CLUSTAL format seed alignment for MF_03028

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PESC_LEIIN        -----------MAHKKQAWAKRVKKERFKKKFLTRMQATRLLQMESVQFRRLCILKGIYP
PESC_LEIMA        -----------MVHKKQAWAKRVKKERFKKKFLTRMQATRLLQMESVQFRRLCILKGIYP
PESC_LEIBR        -----------MAHKKQAWAKRVKKERFKKKYLTRMQATRLLQMESIQFRRLCILKGVYP
Q38EE3_TRYB2      ------------MHRKQAWSKRVKKERQKKKYLTRMQATRLLQVDSIHFRRLCILKGIYP
PESC_DICDI        --------------MGGIKKFKKGEKGENLKFITRNEAVKKLQISLKIFRKLCILKGIHP
F0ZGY9_DICPU      --------------MGGIRKFKKGVKGENLKFMTRNEAVKKLQVSLKVFRKLCILKGIHP
D3BB01_POLPP      --------------MGGIRKYKKNEKGENIRFITRNAAARKLQISLKLFRKLCIIKGIHP
A0DEJ7_PARTE      ----------------MGKKIKKGKEGPVKEYVSRTKALKKLQVNLKDFRRLCILKGIYP
A0D1P2_PARTE      ----------------MGKKIKKGKEGPVKEYVSRTKALKKLQVNLKDFRRLCILKGIYP
Q23RV6_TETTS      ----------------MVKKVMKNTRGEATKYISRAKAIKKLQVSLKDFRRLCILKGVYP
Q5CXI7_CRYPI      ---------------MGGQKIKKGTRGDSAMFITRAQAIKRLQVSLADFRRLCILKGVYP
PESC_HUMAN        ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYP
I3MLZ5_ICTTR      ---------------MGGLEKKKYERGSATNYISRNKARKKLQLSLPDFRRLCILKGIYP
H0WSW0_OTOGA      ---------------MGGLERKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYP
G1LLM9_AILME      ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYP
PESC_MOUSE        ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYP
PESC_RAT          ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYP
PESC_DANRE        ---------------MGGLQKKKYESGSATNYITRNKARKKLSLSLADFRRLCILKGIYP
PESC_SALSA        ---------------MGGLQKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYP
H3BC39_LATCH      ---------------MGGLEKKKYERGAATNYITRNKARKKLQLSLADFRRLCILKGIYP
PESC_XENLA        ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYP
PESC_XENTR        ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYP
F6Y1Q9_XENTR      ---------------MGGLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYP
PESC_NEMVE        ---------------MGKLK-KKGERGAATNYVSRNQALKKLQLSLPDFRRLCILKGIYP
PESC_AEDAE        ----------------MVKRNHKYQSGEGAQYMTRKAAMRKLQLSMQDFRRLCILKGIYP
PESC_CULQU        ----------------MVKRNHKFQSGEGAQYLTRKAAMRKLQLSMQDFRRLCILKGIYP
PESC_ANOGA        ----------------MVKRNHKFKSGEGAMYYTRKAAMNKLQLNIKDFRQLCILKGIYP
PESC_DROER        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROYA        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROSE        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROSI        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROME        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROAN        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROGR        -----------------MRRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROVI        -----------------MRRPKKYEAGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROMO        -----------------MRRPKKYEAGEATQYISRRAALRKLQLSLNDFRRLCILKGVYP
