PAEANK
ERB1_ASPCL        AASVPALT----------------------------------------------PAEANK
ERB1_ASPOR        AASKPPPS----------------------------------------------AAEENK
ERB1_ASPTN        AASRPPPT----------------------------------------------AAEENK
ERB1_ASPNC        AASKPAPK----------------------------------------------ASEEGK
ERB1_EMENI        AASKPAPK----------------------------------------------PADEEK
ERB1_AJECN        AKTL---------------------------------------------------TSDST
ERB1_CHAGB        ATNGQQPA----------------------------------------------APVS--
ERB1_PODAN        ATNGQQPA----------------------------------------------TAPG--
ERB1_NEUCR        ATNGQQHG----------------------------------------------AAPG--
ERB1_MAGO7        AAGGADKQ----------------------------------------------TTDG--
ERB1_BOTFB        ATNATQAL----------------------------------------------TANGQK
ERB1_PHANO        ATSKPSTA----------------------------------------------ANGEAP
ERB1_PYRTR        ATSKPSTS----------------------------------------------SNGEAP
ERB1_ASHGO        DTFGNVKK---SALNVN-----------------------SDDEQ--------AETEATV
ERB1_KLULA        DTFGNVKK---SNLNVN-----------------------SDDEDD-------GAESHAV
ERB1_YEAST        DTFGTVKK---SNLEVNE------------------NGDGDEDGEN-------ESAKNAV
ERB1_YEAS7        DTFGTVKK---SNLEVNE------------------NGDGDEDGEN-------ESAKNAV
ERB1_CANGA        DTFGSTKK---ANLEVN-------------------GSDLESDDEA-------ANANTAV
ERB1_CANAL        DTFGNKKK----DLKISSQKEEDNKESDNEDEDEEEDNDDDDDDDE-----PETSSTVEP
ERB1_PICST        DTFGNKTK----EEKFKN----------------DEGNEDEDDEDD-----SATSTAV--
ERB1_LODEL        DTFGNTKQ----DLKVKG----EDTKGDLDDDEEEEEEEEDDDDDEGQGKVKAHNSTAPA
ERB1_DEBHA        DTFGNKSKTKNSNI---------------------KVNSDDEDEEV------EKADTNTG
ERB1_PICGU        DTYGNKN--KRGDL---------------------NVNGEEDNE----------SGANEV
ERB1_YARLI        AEGGREQQ----DIDTKG-----------------LDDDADSDSDD-------ETGHVKK
ERB1_SCHPO        ESSAIWRR----------------------------------------------------
ERB1_COPC7        STLPPAPA----------------------------------------------TPSAVK
ERB1_CRYNJ        SSATTKQG----------------------------------------------AGNEVK
ERB1_MALGO        LTTPHAAE----------------------------------------------DAATAQ
ERB1_USTMA        TSMPSKPD----------------------------------------------ARSPVA
BOP1_DICDI        LTKPPTDSSTE-------------------------------------------QQQNKS
A0E170_PARTE      NKQIPK------------------------------------------------------
A0DKQ7_PARTE      NKQIPK------------------------------------------------------
Q248A8_TETTS      HEVEYN------------------------------------------------------
BOP1_LEIIN        QTTLDADE--------------------------------------TAHEATADLHDIEE
BOP1_LEIMA        QTALDADE--------------------------------------TAHEATADLHDIEE
BOP1_LEIBR        QTTLDADE--------------------------------------TAHEATTDLHDVEE
Q384Z1_TRYB2      QAALDKDE--------------------------------------TAHSILQDLHDVEE
B3LAV2_PLAKH      CKTKGLLSVFHKNFK-------------------------------------TSEEYVYS
A5K1G8_PLAVS      YMTKGLLSVFHKNFK-------------------------------------SSEEYVYS
Q7RDY8_PLAYO      CKTKELINSFNQNFK-------------------------------------NTDEYISS
Q8IM36_PLAF7      YKTKGLLSVYHSNFK-------------------------------------NSEDYCYS
C4M3V4_ENTHI      YELES--------------------------------------------------VKVEV
V4YYZ6_TOXGV      EEDEALGEKRRQQTLKGVGVWKQIDVKGAAAPVEAGGFQSEKKKKGLPLLQLKRGEETKK
E2RU09_GIAIC      TQPCPHMAWEMHAGVTSGGKS-YASGFVTQVSSNAYNEGSEDDDAAESARFNEERHQRGH
                                                                              

A7AMI3_BABBO      VQSETDTGAWRSAKFGRHQGLSVDHVDELRHLSVHQHGNYVVGVSPLCHDSVN--QCVIY
Q4UBJ6_THEAN      LSMES------------------------------PKGNYFVCVCPDSLESIN--QCILH
BOP1_MOUSE        ALQPARWLEVSEEEHQRGLRLRICHSKPVTQVTWHGRGDYLAVVLSSQEHT----QVLLH
BOP1_RAT          TLQPAHWLEVSEEERQRGLRLRICHSKPVTQVTWHGRGDYLAVVLSSQGHT----QVLIH
BOP1_HUMAN        PLQPARWLEASEEERQVGLRLRICHGKPVTQVTWHGRGDYLAVVLATQGHT----QVLIH
BOP1A_XENLA       VQQPVTWEEVEGAQYSNGLRLCIKHQKEVKQVTFHARGDYFAVVLPDNGNS----QVLIH
BOP1B_XENLA       VQQPVTWEEAEGSEYSSGLRLWIKHQKEVKQVTFHARGDYFAVVLPDNGNS----QVLIH
BOP1_XENTR        GQQPVSWGEAEGTEYSNGLRLCIKHQKAVKQVTWHARGDYFAVVLPDNGNS----QVLIH
BOP1_DANRE        KEQPVQWLVSEGEGHEQGHRLVLKHPKAVRQVTWHAKGDYLACVLPDSSSSV---QVLIH
BOP1_AEDAE        ITTAVQWVDFTEEERKSGVRIVINHFKEIKQVTWHGRGDYFATVMPEAANR----SVLIH
BOP1_CULQU        ISTAVQWVDVAEEEQKAGVRIVINHFREIKQVTWHGRGDYFATVMPEAQNR----SVLIH
BOP1_ANOGA        IRSAVQWGEVTEEEKKLGVRIVITHFREVRQVTWHGRGDYFATVMPDGAYR----SVMIH
BOP1_DROER        IKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROYA        IKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROME        IKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROSE        IKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROAN        IKAAVQWATAEPAEQEKGVRVVINHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROMO        IKTAVQWSNAEPDEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROVI        IKTAVQWSNAEPEEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROGR        IKTAVQWSNAEPEEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROPE        IKTAVQWANAEPADQEKGVRVIITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROPS        IKTAVQWANAEPADQEKGVRVIITHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_DROWI        IKTAVQWSTAEAAEQEKGVRVIINHFKPIRQVTWHGRGDYLATVMPEGANR----SALIH
BOP1_CAEBR        DGAIVTWRKSKD-------KLVLKMPNEVRQVTWHAKGDYFASVAIDDIAK----SVYVH
BOP1_CAEEL        DGAVVTWRKSKE-------KLMLKMPNEVRQVTWHSKGDYFASVAIDDIAK----SVYVH
BOP1_BRUMA        SDVLKWKYEGKG-------TLSVDLGYIARQVVWHHKGDYFATFANSKSPK----LIYIH
BOP1_CHLRE        -GGGRWVRGGPEEASSSGAGLAVRLRFPVRSLAWHGRGDYFASVAPTGNTQ----AVVVH
F6HCQ7_VITVI      DDTGNTTSIVSWVQDDKHGGIRLKHFKTVSSVEWHRKGDYLSTVMPADILLMILFSILIH
BOP1_MONBE        RATPTWNRIRGERQDQDGIFFEIPHHAEVMQVTWHHKGNYFASVMPRAETQ----SVCVH
ERB1_ASPFU        KNNPPKWMRPSSSLADSGVCAVIPLRYVAKSLSWHRRGDYFVTVCPGSSTPAS-VAIAIH
ERB1_ASPFC        KNNPPKWMRPSSSLADSGVCAVIPLRYVAKSLSWHRRGDYFVTVCPGSSTPAS-VAIAIH
ERB1_NEOFI        KNNPPKWMRPSSSLADLGVCAVIPLRYVAKSLSWHRRGDYFVTVCPGSSTPAS-VAIAIH
ERB1_ASPCL        KNNPPKWIRPSSSLQESGVCAIIPLRYIAKSLSWHRRGDYFVTVCPGSSTPAS-VAIAIH
ERB1_ASPOR        KNVPPQWIRPSLSLAESGVCAVIPLRYVVKSLSWHRRGDYFVTVCPGSSTPAS-VAISIH
ERB1_ASPTN        KNTPPQWIRPSAALADSGVCAVIPLRYVVKTLSWHRRGDYFVTVCPGSSTPAS-VAISIH
ERB1_ASPNC        KTTPPQWVRPSAALADNGVCAVIPLRYVAKSISWHRRGDYFVTVCPGSSTPAS-MAIAIH
ERB1_EMENI        KSTPPQWIRPSAALADSGVCVVIPLRYIAKTISWHRRGDYFVTVCSGASTPAS-VAIAIH
ERB1_AJECN        KKTSAQWTRPSPSLLDSGVQAVISLGYVAKSLSWHRRGDYFVTVCPGTATPVS-LAIAIH
ERB1_CHAGB        KEPAAKWARPGTKLEDEGVLIRITVRSTVKVINWHRRGDHFATVSP---TGQR-SSVAIH
ERB1_PODAN        KEPAGKWARPGTKLEDAGVLVRVTVRSAVKVITWHRRGDHFATVSP---EGQR-SSVAIH
ERB1_NEUCR        KEPPAKWARPGAKLEDEGVLIRITVRSTVKVINWHRKGDHFATVSP---SGQR-SSVAIH
ERB1_MAGO7        KAPAAKWARPGARLEDEGVLVKVTVRSPVKVISWHRRGDHFCTVSP---SGQR-SSVAVH
ERB1_BOTFB        KEPVATWARPTSRLQDEGVLIKITVRSTVKVINWHRRGDFFSTVSP---TAQK-SAVAIH
ERB1_PHANO        KQSPGKWSRPGSRMENKGILVQIEVRSAVKIINWHRRGDYFATVSP---RGQS-TAVAIH
ERB1_PYRTR        KQAPGKWSRPGARLENKGVLVQVEVRSAVKIVNWHRRGDYFATVSP---RGQS-TAVAIH
ERB1_ASHGO        KKQVAQWNKPTQKQAENDVAIVITCRKTVKKISWHRKGDYFVSVQP---ESGH-TSVLIH
ERB1_KLULA        KKQVAQWNKPTERQAANDICIVITCRKSVKKLSWHRKGDYFVTVQP---DSGN-TSVLIH
ERB1_YEAST        KKQVAQWNKPSQKQLEKDICITISCKKTVKKLSWHRKGDYFVTVQP---DSGN-TSVLIH
ERB1_YEAS7        KKQVAQWNKPSQKQLEKDICITISCKKTVKKLSWHRKGDYFVTVQP---DSGN-TSVLIH
ERB1_CANGA        KKQVAQWHKPTQRQMEQDICIVIVCKKPVKKLSWHRKGDYFVTVQP---DSGN-TSVLIH
ERB1_CANAL        KKEVAKWYPPNTEQASMGISAIIQCRKTIKKLSWHRKGDYFVTVSP---DSKN-TAVLIH
ERB1_PICST        KKDVARWFPPNQEQTKLGISAIIQCRKTVKKVSWHRKGDYFVTVSP---DSKN-TAVLIH
ERB1_LODEL        KKDVAKWINPNSSQQAMGISAIIQCRRTVKKISWHRKGDYFVTVSP---DSKN-TAVLIH
ERB1_DEBHA        KKDVCKWFTPNTEQSQAGISAIIQCRKTVKKISWHRKGDYFVTVSP---DSGH-SSVLIH
ERB1_PICGU        KKEVTKWLTPMEGQSQQGIAAIIQCRKAVKNLSWHRKGDYFVTVSP---DSGN-TSVLIH
ERB1_YARLI        KSPPAKWITPTAKQQASGIGAIITATKTIKRLAWHRKGDYLVTVAP---SAQH-RAVAIH
ERB1_SCHPO        ------GAKQSLQLHGGIVHATVSTPSSIKSLSWHRRGDYLATSSP---TSSS-QAVLIH
ERB1_COPC7        WSSSSLSSWSVEQPILS--LNLPPSSGLPTQISWHKKGDYIATVSSG-GAQ---NGVWIH
ERB1_CRYNJ        GIESVKWTRPSERERERGVLVYVEVPGTPKQVTWHRKGDYFATVASD-AAN---KSVLIH
ERB1_MALGO        WTRASEADRAAGVCVRIDVRNNKHASLVPKYVRWHARGDYFATVSPE-AAG---EAVLIH
ERB1_USTMA        WTRPSEAERRTGVAMHLNITSPSAANL--KTVVWHNKGDYFATVCPD-SAAGS-AGLLIH
BOP1_DICDI        VNWYQVTGADKAKLLEKGVRIEIHHPFTVKNLTWHYKGDYFSTTSPEEGTR----SVKIH
A0E170_PARTE      NSNNVFEWNFELDDNVFQQLLEVKMPYDPLYAQFHSKSDYIVSTQPHTHVKSH--CILVH
A0DKQ7_PARTE      NSNNVFEWNFELDDNVFQQLLEVKMPYDPLYAQFHSKSDYIVSTQPHTHVKSH--CILVH
Q248A8_TETTS      AQLKWVFTDPESEEYKTGLRVSIKFSNDVKQISFHQNGDYFSTLSPRAEKRNE--QIFIH
BOP1_LEIIN        REKRAEFVDASAKERNAGIVVKIAMHAKVKKFCFHIKGDYLCALCPKDHVKYR--QTIML