PESC_DROPE        -----------------MRRPKKYEAGEATQYISRRAAIRKLQLSLNDFRRLCILKGVYP
PESC_DROPS        -----------------MRRPKKYEAGEATQYISRRAAIRKLQLSLNDFRRLCILKGVYP
PESC_DROWI        -----------------MRRPKKYESGEATQYISRRAALRRLQLSLNDFRRLCILKGVYP
E0VTT0_PEDHC      --------------------------------MSRRAALRYLQLSLKDFRRLCILKGIYP
E9FYB2_DAPPU      ---------------MGARMKKKYEAGEATKYITRAQALKKLQLNLKDFRRLCILKGVYP
PESC_CAEBR        ---------------MKDRFKQKYTAGAAVAYMSRKQALKKLQLTLKDFRRLCIIKGIYP
PESC_CAEEL        ---------------MKDRFKQKYTAGAAVAYMSRKQALKKLQLTLKDFRRLCIIKGIYP
PESC_BRUMA        -------MRHFTYHSDVVVWQYIFESGAATNYITRGRALKKLQLSLKDFRRLCILKGVYP
G4VRP5_SCHMA      -------------------MKKKHTKGQVVAFLSQKQAMRRLQLNLPNFRRLCILKGIYP
PESC_SCHPO        -------------MARVKQK---GKAGAARIYITRNQALKKLQLTLADFRRICILKGVYP
F4P5J1_BATDJ      -------------MAGKLKKAMIGKEGNVLKYISRSQAIKKLQITLTQFRRLCILKGIYP
I1CDW4_RHIO9      -------------MGKLIKK---GTKGAAANFITRQQALNKLQISLADFRRLCILKGIYP
PESC_COCIM        -------------MAKIKKK---GTSGAAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
C0NUL9_AJECG      -------------MGKIKKK---GTSGQAKNFITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_ASPFU        -------------MGKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_ASPFC        -------------MGKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_NEOFI        -------------MGKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_ASPCL        -------------MGKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_ASPOR        -------------MAKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_ASPTN        -------------MAKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_EMENI        -------------MAKIKKK---GTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYP
PESC_PHANO        ------------MAGRSKKK---GTSGAAKNYITRTRAVKKLQISLPDFRRLCIFKGIYP
PESC_PYRTR        -------------MHILTPT---QAPLVPNPPHELMYTSSPLQISLPDFRRLCIFKGIYP
PESC_BOTFB        -------------MGRIKKK---GTSGQAKNFITRTQAVRKLQISLPDFRKLCIWKGIYP
PESC_SCLS1        -------------MGRIKKK---GTAGQAKNFITRTQAVRKLQISLPDFRKLCIWKGIYP
PESC_CHAGB        -------------MGKLKKK---GQSGQAKNYITRTQAVKKLQLSLPDFRKLCIWKGIYP
PESC_NEUCR        -------------MPKIKKK---GQAGAAKNYITRTQAVKKLQLSLPDFRKLCIWKGIYP
C7YII3_NECH7      -------------MARIKKK---GKAGAAKNYVTRNQAIRKLQISLPDFRKLCIWKGIYP
PESC_MAGO7        -------------MGRIKKK---GESGAAKNYITRTQAVRKLQISLPDFRKLCIWKGIYP
D5GH60_TUBMM      -------------MPKIKKK---GVSGNAKNFITRTQAVRKLQVSLPDFRRLCIFKGIYP
PESC_ASHGO        --------------MRVKKK---NTTGNARNFVTRSQAVRKLQISLADFRRLCIFKGIYP
PESC_KLULA        --------------MRIKKR---NTRGNARNFITRSQAVRKLQISLADFRRLCIFKGIYP
PESC_YEAST        --------------MRIKKK---NTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYP
PESC_YEAS7        --------------MRIKKK---NTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYP
PESC_VANPO        --------------MRIKKK---NTSGNAKNFVTRSQAVRKLQVSLADFRRLCIFKGIYP
PESC_CANGA        --------------MRVKKR---NVRGNAKNFITRSQAVRKLQISLADFRRLCIFKGIYP
PESC_CANAL        -------------MARIKKR---GTTGNAKNFITRTQAIKKLQISLADFRRLCIFKGIYP
PESC_LODEL        -------------MGKIKKR---ATSGNAKNFITRTQAIKKLQVSLADFRRLCIFKGIYP
PESC_DEBHA        --------------MRIKKK---GTSGNAKNFITRTQAVKKLQVSLADFRRLCIFKGIYP
PESC_PICST        -------------MAKIKKR---GVSGNAKNFITRTQAVKKLQVSLSDFRRLCIFKGIYP
PESC_PICGU        --------------MRIKKK---GTSGNAKNFITRTQAVKKLQVSLADFRRLCIFKGIYP
PESC_YARLI        -------------MGQIKKK---HTAGAARNFITRTQAIRKLQVSLADFRRLCIFKGIYP
PESC_COPC7        -------------MGRLKQK---GKAGAAKNYITRTAAVRKLQCSLADFRRLCILKGIFP
PESC_LACBS        -------------MGRLKQK---GKAGAAKNYVTRTSAIKKLQCSLADFRRLCILKGIFP
PESC_CRYNJ        -------------MAKIKKR---GESGAAKNYVTRNQALKKLQISLSDFRRLCILKGIYP
PESC_MALGO        -------------MARIKKR---GESGAAKNYITRNQSLKKLQITLAEFRRLCILKGIFP
E3K873_PUCGT      MGRTAPAHIKTVKPGLKKKK---GTTGAARNYVTRNQALKKLQCTLSDFRRLCILKGIYP
PESC_MONBE        -------------MGRIKKK---GEEGTATEYMSRSRAVRKLQLSLADFRRLCILKGIYP
D7TWJ6_VITVI      -------------MPKHYRPPGKKKEGNAAKYITRSQAVKHLQVSLPLFRRLCILKGVFP
B9H456_POPTR      ----------MVARKKHYRPPGKKKEGNAARYVTRSQAIKQLQVTLGFFRRLSILKGIFP
PESC_ARATH        -------------MPKHYRPTGKKKEGNAARYMTRSQALKHLQVNLNLFRRLCIVKGIFP
C5WNV4_SORBI      -------------MPKHYRPAGKKKEGNAAKYITRTKAVNYLQVSLAIFRKLCILKGVFP
PESC_CHLRE        ---------------MAGKKLKKGKSGNAAQYITRTQAVRKLQLRLSEFRRLCILKGVHP
D0NK35_PHYIT      -------MGSKRRLAKFGKEQRKGMRGSAANYITRSQALKRLQVTLKDFRRLCILKGIYP
C4M0Q1_ENTHI      ------MVKGHGKHQSKRFAGKKEKAPKISKYITRTQAIKRLNCTMEQFRKICILKGVSP
Q4UA76_THEAN      ----------------MTLKKKPGKEGSTKNFITRTQAVRRLQVSLRDFQRLCILKGVYP
Q4N2W3_THEPA      ----------------MTLKKKPGKEGSTKNFITRTQAVRRLQVSLRDFQRLCILKGVYP
A7ATP9_BABBO      ----------------MTLKKKPNTEGNTRNYITRSQALKKLQVSLKDFQRLCILKGVYP
PESC_PLAF7        --------------MHIHKLKKKIKKKKEGKYLTKKHILRKLFLNEEEFRKLCIFKGIYP
PESC_PLAYO        --------------MHIHKLKAKIKKKHQEKYLTKKKIQKKLFLNESEFRRLCIFKGIYP
B3L4N0_PLAKH      --------------MHIHKLRKKANKKKEGKYFTKKSILKKLYLKEKEFRKLCIFKGIYP
A5K4A1_PLAVS      --------------MHIHKLRKKAKKKKEGKYLTKKSILKKLFLKEREFRKLCIFKGIYP
A8BZA6_GIAIC      ----------------MPLVRRKDPNSMEMRFMPRNKACRKLQLTLGEFRRVCIIKGIYP
A2DN41_TRIVA      ---------------MVKLPFQKGKEGKSSNLVKEDEAIERVALDPKDMGRMAILRGVYP
                                                           :      : ::.* :*: *

PESC_LEIIN        ---RALNRSKQKQSGHE-----KQYYLAREIKWLVRDQIAEKMMAYRAWEKKVKR-AEAM
PESC_LEIMA        ---RALNRSKQKQSGNE-----KQYYLAREIKWLVRDQIAEKMMAYRAWEKKVKR-AEAM
PESC_LEIBR        ---RALTRSKQKQSGNE-----KQYYLAREIKWLVRDHIAEKMMTYRAWEKKVKR-AEAM