BOP1_LEIMA        REKRAEFVDASAKERNAGIVVKIAMHAKVKKFCFHIKGDYLCALCPKDHVKYR--QTIML
BOP1_LEIBR        REKRAEFLDASAKERNAGIVVKIAMHAKVKKFCFHIKGDYLCALCPKDHVKYR--QTIML
Q384Z1_TRYB2      RDKRAEFFDASAKERRAGIVLKIALHAKVKRFTFHARGDYLCALCPKDHVKYR--QTVML
B3LAV2_PLAKH      PDVDVKWKYIKPNDRKIKYCVAIQHEGKIRNFSWNKNGNYLSVTCLRKVGQYH--YCYLH
A5K1G8_PLAVS      PDVDVKWKHIKPNDRKIKYCVAIQHEGKIRNFSWNKNGNYLSVTCLRKVGQYH--YCYLH
Q7RDY8_PLAYO      SDLDIKWIKIPSNNKKLKYCVAIKHEGL-----FDKLGNYLSVTCLRKLGQYH--HCYLH
Q8IM36_PLAF7      KDINVKWMLLKSNHKKIKYCVAIKHEGEIKDISWNNNGNYLSVTCMRNIGQYN--DCYLH
C4M3V4_ENTHI      FENKTSFITPNEELKKEGIILAIHHPHLVKKLSLHHKGSYLACVFGTSSNS----YCVIH
V4YYZ6_TOXGV      QTLPEEEETVSAPLGGILCGISILHDSTIRSLTWHHKGTYLIAMCPGSASPSQ--QCSVH
E2RU09_GIAIC      EGQIDADVYTVYTRLNQFVLLRIHHTHLVSFCNWHFQGDYIVTVCTDDKSR---AKVTLH
                                                       . ..                 : 

A7AMI3_BABBO      CLTKRNFVRVGTKMAN-----NSIRLAMFHPLEPKLILCLRRGVRFYNLKVS--------
Q4UBJ6_THEAN      CLPKRSSMKLGNKVSN-----NKMKLAIFHPSEPKLIIAFTRNIRVYNLNTKAG------
BOP1_MOUSE        QVSRRRSQSPFRRSH------GQVQCVAFHPSRPFLLVASQRSIRIYHLLRQE-------
BOP1_RAT          QLSRRRSQSPFRRSH------GQVQCVAFHPTRPFLLVASQRSIRIYHLLRQE-------
BOP1_HUMAN        QLSRRRSQSPFRRSH------GQVQRVAFHPARPFLLVASQRSVRLYHLLRQE-------
BOP1A_XENLA       QLSRRRSQNPFRKNK------GQVQKVLFHPTRPFFFVATQRYVRVYNLLKQE-------
BOP1B_XENLA       QLSRRRSQNPFRKNK------GQVQKVLFHPTRPFFFVATQRYVRVYNLLKQE-------
BOP1_XENTR        QLSRRRSQNPFRKNK------GQVQKVLFHPTRPFFFVATQRCVRVYNLLKQE-------
BOP1_DANRE        QVSKRRTQNPFRKSK------GLVQCVSFHPVRPYFFVATQRYVRVYNLIKQE-------
BOP1_AEDAE        QLSKRRSQFPFSKSK------GLIQCVLFHPVKPCLFVATQRHVRVYDLVKQE-------
BOP1_CULQU        QLSKRRSQFPFSKSK------GLIQCVLFHPVKPCLFVATQRHIRVYDLVKQE-------
BOP1_ANOGA        QLSKRRSQVPFSKSK------GLIQCVLFHPIKPCLFVATQRHIRVYDLVKQL-------
BOP1_DROER        QLSKRRSQIPFSKSK------GLIQFVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROYA        QLSKRRSQIPFSKSK------GLIQFVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROME        QLSKRRSQIPFSKSK------GLIQFVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROSE        QLSKRRSQIPFSKSK------GLIQFVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROAN        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROMO        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROVI        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROGR        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROPE        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROPS        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_DROWI        QLSKRRSQIPFSKSK------GLIQCVLFHPVKPCFFVATQHNIRIYDLVKQE-------
BOP1_CAEBR        QMSKAKSQCPFQKRK------GHVQAVTFHPTQARLFVATKIHVREYDLARCV-------
BOP1_CAEEL        QLSKAKSQCPFQKRK------GHVQAVTFHPTQARLFVATKIHVREYDLARCV-------
BOP1_BRUMA        QLSKCKSQRPFSRLK------GLMTVLSFHPSEPFLFVGTQRYIRIYDLAKCQ-------
BOP1_CHLRE        QLSKRASQNPFRKNR------GRVVRVAFHPTKPFFFVATQNHVRVYNLAKQA-------
F6HCQ7_VITVI      QLSKKLTQRIPFKLH------GLPVSSIFHPTRSIFFISTKKNVRVYDLLKQK-------
BOP1_MONBE        SLNRQSTQHPFQKRN------RDVQRVLFHPTQPLFFVATKTHVRVYNLQAQA-------
ERB1_ASPFU        TLSKHLTQYPFRRRIKGG---GPPQAAHFHPSKPILFVANQRSIRAYDLSRQL-------
ERB1_ASPFC        TLSKHLTQYPFRRRIKGG---GPPQAAHFHPSKPILFVANQRSIRAYDLSRQL-------
ERB1_NEOFI        TLSKHLTQYPFRRRIKGG---GPPQAAHFHPSKPILFVANQRSIRAYDLSRQL-------
ERB1_ASPCL        TLSKHLTQYPFRRRIKGG---GSPQAAHFHPSKPILFVANQRSIRAYDLSRQL-------
ERB1_ASPOR        TLSKHLTQFPFRRRIKGG---GPPQTAHFHPSKPILFVANQRTIRAYDLSRQL-------
ERB1_ASPTN        TLSKHLTQFPFRKRIKGG---GPPQTAHFHPSKPILFVANQRTIRAYDLSRQL-------
ERB1_ASPNC        TLSKHLTQYPFSRRIKGG---GPPQTAHFHPSKPILFVANQRTVRAYDLSRQL-------
ERB1_EMENI        TVSKHLTQYPFRRRIKGG---GPPQTAHFHPSKPILFVANQRTIRAYDLSRQL-------
ERB1_AJECN        TLSKHLTQHPFRRRLKGG---GPPQAAHFHPSKPILFVANQRTIRSYDLSRQS-------
ERB1_CHAGB        TLSKHLTQIPFRKLS------GLAQTAAFHPLRPLFFVATQRTIRCYDLQKLE-------
ERB1_PODAN        TLSKHLTQIPFRKLH------GLAQTVVFHPLKPLFFVATMRTVRCYDLQKVE-------
ERB1_NEUCR        TLSKHLTQIPFRKLS------GLAQTASFHPLRPLFFVATQRTIRCYDLQKLE-------
ERB1_MAGO7        TLSKHLSQIPFRKLS------GLAQVAHFHPSRPLFFVATQRTIRCYDLQRLE-------
ERB1_BOTFB        TLSKHLTQIPFRRLP------GIAQTAQFHPSRPIFFVATQRTIRSYDLQKQE-------
ERB1_PHANO        TVSKHLTQLPFRRLK------GIAQTAQFHPSKAIFFVATRNTIRSYDLAKQE-------
ERB1_PYRTR        TVSKHLTQLPFRRLK------GIAQTAQFHPSKAIFFVATRNTIRSYDLAKQE-------
ERB1_ASHGO        QLSKHLTQSPFNKSK------GIIMDAKFHPFKPQLFVCSQRYIRIYDLSQQV-------
ERB1_KLULA        QLSKHLTQSPFKKSK------GIIMDAKFHPFKPQLLVCSQRYVRIYDLSQQV-------
ERB1_YEAST        QVSKHLTQSPFKKSK------GIIMDAKFHPFKPQLFVCSQRYVRIYDLSQQI-------
ERB1_YEAS7        QVSKHLTQSPFKKSK------GIIMDAKFHPFKPQLFVCSQRYVRIYDLSQQI-------
ERB1_CANGA        QLSKHLTQSPFRKSK------GIIMDAKFHPFKPQLFVCSQRYVRIYDLSQQV-------
ERB1_CANAL        QISKHLSQSPFKKSK------GIIMDAKFHPFKPQLFVASQRQIKIYDLAQQV-------
ERB1_PICST        QLSKHLSQSPFKKSK------GIIMDAKFHPFKPQLFVASQRQVRIYDLAQQV-------
ERB1_LODEL        QLSKHLSQSPFRKSK------GVIMDAKFHPFKPQLFVASQRQIKIYDLAQQT-------
ERB1_DEBHA        QLSKHLSQSPFKKSK------GIIMDAKFHPFKPQLFVASQRYIRIYDLAQQV-------
ERB1_PICGU        QLSKHLSQSPFRKSK------GIIVDAKFHPFKPQLFVASQRSIKIYDLSQQV-------
ERB1_YARLI        QISKHSSQSPFNKSK------GIVQDAMFHPFRPHLYVATQRYVRIYDLAKQV-------
ERB1_SCHPO        QLSRGASQSPFSKSK------GSVQAVTFHPTMPYLLVATQRYVRIYNLVKQE-------
ERB1_COPC7        QFTRRHSQAPFKKI------KGAVQQVLFHPIKPHFFVATQQYVRLYNLAEQK-------
ERB1_CRYNJ        QLSRHGSQSPFRKT------PGTIQRVAFHPSKPHFFAATQRYIRLYDLAAQK-------
ERB1_MALGO        QVSKHRSQAPFRRTRRAGNSAMAVQCVCFHPSRPWLFVATQRYVRVYDLVQQS-------
ERB1_USTMA        QLSKHRSQSPFRKASKGS----SIQKLVFHPTKPWIFVATQRYIRIYDLMAQS-------
BOP1_DICDI        HLSKRATQSPFRKSK------TPNQVTRFHPNKPIFFVADQNIIRVYDLMKQE-------
A0E170_PARTE      SISKSSTSIPFQNMKAST----EVQQTIFHPTKPELYIMTNKNIFIYSLTKQQ-------
A0DKQ7_PARTE      SISKSSTSIPFQNMKAST----EVQQTIFHPTKPELYIMTNKNIFIYSLTKQQ-------
Q248A8_TETTS      SISKGNSSKPFSKSKG------DVEKVAFHPNKPIIFILTKKHVYVYNLQKQA-------
BOP1_LEIIN        QLSKRKVFCPFRKFS------EVVTDCRFHPREPIFFLATTNSVRCYNLMAHR-------
BOP1_LEIMA        QLSKRKVFCPFRKFS------EVVTDCRFHPREPIFFLATTNSVRCYNLMAHR-------
BOP1_LEIBR        QLSKRKVFCPFRKFS------EVVTDCRFHPREPLFFLATTNSVRCYNLMAHR-------
Q384Z1_TRYB2      QLSKRKVFCPFRKFS------EVVTDCKFHPREPLFFLSTTNSVRMYNLLAHK-------
B3LAV2_PLAKH      HLKSMKSIKLIKKYNQKR---GDLVQSMFFPSSPYFLAAFENGITIYNLKAKSKN-----
A5K1G8_PLAVS      HLKSMKSIKLIKKYNQKR---GDLVQSMFFPSSPYFLAAFQNGITIYNLKAKSKK-----
Q7RDY8_PLAYO      HIKSMRTIKLINKYKQKR---GDIIQTMFFPRTPYFIAAFENSIIIYNLKPSSKK-----
Q8IM36_PLAF7      HMKTMKSIKLIKKYKHKR---GNIISTMFFPRSPYFMVAFENNITIYNLKATNKK-----
C4M3V4_ENTHI      HLPTKRSQNPAKNLK------GFIQSCVFHPLKPMIAIATLSKIVIIDLQKGV-------
V4YYZ6_TOXGV      SLEKQKTIHPIRRAAG-----GHMKAAVFHATKPWLIVAYHKGIRIFDLHSNKKVGPKGG
E2RU09_GIAIC      QLSKWHSLSPFNRLK------SKIIGAHFRTKKSELIVVSERSSRIYNLLTGD-------
                   .          .               * .  . :            *           

A7AMI3_BABBO      ----NEKLENEGEKLSGVDFPVSMHVDSRAQLMAVADEKGTVSLFDLNVGSFPYKKFQFQ
Q4UBJ6_THEAN      ---HDNKLADE-NKFTGVELPVS--IDTNGTYLLTGDELGKLTIFDQEISSFPYKSFSFE
BOP1_MOUSE        ---LTKKLMPNCKWVSSMAVHP------AGDNIICGSYDSKLVWFDLDLSTKPYKVLRHH
BOP1_RAT          ---LTKKLMPNCKWVSSMAVHP------AGDNIICGSYDSKLVWFDLDLSTKPYKVLRHH
BOP1_HUMAN        ---LTKKLMPNCKWVSSLAVHP------AGDNVICGSYDSKLVWFDLDLSTKPYRMLRHH
BOP1A_XENLA       ---LTKKLLTNCKWVSSIAVHP------AGDNLICGSYDSKLAWFDMDLSTKPYKVLRHH
BOP1B_XENLA       ---LTKKLLTNCKWVSSIAVHP------AGDNLICGSYDSKLAWFDMDLSTKPYKVLRHH
BOP1_XENTR        ---LSKKLLTNCKWVSSIAVHP------AGDNLICGSYDSKLAWFDMDLSTKPYKVLRHH
BOP1_DANRE        ---LTKKLMANCKWISSMAIHP------GGDNVICGSYDCRLAWFDLDLSTKPYKVLRHH
BOP1_AEDAE        ---LLKKLFPSCKWISSMAIHP------KGDNLLVATYEKKMMWFDLDLSTRPYQQLKLH
BOP1_CULQU        ---LLKKLFPSCKWISSMAIHP------KGDNLLVATYEKKMMWFDLDLSTRPYQQLKLH
BOP1_ANOGA        ---MMKKLYPGCKWISSMAIHP------KGDNLLIGTYEKRLMWFDLDLSTKPYQQLRIH
BOP1_DROER        ---LVKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROYA        ---LVKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROME        ---LVKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROSE        ---LVKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROAN        ---LVKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROMO        ---LIKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROVI        ---LIKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROGR        ---LIKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROPE        ---LIKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROPS        ---LIKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_DROWI        ---LIKKLLTNSKWISGMSIHP------KGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLH
BOP1_CAEBR        ---LVKKLITGCKHISSMATDA------NGENLFLGGLDRRFCWMDLQMGNKPWKKLKHH
BOP1_CAEEL        ---LVKKLITGCKHISTMATDA------NGENLFLGGLDRRFCWMDLQMGNKPWKKLKHH
BOP1_BRUMA        ---LKKKIITGSQWMSCMHVDF------RGDNVFVGGHDRVFSWIDLQLSSKPWKSVKHH
BOP1_CHLRE        ---LAKKLLGGGGVLSCLALHP------GGDHVLVGSDDKRVAWYDLDLSTKPYKALRYH
F6HCQ7_VITVI      ---LVKKLETGLREVSSIAVHP------AGDNVIVGSREGKLCWFDMDLSSQPYRILKCH
BOP1_MONBE        ---LVKKLLTGVRWLSSLAIHP------AGDNLIIGSYDKRLCWFDMDLSIKPYKILRYH
ERB1_ASPFU        ---LVKILQPGARWISSFDIHPTSSTASGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_ASPFC        ---LVKILQPGARWISSFDIHPTSSTASGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_NEOFI        ---LVKILQPGARWISSFDIHPTSSTASGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_ASPCL        ---LVKILQPGARWISSFDIHPTSSTASGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_ASPOR        ---LVKIIQPGARWISSFDIHPTSSTASGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_ASPTN        ---LVKIVQPGARWISSFDIHPTSSTAAGGDNIIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_ASPNC        ---LVKIIQPGARWISSFDIHPTSSTASGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_EMENI        ---LVKIVQPGARWISSFDIHPTSATAAGGDNLIVGSYDRRLLWHDLELSQRPYKTLRYH
ERB1_AJECN        ---LVKILQPGARWISSFDIHPTSSTTSGGDNLIVGSYDRRLLWHDVDLSPRPYKTLRYH
ERB1_CHAGB        ---LVKVVQPGAKWISSFDIHP------GGDNLIVGSYDKRLLWHDLDLSNRPYKTMRFH
ERB1_PODAN        ---LVKIVQPGAKWISSLDIHS------GGDHLIVGSYDRRLLWHDLDLSNRPHKTMRFH
ERB1_NEUCR        ---LVKVVQPGAKWISSFDIHP------GGDNLIVGSYDKRLLWHDLDLSIRPYKTMRFH
ERB1_MAGO7        ---LVKVVQPGARWISSFDIHP------GGDNLIVGSYDRRLLWHDLDLSTRPYKTMRFH
ERB1_BOTFB        ---LVKIIQPGARWISSFDIHP------GGDNLIVGSYDRRLLWHDLDLSTRPYKTMRFH
ERB1_PHANO        ---LVKILQPGAKWISSIDVHP------GGDNIIVGTYDKRLLWHDLDLSNKPYKTLRFH
ERB1_PYRTR        ---LVKILQPGAKWISSIDVHP------GGDNLIVGTYDKRLLWHDLDLSNKPYKTLRFH
ERB1_ASHGO        ---LVKKLLPGARWLSTIDIHP------RGDNLIASSFDKRVLWHDLDLAATPYKTLRYH
ERB1_KLULA        ---LIKKLLPGARWLSTIDIHP------RGDNLIASSFDKRVLWHDLDLASTPYKTLRYH
ERB1_YEAST        ---LVKKLLPGARWLSKIDIHP------RGDNLIASSFDKRVLWHDLDLASTPYKTLRYH
ERB1_YEAS7        ---LVKKLLPGARWLSKIDIHP------RGDNLIASSFDKRVLWHDLDLASTPYKTLRYH
ERB1_CANGA        ---LVKKLLPGARWLSNIDIHP------RGDNLIASSYDKRVLWHDLDLAATPYKTLRYH
ERB1_CANAL        ---LLKKLMPGVRLLSTIDIHP------RGDNLIAGSYDKRVLWHDLDLSATPYKTLRYH
ERB1_PICST        ---LVKKLMPGVRLLSTIDIHP------RGDNLLASSYDKRVLWHDLDLSATPYKTLRYH
ERB1_LODEL        ---LLKKLLPGVRLLSTIDLHP------RGDNLLAASYDKRVLWHDLDLAATPYKTLRYH
ERB1_DEBHA        ---LVKKLMPGARWLSNIDIHP------RGDNLLASSYDKRVLWHDLDLSSTPYKTLRYH
ERB1_PICGU        ---LTKKLMPGARYLSGIDIHP------RGDHLLASSYDKRVLWHDLDLSNTPYKTLRYH
ERB1_YARLI        ---MAKKLMPGARWVSSLDIHP------RGDNVILSSFDKRLLWHDLDLSDKPYKTLRYH
ERB1_SCHPO        ---LVKTLLTGVKWVSSLSVHS------SGDHVIIGSYDKRLCWFDLDFSSKPYKNLRYH
ERB1_COPC7        ---LIKTLQPGIRWISSMDVHP------SGDHVIVGGYDRKLCWFDLELSEKPYKVLRYH
ERB1_CRYNJ        ---LIRTLQSGVKWISSMDVHS------GGDNLIIGSYDKKLAWFDMDLSAKPYKTLRYH
ERB1_MALGO        ---LVKTLQPGVRWISSLDVHP------SGDHVIIGSYDRRVLWFDLDLSERPYKALRYH
ERB1_USTMA        ---LIKTLQSGFKWISTLDVHP------SGDHLMVGSYDKKLAWFDLDLSARPYKVLKYH
BOP1_DICDI        ---LIKKLITGCRYISSIDIHP------QGDNVIMGGYDKKVCWFDLDLSVRPYKVLNYH
A0E170_PARTE      ---LMKKLLAGNQQNSTIAIHP------YGDNLIVGSNDQKVCWFDLDMGKTPFKKMSYH
A0DKQ7_PARTE      ---LMKKLLAGNQQNSTIAIHP------YGDNLIVGSNDQKVCWFDLDMGKTPFKKMSYH
Q248A8_TETTS      ---TLKKLLTGCQWASSIDIHP------YGDNLIVGSFDKKVLWFDLDLGNTPYKNMKYH
BOP1_LEIIN        ---LQRRFKASGGVTTCLSIHP------EGDNFLVGDTTSHTSWFDMDFSDKPYKRMRSH
BOP1_LEIMA        ---LQRRFKASGGVTTCLSIHP------EGDNFLVGDTTSHTSWFDMDFSDKPYKRMRSH
BOP1_LEIBR        ---LQRRFKASGGVTTCLSIHP------EGDNFLVGDTTSHTSWFDMDFSDKPYKRMRSH
Q384Z1_TRYB2      ---LQRRYKAPGGITTCLSIHT------EGDNFLVGDTTSHTQWYDCDFSDKPYKRMRSH
B3LAV2_PLAKH      --ERIVKKLRGIQNITCVDVHI------NESYILSSDENGNVFIFDLDLSCNPYKKFHLQ
A5K1G8_PLAVS      --ERIVKKLRGIQNITCVDVHI------NESYILSSDEKGNVFIFDLDLSSNPYKKFHLQ
Q7RDY8_PLAYO      --EKIFKKLRGVKNATSIDIHT------NESYILVSDEKGNVFIYDLDLASSPYKMFHAQ
Q8IM36_PLAF7      --ERIFKKLRGVQHITSMDVHT------NESYILVSDSLGNVFIFDLDLSCNPYKKFHLQ
C4M3V4_ENTHI      ---TQKRLNVPSKSITDIVFHP------CGDHLIACSFDKKCIWYDLQAGLDPFKVLRLH
V4YYZ6_TOXGV      KHQALVRKLVGAEAISSIDVHP------SGEQIIAGAENRRLYIFDLELSSRVYKIMRSH
E2RU09_GIAIC      ---KLSTLYPGVKQVTASGMGY-------GDNFITGSADSQCALFANAAGPEPTAKLCYH
                                 :                .                .      .  .