Q38EE3_TRYB2      ---RALNRSKQKQSGND-----KQYYLAREIKWLVRDHLADRMMAFRAWEKKVRR-AEAM
PESC_DICDI        ------RDPKKKFKGKH-----KTYYYSKDIKYLQNEKVLEIIRARKVFKDREKK-LINK
F0ZGY9_DICPU      ------RDPKKKLKGKN-----KTYYYAKDIKYLQNEKILETIRERKTIKEKEIK-LIAK
D3BB01_POLPP      ------RDPKKKLQGKH-----KTYYYMKDIRFLQHEPIIQTLRDRKTFAKKEKK-LRER
A0DEJ7_PARTE      ------REPPQKLRKQH-----KTYYHNKDIAFLKNESILDTFRQRQAHLKKIRK-ALTR
A0D1P2_PARTE      ------REPPQKLRKQH-----KTYYHNKDIAFLKNESILDTFRQRQAHLKKIRK-ALTR
Q23RV6_TETTS      ------REPPKKLQKQN-----KTYYHLKDINYLMHEKILNKFRELKTHMKKVMK-LKAK
Q5CXI7_CRYPI      ------REPKKKLSGLD-----KTYYHLKDIIHLKHDPILSRIRELKIHLRKYRK-AMGR
PESC_HUMAN        -HEPKHKKKVNKGSTAA-----RTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRK-AYGK
I3MLZ5_ICTTR      -HEPKHKKKVNKGSTAA-----RTFYLIKDIKFLLHEPIVNKFREYKIFVRRLRK-AYGK
H0WSW0_OTOGA      -HEPKHKKKVNKGSTAA-----RTFYLVKDIKFLLHEPIVNKFREYSVFVRKLRK-AYGK
G1LLM9_AILME      -HEPKHKKKVNKGSTAA-----RTFYLLKDIKFLLHEPIVNKFREYKVFVRKLRK-AYGK
PESC_MOUSE        -HEPKHKKKVNKGSTAA-----RTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRK-AYGK
PESC_RAT          -HEPKHKKKVNKGSTAA-----RTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRK-AYGK
PESC_DANRE        -HEPKHKKKVNKGSTAA-----RTYYLLKDIRFLLHEPIVGKFREYKIFVRKLRK-AYGK
PESC_SALSA        -HEPKHKKKVNKGSTAP-----RTFYLLKDIRFLLHEPIVRKFREYKVFVRKLRK-AYGK
H3BC39_LATCH      -HEPKHKKKVNKGSTAP-----RTFYLHKDIKFLLHEPIVNKFREYKVFVRKLRK-AYGK
PESC_XENLA        -HEPKHKKKVNKGSTAP-----RTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRK-AYGK
PESC_XENTR        -HEPKHKKKVNKGSTAP-----RTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRK-AYGK
F6Y1Q9_XENTR      -HEPKHKKKVNKGSTAP-----RTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRK-AYGK
PESC_NEMVE        -VEPKNKKKVNKGSTAN-----KTYYYVKDIQWLAHEPVLNKFREFKVFLRKLKK-AIAK
PESC_AEDAE        -REPKHRVIAQRGSTDI-----KILYHRKDITFLLHEPIVWTLRDRKIFNRRIAH-ARAK
PESC_CULQU        -REPKHRAIAQRGSTDI-----KILYHKKDITFLLHEPIVWTLRDRKIFNRRIAA-AKGK
PESC_ANOGA        -REPKHRARAQHGSREM-----KILYHKKDITFLLHEPIVWTLRDRKIFNRRIKH-AAAK
PESC_DROER        -REPKHRRRAQKGSSEI-----KVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNR-DRAI
PESC_DROYA        -REPKHRRRAQKGSSEI-----KVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNR-DRAI
PESC_DROSE        -REPKHRRRAQKGSSEI-----KVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNR-DRAI
PESC_DROSI        -REPKHRRRAQKGSSEI-----KVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNR-DRAI
PESC_DROME        -REPKHRRRAQKGSSEI-----KVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNR-DRAI
PESC_DROAN        -REPKHRRRAQKGSSEI-----RVLYHTKDIRFLLHEQIVWTLRDYKIFAKKSNR-DRAI
PESC_DROGR        -REPKHRRRAQKGSSEI-----KILYHTKDIRFLLHEPIVWTLRDYKIFAKKSGR-DRAI
PESC_DROVI        -REPKHRRRAQKGSSDI-----KILYHAKDIRFLLHEPIVWTLRDYKIFAKKSGR-DRAI