A7AMI3_BABBO      EGRIVHVEFHRS---LPLLMIASAN----------GVIHLIHVKVPTDLSQEPVIVPLRD
Q4UBJ6_THEAN      NETIIKVQIHKK---LPLFLVAYTH----------CVKCF---HLSTTQESELLFVPLGE
BOP1_MOUSE        KKALRAVAFHPR---YPLFASGSDD----------GSVIVCHGMVYNDLLQNPLLVPVKV
BOP1_RAT          KKALRAVAFHPR---YPLFASGSDD----------GSVIVCHGMVYNDLLQNPLLVPVKV
BOP1_HUMAN        KKALRAVAFHPR---YPLFASGSDD----------GSVIVCHGMVYNDLLQNPLLVPVKV
BOP1A_XENLA       KKALRAVSFHKS---YPLFASGSDD----------GSVIVCHGMVYNDLLQNPLIVPVKV
BOP1B_XENLA       KKALRAVSFHKS---YPLFASGSDD----------ASVIVCHGMVYNDLLQNPLIVPVKV
BOP1_XENTR        KKALRAVSYHKQ---YPLFASGSDD----------GSVIVCHGMVYNDLLQNPLIVPVKV
BOP1_DANRE        KKALRSVSFHSH---YPLLASGSDD----------GSVIVCHGMVYNDLLQNPLIVPVKV
BOP1_AEDAE        HSAIRNVAFHLR---YPLFASASDD----------RSVIVSHGMVYNDLLQNPLIVPLRR
BOP1_CULQU        FSAIRNVAFHQR---YPLFASASDD----------RSVIVSHGMVYNDLMQNALIVPLRR
BOP1_ANOGA        NAAIRSVAFHPR---YPLFASAGDD----------RSVIVSHGMVYNDLLQNPLIVPLRR
BOP1_DROER        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROYA        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROME        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROSE        RNAVRSVAFHRR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROAN        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROMO        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROVI        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROGR        RNAVRSIAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROPE        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROPS        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_DROWI        RNAVRSVAFHLR---YPLFASGSDD----------QAVIVSHGMVYNDLLQNPLIVPLKK
BOP1_CAEBR        TAAVRSVAYHKK---YPLLATVSDD----------GTAMVYYARIYSDFSKDNELYPVKR
BOP1_CAEEL        TAAVRSVAYHKK---YPLLATVSDD----------GTAMVYYARIYTDFVKDNELYPVKR
BOP1_BRUMA        TAAIRGVTQHAR---CPLIATVSDD----------STAIVYYARISSDSLKENEFVPVRR
BOP1_CHLRE        SAPPRAVAFHRS---YPLFASAADD----------GTVQVFHGMVYADLLTNPLIVPVKI
F6HCQ7_VITVI      PKDITNVAFHHS---YPLFATCSDD----------CTAYVFHGMVYSDLNQNPLIVPLEI
BOP1_MONBE        KYALRQVCFHKK---YPIFASCGDD----------GNVHVLHGMVYNDLGQNPLIVPVKI
ERB1_ASPFU        RKAIRAVKFHPGG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNATIVPLKV
ERB1_ASPFC        RKAIRAVKFHPGG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNATIVPLKV
ERB1_NEOFI        RKAIRAVKFHPGG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNATIVPLKV
ERB1_ASPCL        RKAIRAVKFHPGG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNATIVPLKV
ERB1_ASPOR        RKAIRSVRFHPSG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNASIVPLKV
ERB1_ASPTN        RKAIRSVKFHPGG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNASIVPLKV
ERB1_ASPNC        RKAIRAVKFHPSG-RYPLFADASDD----------GSLQIFHGSVTGDMLSNASIVPLKV
ERB1_EMENI        RKAIRAVKFHPGG-RYPLFADASDD----------GSLQIFHGNVTGDMLSNATIVPLKV
ERB1_AJECN        QKAIRAVRYHSN---YPLFADASDD----------GSLQIFHGSVTGDLLSNASIVPLKV
ERB1_CHAGB        GQAIRQVRYHRGG--LPLFADASDD----------GSLQIFHGKVPNDQLENPTIVPVKM
ERB1_PODAN        PKAIRAVRFHKGG--LPLFADASDD----------GTLQIFYGKVPNDQLESPTIVPVKQ
ERB1_NEUCR        SEAVRQVKYHRGG--LPLFADASDD----------GTLQIFHGKVPNDQLENPTIVPVKV
ERB1_MAGO7        PQAIRAVKYHRGG--LPLFADASDD----------GSLQIFHGKVVSDLMENATIVPLKS
ERB1_BOTFB        NKAIRAVKYHKGG--LPLFADASDD----------GSLQIFHGKVVSDAMENATIVPVKV
ERB1_PHANO        KEAIRAVKFHQGG--LPLFADASDD----------GSLQIFHGKVVDDLMENATIVPLKV
ERB1_PYRTR        KEAIRAVRFHQGG--LPLFADTSDD----------GTIQIFHGKVVGDLMENATIVPLKV
ERB1_ASHGO        EKAVRSVGFHK---KLPLFCSAADD----------GTIHVFHGTVYDDMMKNPLLVPLKK
ERB1_KLULA        EKAVRSVSFHK---KLPLFCSAADD----------GNIHVFHATVYDDLMKNPMIVPLKK
ERB1_YEAST        EKAVRSVNFHK---KLPLFSSAADD----------GTIHVFHATVYDDMMKNPMIVPLKK
ERB1_YEAS7        EKAVRSVNFHK---KLPLFSSAADD----------GTIHVFHATVYDDMMKNPMIVPLKK
ERB1_CANGA        DKAVRSTTFHK---KLPLFCSAADD----------GFIHIFHATVYDDMMKNPMIVPLKK
ERB1_CANAL        EKAVRSIKFHKG--NLPLFASASDD----------GNIHIFHGTVYDDLMTNPLLVPLKK
ERB1_PICST        EKAVRSIKFHKG--NLPLFASASDD----------GNIHIFHGTVYDDLMTNPLLVPLKK
ERB1_LODEL        EKAVRQIKYHKG--SLPLFASASDD----------GIIHVFHGTVYDDLMTNPLLVPLKK
ERB1_DEBHA        DKAVRSIKFHKA--NLPLFASASDD----------GSIHVFHGTVYDDLMTNPLLVPLKK
ERB1_PICGU        EKAVRNIKFHKG--RLPLFASASDD----------GSVHVFHGTVYDDLMTNPLLVPLKK
ERB1_YARLI        EKAVRHAAFHKG--GLPLFCSASDD----------GNINIFHGTVYDDMMTNPLLVPLKV
ERB1_SCHPO        SRALRDVSYHPS---LPLFCSGSDD----------GDVQVFHGRVYSDLLANPLIVPLKI
ERB1_COPC7        SRAIRSLHFHPT---YPLFASSSDD----------GSIQIFHARVYNDLMTDPLIVPLKI
ERB1_CRYNJ        NRALRSVAYHPT---LPLFASASDD----------GTVHIFHCTVYTDLMQNPLIVPLKI
ERB1_MALGO        SRAVRAVAYHPR---FPLFASAADD----------GTVHVYHGTVYSDLLQNALLVPLKI
ERB1_USTMA        ARAIRSVHFSTS---WNLVADASDD----------GTLQLFYAKVGADYGENLTLVPLKV
BOP1_DICDI        KMAVRKVIYHPT---LPLFASCSDD----------LSIHVFHGMVYDDLLQNALIVPLKI
A0E170_PARTE      KNGVRRVIFHKT---YPLFASCSDD----------GTINIFHCRISTDLNQAPVILPLKV
A0DKQ7_PARTE      KNGVRRVIFHKT---YPLFASCSDD----------GTINIFHCRISTDLNQAPVILPLKV
Q248A8_TETTS      EKGIRQVCFSRK---YPLMASSSDD----------GSINIFHAKVFKDSFENALILPVKV
BOP1_LEIIN        RGVVNALAFHPKTNAYPLFATGASD----------GQVHVFHGMVYDDYNKNALVVPVKI
BOP1_LEIMA        KGVVNALAFHPKTNAYPLFATGASD----------GQVHVFHGMVYDDYNKNALVVPVKI
BOP1_LEIBR        KGVVNALAFHPKTGAYPLFATGASD----------GQVHVFHGMVYDDYNKNALVVPVKI
Q384Z1_TRYB2      KGVVNAVAFHTNTNAYPLFASGAAD----------GQVHVFHGMVYDDYNKNALLVPVKI
B3LAV2_PLAKH      ECSLKKVEFHKK---YNLFYSLSSN----------GVVNLFYAKFFQDYVTNPVLLPITQ
A5K1G8_PLAVS      ECSLKKVEFHKK---YNLFYSLSSN----------GVVNLFYAKFFQDYVTNPVLLPITQ
Q7RDY8_PLAYO      NCPLKKAEFHKE---YNLFYSLGSN----------GVINLFYSKFFNDYITDPILVPIKE
Q8IM36_PLAF7      ECPLKKVQFHKS---YNLFYSLGDN----------GKINLFYSKFFQDYITNPVLLPIKE
C4M3V4_ENTHI      TAAVRAVDVHKI---LPLFATIGDD----------AEIQIMHGAASSDVTVDPILIPIVK
V4YYZ6_TOXGV      KGAITCACLHPS---FPLMCTASAD----------GTVQIYHFKVFNDLITNPLIVPVRT
E2RU09_GIAIC      TSTIRNIDVHPCG---GLVATCSDDGIVQISRIVDASLVKMHPGQFDEKLYNRMIPCVVL
                                   :.     .                             .  :  

A7AMI3_BABBO      LR------MSG-VTHAHWHKKEPWIYTSGLDCGYMWA----
Q4UBJ6_THEAN      LK------IKEKLTDCSWHNTEPWLYTSTNKEALMWA----
BOP1_MOUSE        LKGHTLT-RDLGVLDVAFHPTQPWVFSSGADGTIRLFS---
BOP1_RAT          LKGHSLT-RDLGVLDVAFHPTQPWVFSSGADGTIRLFS---
BOP1_HUMAN        LKGHVLT-RDLGVLDVIFHPTQPWVFSSGADGTVRLFT---
BOP1A_XENLA       LRGHAIH-RDLGVLDVTFHPTQPWVFSSGADATIRLFT---
BOP1B_XENLA       LRGHAIH-RDLGVLDVMFHPTQPWVFSSGADGTIRLFT---
BOP1_XENTR        LRGHAIH-RDLGVLDVIFHPTQPWVFSSGADATIRLYT---
BOP1_DANRE        LKGHSIT-HDLGVLDVTFHPTQPWVFSSGADATIRLYT---
BOP1_AEDAE        LEHHERV-NDFGAFDVVFHPTQPWLFSSGADNTVRLYT---
BOP1_CULQU        LENHERV-NDFGAFDVVFHPTQPWLFSSGADNTVRLYT---
BOP1_ANOGA        LKNHAVV-NDFSVFDVVFHPTQPWVFSSGADNTVRLYT---
BOP1_DROER        LQTHEKR-DEFGVLDVNWHPVQPWVFSTGADSTIRLYT---
BOP1_DROYA        LQTHEKR-DEFGVLDVNWHPVQPWIFSTGADSTIRLYT---
BOP1_DROME        LQTHEKR-DEFGVLDVNWHPVQPWVFSTGADSTIRLYT---
BOP1_DROSE        LQTHEKR-DEFGVLDVNWHPVQPWVFSTGADSTIRLYT---
BOP1_DROAN        LQTHEKR-EDFGVLDVNWHPIQPWIFSTGADCTIRLYT---