PESC_DROMO        -REPKHRRRAQKGSSEI-----KILYHTKDIRFLLHEPIVWTLRDYKIFAKKSGR-DRAI
PESC_DROPE        -REPKHRRRAQKGSSEI-----KILYHTKDIRFLLHESIVWTLRDYKIFAKKTSR-DRAI
PESC_DROPS        -REPKHRRRAQKGSSEI-----KILYHTKDIRFLLHESIVWTLRDYKIFAKKTSR-DRAI
PESC_DROWI        -REPKHRRRAQKGSSEI-----KILYHAKDIRFLLHESIVWTLRDYKIFAKKSGR-DRAI
E0VTT0_PEDHC      -REPKKRKRAQKGATSI-----QTLYYKKDIQFLLHEPLIWKFRDLNVYFKKIGR-ASSL
E9FYB2_DAPPU      -REPNNRKKAQKGKLDK-----KTLYYVKDIRFLSHEPLIWKFRDFKIFMRKMKT-AMEK
PESC_CAEBR        -HEPAHKKQANKGSTAN-----KVFYYRKDINFLAHEPIINKFRDYKVFLRKLNH-LKAK
PESC_CAEEL        -HEPAHKKQANKGSTAN-----KVFYYRKDINFLAHEPIINKFRDYKVFLRKLNH-LKAK
PESC_BRUMA        -HEPLHKKKVNKGSTEN-----RVYYYAKDINFLASEPIIRKFREYKIFLRKLTT-AKAK
G4VRP5_SCHMA      -VEPRSRKKVGKGNSQP-----RIYYNAKDIAFLSHEPLIETFRKLRVFHVKLKK-ARER
PESC_SCHPO        -REPKNKKKANKGSTAP-----VTFYYTKDIQYLLHEPIVQKFREYKVFARKLSK-ALGK
F4P5J1_BATDJ      -VEPKNKRQLAKGSTTW-----QTYYFRKDIQFLLHEPVLRVLREQRSHKLKLNK-AIGK
I1CDW4_RHIO9      -REPKNKKKANKGSTAP-----ATFYYVKDIKYLLHEPLLVKFREHKAFTKRLNK-VLHK
PESC_COCIM        -REPRNKKKASKTSTPS-----TTFYYTRDIQYLLHEPLLKRFRDQKALSKKIAR-SLGR
C0NUL9_AJECG      -REPRNKKKASKSATPS-----TTFYYTRDIQYLLHEPLLKKFREQKTLSKKIAR-ALGR
PESC_ASPFU        -REPRNKKKASKTSTPN-----TTFYYTKDIQYLLHEPLLRKFREQKAVAKKIAR-SLGR
PESC_ASPFC        -REPRNKKKASKTSTPN-----TTFYYTKDIQYLLHEPLLRKFREQKAVAKKIAR-SLGR
PESC_NEOFI        -REPRNKKKASKTSTPN-----TTFYYTKDIQYLLHEPLLRKFREQKAVAKKIAR-SLGR
PESC_ASPCL        -REPRSKKKASKTSTPN-----TTFYYTKDIQYLLHEPLLRKFRDQKAVAKKIAR-SLGR
PESC_ASPOR        -REPRNKKKAAKNSTAS-----TTFYYTKDIQYLLHEPLLRKFRDQKALSKKIAR-SLGR
PESC_ASPTN        -REPRNKKKASKTSTPN-----TTFYYTKDIQYLLHEPLLRKFRDQKAVAKKIAR-SLGR
PESC_EMENI        -REPRNKKKASKSATQS-----TTFYYTKDIQYLLHEPLLRKFREQKALAKKIAR-SLGR
PESC_PHANO        -REPRNKKKVSKGSTAQ-----TTFYYTKDIQYLLHEPLLAKFREHKSVAKKIGR-ALGR
PESC_PYRTR        PREPRNKKKVSKGSTAA-----TTFYYTKDIQYLLHEPLLAKFREHKAVAKKIGR-ALGR
PESC_BOTFB        -REPRNKKKASKSSTHS-----TTFYYTKDIQWLLHEKIVDAFREQKALERKISK-ALGR
PESC_SCLS1        -REPRNKKKASKSSTHS-----TTFYYTKDIQWLLHEKIVDAFREQKALEKKISK-ALGR
PESC_CHAGB        -REPRSRKKVSKSATAS-----TTFYYTKDIQYLLHEPLLQKFRDQKVLEKKISR-ALGR
PESC_NEUCR        -REPRNKKKVSKSATAS-----TTFYYTKDIQYLLHEPLLQKFRDQKVLEKKISR-ALGR
C7YII3_NECH7      -REPRSRKKVSKSSTSS-----TTFYYAKDIQYLLHEPLLQKFRDQKVLEKKISR-ALGR
PESC_MAGO7        -REPRNKKKVSKSATAS-----TTFYYTKDIQYLLHEPLLAKFRDQKVLEKKISR-ALGR
D5GH60_TUBMM      -REPRNKKKANKGSTQS-----TTFYYTKDIQYLLHEPVLQKFRDHKAFAKKLQK-ALGR
PESC_ASHGO        -REPRNKKKANKGSTAP-----TTFYYYKDIQYLQHEPVLAKFREHKTFAKKLTR-ALGR
PESC_KLULA        -REPRNKKKANKGSTAP-----TTFYYYKDIQYLMHEPVLAKFREHKTFAKKLTK-ALGR
PESC_YEAST        -REPRNKKKANKGSTAP-----TTFYYAKDIQYLMHEPVLAKFREHKTFARKLTR-ALGR
PESC_YEAS7        -REPRNKKKANKGSTAP-----TTFYYAKDIQYLMHEPVLAKFREHKTFARKLTR-ALGR