BOP1_DROMO        LQTHEKR-DEFGVLDVTWHPVQPWVFSTGADCTIRLYT---
BOP1_DROVI        LQTHEKR-DEFGVLDVSWHPVQPWVFSTGADCTIRLYT---
BOP1_DROGR        LQTHEKR-DEFGVLDVNWHPVQPWIFSTGADCTIRLYT---
BOP1_DROPE        LQTHEKR-EEFGVLDVNWHPVQPWVFSTGADCTIRLFT---
BOP1_DROPS        LQTHEKR-EEFGVLDVNWHPVQPWVFSTGADCTIRLFT---
BOP1_DROWI        LQTHEKR-DDFGVLDVCWHPVQPWVFSTGADCTIRLYT---
BOP1_CAEBR        LRAHERTSNDLCMLHTTWHPTQPWLITTGADGTIALFTY--
BOP1_CAEEL        LRAHEKTPNDLCMLHTTWHPTQPWLITAGADGTIALFTY--
BOP1_BRUMA        LRTQTAQKNGLSILAAIFHPSQPWLITAHVDGSIALFT---
BOP1_CHLRE        LRGGHTVTASEGVADCAFHPTQPWIFTAGADSKILLYCN--
F6HCQ7_VITVI      LRGHSSTNGRG------------------------------
BOP1_MONBE        IKAHNQTSDGMGVMDCTFHPSQPWLFSAGSDGSIKLHV---
ERB1_ASPFU        LKGHKIT-GELGVLDVDWHPREPWCVSAGADGTCRLWM---
ERB1_ASPFC        LKGHKIT-GELGVLDVDWHPREPWCVSAGADGTCRLWM---
ERB1_NEOFI        LKGHKIT-GELGVLDVDWHPREPWCVSAGADGTCRLWM---
ERB1_ASPCL        LKGHKIT-GELGVLDIDWHPREPWCVSAGADGTCRLWM---
ERB1_ASPOR        LKGHKIT-GELGVLDVDWHPREAWCVSAGADGTCRLWM---
ERB1_ASPTN        LKGHKIT-GELGVLDVDWHPREAWCVSAGADGTCRLWM---
ERB1_ASPNC        LKGHKIT-GELGVMDLDWHPREAWCVSAGADGTCRLWM---
ERB1_EMENI        LRGHKIT-GELGVLDIDWHPREAWCVSAGADGTCRLWM---
ERB1_AJECN        LRGHKVT-GELGVLDLDWHPREAWCVSAGADGTCRLWT---
ERB1_CHAGB        LKGHKVV-SKLGVLDIDWHPREPWCVSAGADGTARLWM---
ERB1_PODAN        LKGHKVV-NQVGVVDIDWHPREPWCVSAGADGTARLWM---
ERB1_NEUCR        LKGHKVV-NKLGVLDMDWHPREPWCVSAGADGTIRLWM---
ERB1_MAGO7        LKGHRVV-DSLGVMDVDWHPSEPWCISAGADGTCRLWM---
ERB1_BOTFB        LKGHKVK-SALGVMDLDWHPKEPWLVSAGADGTCRLWT---
ERB1_PHANO        LRGHKVK-SRLGVMDLDWHPREPWCVSAGADGTLRLWN---
ERB1_PYRTR        LKGHKVR-SRLGVMGLDWHPKEPWCVSAGADGTLRLWS---
ERB1_ASHGO        LTGHKLV-NSLGVLDTVWHPREAWLFSAGADNTARLWTT--
ERB1_KLULA        LTGHKIV-NSLGVLDTIWHPREAWLFSAGADKTARLWTT--
ERB1_YEAST        LTGHKVI-NSLGVLDAIWHPREAWLFSAGADNTARLWTT--
ERB1_YEAS7        LTGHKVI-NSLGVLDAIWHPREAWLFSAGADNTARLWTT--
ERB1_CANGA        LTGHKVQ-GHLGVLDTIWHPKEAWLFSAGADNTARMWTT--
ERB1_CANAL        LNGHKII-NQIGILDLIWHPKEPWLFSAGADGTARLWTT--
ERB1_PICST        LTGHKIV-NSIGILDLIWHPKEAWLFSAGADGTARLWTT--
ERB1_LODEL        LSGHKVI-NQIGVLDIVWHPKEAWLFSAGADGTARLWTT--
ERB1_DEBHA        LTGHKII-NSLGVLDLVWHPKEAWLFSAGADGTARLWTT--
ERB1_PICGU        LTGHKVV-HSLGVLDLVWHPKEAWLFTAGADGTARLWTT--
ERB1_YARLI        LKGHDVK-SGLGILRVEWHPREAWLFSAAADGTAKLWTT--
ERB1_SCHPO        LRNHKVV-DNVGVLSTCWHPKEAWLFSAGAGGEIRMWT---
ERB1_COPC7        LRGHQIT-DGLGILQVKWTPKHPWLLSAAADGTVAVWCS--
ERB1_CRYNJ        LRGHKVI-DGIGVLDLRWVPGKPWLVSSGADGEVRLWCS--
ERB1_MALGO        LRGHAVQ-DALGVLSIAWHPTLPWLVSAGADGDARLWTP--
ERB1_USTMA        LRGHEVK-NGLGVLDVKWHPNQPWLFSAGADGNALLWTT--
BOP1_DICDI        LKTHESI-NDLGVLDIVFHPKQPWIFSSGADSTIRLYTN--
A0E170_PARTE      LKQKKKE-S---VMDVAFHPTQPWIYSASKEGVVSLWT---
A0DKQ7_PARTE      LKQKKKE-S---VMDVAFHPTQPWIYSASKEGVVSLWT---
Q248A8_TETTS      LKGHTVH-NSLGVLDIVFHPTQPWIFSAGSDHRIFLWT---
BOP1_LEIIN        LKHQRPV------YAVAWHPTLAWLFTSTEDGVVTAWTE--
BOP1_LEIMA        LKHQRPV------YAVAWHPTLAWLFTSTEDGVVTAWTE--
BOP1_LEIBR        LKHQRSV------YAVAWHPSLAWLFTSTEDGVVTAWTE--
Q384Z1_TRYB2      LKHRRAV------YSVAWHPTLPWIFTSTEDGVVSAWTE--
B3LAV2_PLAKH      LSSESKI------CDVTWSGRSPWLFAHTEGNFSVLYT---
A5K1G8_PLAVS      LTSESKI------SDVTWSGRSPWLFAHTEGNFSVLYT---
Q7RDY8_PLAYO      IKNEAKI------IDLTWSEKKPWLFAHTESNFSVLYT---
Q8IM36_PLAF7      ISNESKI------VDMVWSEKKPWFFTYTQNNFSVLYT---
C4M3V4_ENTHI      LGGHEKK-GQLGGTDIAFHPFLPWIYSTGADGTIQWYSDWF
V4YYZ6_TOXGV      LRVVEEPQKNGGVLCCMWHPTQPWLVTADRSGQCSLWT---
E2RU09_GIAIC      NRRRQAADGSVGISRVTWHPRQPWLLCSGTDGVLRLFK---