PESC_VANPO        -REPRNKKKANKGSTAP-----TTFYYAKDIQYLMHEPVLNKFREHKTFAKKLTR-ALGR
PESC_CANGA        -REPKNKKKANKGSTAP-----TTFYYAKDIQYLMHEPVLAKFREHKTFARKLTR-ALGR
PESC_CANAL        -REPRNKKKANKGSTAP-----VTFYYSKDIQYLLHEPVLDKFRQHKTFAKKLQK-ALGR
PESC_LODEL        -REPRNKKKANKGSTAP-----VTFYYAKDIHYLLHEPVLDKFRQHKTFAKKLQR-ALGK
PESC_DEBHA        -REPRNKKKANKGSTAP-----VTFYYTKDIQYLLHEPVLGKFREHKTFAKKLQR-ALGR
PESC_PICST        -REPRNKKKANKGSTAP-----VTFYYAKDIQYLSHEPVLAKFREHKTFAKKLQR-ALGR
PESC_PICGU        -REPRNKKKANKGSTAP-----VTFYYAKDIQYLLHEPVLQKFREHKTFAKKLQR-ALGR
PESC_YARLI        -REPRSKKKANKGSTAP-----VTFYYAKDIQYLLHEPVLDKFREHKTFAKKLTR-ALGR
PESC_COPC7        -REPNNRKKANKGSSAP-----TSFYYAKDIAYLAHEPVLKRLREHKAFAKKLSR-ALGR
PESC_LACBS        -REPRSRKRANKGSSAP-----TSFYYAKDIAYLAHEPVLKKLREHKAFAKKLSR-ALGR
PESC_CRYNJ        -REPLNKKRANKGSSAP-----ASFYYHKDIQYLLHEPLLVKFREHKAFAKKLAR-AIGR
PESC_MALGO        -RQPRHVKRANKGSTAP-----TTFYYTKDIAYLQHEPVLQAFRDHKAFAKKVNR-AIAR
E3K873_PUCGT      -REPRSRKKANRGSTAA-----ASFYYQKDIAYLLHEPVLQKLREHKAFAKKLSR-ALGR
PESC_MONBE        -REPPNKKKVT-GSTAN-----RTYYFVKDINWLLHEPLLQRFRELKTYARRLKK-AEAK
D7TWJ6_VITVI      -REPKK-----KVKGNH-----HTYYHTKDIAFLQHEPLLEKFRNIRAYDKKVNK-AKAK
B9H456_POPTR      -REPKK-----KFKGNN-----HTYYHVKDVAFLQHEPLLDKFRDIRAYQKKIKK-AEAK
PESC_ARATH        -REPKK-----KIKGNH-----HTYYHVKDIAFLMHEPLLEKFREIKTYQKKVKK-AKAK
C5WNV4_SORBI      -RQPKK-----KVEGNH-----KTYYHTKDIAFLAHDPLIEKFREIKVHRRKVKK-AVAK
PESC_CHLRE        -REPKK-----KPKGAN-----KTYYHLKDINWLAHEPLLNTFRSIKAHDKKVRK-ARAK
D0NK35_PHYIT      -REPKK-----KPSGKD-----KTYYYLKDVMFLAHEPVLEKFREFKSFMKKVKK-AMGK
C4M0Q1_ENTHI      ----RLPSKGLNTLTQK-----KTYYHIDDIKPLVNDKVTLKIKQIRAFKKHIRK-LTAR
Q4UA76_THEAN      RDVARGGTLTSKGINRRRLKKDKIYYHINDIRNLASGELLPKFRDISSHLKKFKR-LVER
Q4N2W3_THEPA      RDVARGGTLTSKGINRRRLKKDKIYYHINDIRNLASGELLPKFRDISSHLKKFKR-LVER
A7ATP9_BABBO      RDLTSGYTLTSKGINRKKIKKDKIYYHINDVRYLAAGELLSKFRDISAHLKRYRR-LVAR
PESC_PLAF7        KDFKEIPLKYRKKFYKH-----KVFYTRNDFLKLSHEKIINDFRKIKIYLKKYKKCKLTL
PESC_PLAYO        KDYKDIPLKFRNKFYKN-----KVYYTRNDYKKLSNEKIIQDFRKIKTSLKRYKKYKITL
B3L4N0_PLAKH      KDFKEIPLKYRTKFYKQ-----KVYYSKNDFKKLAHEKIIQDFRKIQTCLKKYKKYKLAL
A5K4A1_PLAVS      KDFKEIPLKLRSKFYKQ-----KVYYSKNDFQKLAHEKIIQDFRKITTCLRKYKKYKVAL
A8BZA6_GIAIC      ------QVPPKKFAGDT------SYFLRKDIVHLFHDPIIPKIREIAAQLKRIKR-MKAR
A2DN41_TRIVA      -------KVSPKDKNSP-----WAYFHKKDLQMINSDPMAWFIRDHANWLKHHEK-----
                                           :   :   :    :   :        :        

PESC_LEIIN        GRSEDLKVLQSSR------VKPRHSLVATIKERYPYFIDAIRDVDDAMSMIHLYAFLSPE
PESC_LEIMA        GRSEDLKVLQTSR------VKPRHSLVATIKERYPYFIDAIRDVDDAMSMIHLYAFLSPE
PESC_LEIBR        GRADDLKALQSSR------VKPRHSLVATIKERYPYFIDAIRDVDDAMSMIHMYAFLSPE
Q38EE3_TRYB2      RLTEDLKVLHSNK------VKPKYSLVATIKERYPYFADAVRDIDDAMSMIALYAFLSPE
PESC_DICDI        KQFGALKNLKENR--------PMITLDHIIKERYPTFQDALKDLDDCLSLIHLFANMDAS
F0ZGY9_DICPU      KEVALLKKLRENR--------PMISLDHIVKERYPTFEDALKDLDDCLSLIFLFANMDAS
D3BB01_POLPP      KDWAALEQFIKNR--------PSSSIDHIVRERYPTFTDALKDLDDCLTLIHLFASMDSS
A0DEJ7_PARTE      GDKLKAGRLRRNQ--------PKDKLDHLVKERYPTFIDALNDLDDPLCLVSLFASFPTH
A0D1P2_PARTE      GDKLKAGRLRRNQ--------PKDKLDHLVKERYPTFIDALNDLDDPLCLVSLFASFPTH
Q23RV6_TETTS      GDKTRLRLLQKQK--------PTYSLNHLVKERYPTFIDALRDLDDPLCLVNLFASFPAH
Q5CXI7_CRYPI      NDKTKARSIRENK--------PIITLQHIVKERYPCFVDALRDLDDALSTCSLFASLGAD
PESC_HUMAN        SEWNTVERLKDNK--------PNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRT
I3MLZ5_ICTTR      SEWNTVERLKDNK--------PSYKLDHIIKERYPTFIDALRDLDDALCMCFLFSTFPRT
H0WSW0_OTOGA      SEWNTVERLKDNK--------PNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRT
G1LLM9_AILME      SEWNTVERLKDNK--------PNYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRT
PESC_MOUSE        SEWNAVERLKDNK--------PCYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRT
PESC_RAT          SEWNAVERLKDNK--------PSYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRT
PESC_DANRE        AEWSAVERLKENK--------PGYKLDHIIKERYPTFIDALRDVDDALSMCFLFSTFART
PESC_SALSA        AEWTGVERLRDNK--------PGYKLDHIIKERYPTFIDALRDIDDALSMCFLFSTFART
H3BC39_LATCH      SEWGSVDRLKENK--------PMYKLDHIIKERYPTFIDALRDLDDGLSMCFLFATFPRT
PESC_XENLA        REWDSVDRIRDNK--------PSYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRT
PESC_XENTR        REWDAVDRIRDNK--------PAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRT
F6Y1Q9_XENTR      REWDAVDRIRDNK--------PAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRT
PESC_NEMVE        EQPGTADRLEDNK--------PVYTLDHIVKERYPTFIDALRDLDDALSMLFLFSIMPQT
PESC_AEDAE        GNNLLKNVRMANY--------PEIKLDHIIKERFPTFIDAIKELDDCMTLLFLFSTFPAM
PESC_CULQU        GNNLLKNVRMANY--------PEIKLDHIIKERFPTFVDAIKELDDCMTLLFLFSTFPAM
PESC_ANOGA        QNMNLRDIRLHNY--------PQLKLDHIVKERYPTFIDAIKELDDCMTLLFMFSTFPAT
PESC_DROER        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROYA        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROSE        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROSI        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROME        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROAN        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROGR        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROVI        KDFRNLKRRLAMF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROMO        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROPE        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROPS        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
PESC_DROWI        KDFRNLKRRLALF--------PEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSL
E0VTT0_PEDHC      KEFAEMKAYLNKH--------PTITLDHLVKERYPTFIDALRDLDDCLTLCFLFSTFPSM
E9FYB2_DAPPU      GDKETVARLKDNK--------PSMKLDHLVKERYPTFLDALNDLDDCLTLCFFYSTLPRD
PESC_CAEBR        KEDEKIKKLYDNK--------PVYNLDTIVKERFPTFGSALRDMDDALSLCFTFAMLPHT
PESC_CAEEL        KEEDKLKKLYENK--------PVYSLDTIVKERFPTFGSALRDMDDALSLCFTFAMLPHT
PESC_BRUMA        RDEERIKTLYENR--------PEYQLDHIVKERYPTFESALRDLDDALCLLFAFAVLPHT
G4VRP5_SCHMA      KDKEKEFRVRINK--------PRYTLHQIVKERYPTRQDALRDISDSLNLLFLFEKLPKL
PESC_SCHPO        GELETAKRLEAR--------KPTYSLDHIIKERYPTFHDALKDIDDALSMLFLFSTMPVT
F4P5J1_BATDJ      REFVVAKRLYEN--------RPVYTLDHIIKERYPCFVDALRDLDDALSMIFLFATISAN
I1CDW4_RHIO9      GEFAAAKSLEENN-------KPVYSLDHIVKERYPSFIDALRDLDDALSMLFLFAMLPAD
PESC_COCIM        GDVGDAARLEKNN-------APKITLDHIVKERYPTFIDALRDLDDALSLLFLFANLPST
C0NUL9_AJECG      GEVGNAARLEKNN-------APKLSLDHIIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_ASPFU        GEVGDAARLEKNH-------APKLTLDHVIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_ASPFC        GEVGDAARLEKNH-------APKLTLDHVIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_NEOFI        GEVGDAARLEKNH-------APKLTLDHVIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_ASPCL        GEVGDAARLEKNH-------APKLTLDHVIKERYPTFIDALRDLDDALSLLFLFANLPSD
PESC_ASPOR        GEVSDAARLEKNH-------APQLTLDHIIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_ASPTN        GEVGDASRLEKNH-------APKLTLDHIIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_EMENI        GEVSDAARLEKNH-------APKLTLDHVIKERYPTFIDALRDLDDALSLLFLFANLPST
PESC_PHANO        GEAGDAARLEKNL-------MPKVKLDHIIKERYPTFVDALRDLDDALSMLFLFANLPSS
PESC_PYRTR        GESGDASRLEKNL-------MPKVKLDHIIKERYPTFVDALRDLDDALSMLFLFANLPSS
PESC_BOTFB        GDASDAARLERNASRPEKTGKTKYNLDHIIRERYPTFIDALRDLDDCLSMLFLFANLPST
PESC_SCLS1        GDAHDAARLERNASRPEKTGKTKYNLDHIIRERYPTFIDALRDLDDCLSMLFLFANLPST
PESC_CHAGB        GDVGDAARLERNAARPDKTGKPRYTLNHVIRERYPTFIDALRDLDDCLSMLFLFANLPST
PESC_NEUCR        GDVSDAARFERHAARPEATGKPRYTLNHVIRERYPTFNDALRDLDDCLSMLFLFANLPST
C7YII3_NECH7      GDVTDASRLEKNAARPEKTGKPRYTLDHVIRERYPTFVDALRDLDDCLSMLFLFANLPST
PESC_MAGO7        GDVSDAKRLEGNAARPENTGKPSYTLDHVVRERYPTFVDALRDLDDCLSMLFLFANLPAT
D5GH60_TUBMM      GDFSDAKRLETTQ-------KPVVRLDHIVKERYPTFTDALRDLDDALSMIHLFASLPTN
PESC_ASHGO        GEVSSAKKLEENK--------SHYKLDHIIKERYPSFADALRDLDDALNMLFLFANLPAT
PESC_KLULA        GEVSAAKRLEENR--------PNYQLDNIIKERYPSFADALRDVDDALNMLFLFANLPAT
PESC_YEAST        GEVSSAKRLEENR--------DSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPST
PESC_YEAS7        GEVSSAKRLEENR--------DSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPST
PESC_VANPO        GEVSSAKKLDENR--------TSYKLDHIIKERYPSFPDAVRDIDDALNMLFLFANLPAT
PESC_CANGA        GEVSSAKKLEENR--------STYKLDHIIKERYPSFPDAVRDIDDALNMLFLFANLPAT
PESC_CANAL        GEVSDAYKLDQHR--------PKYTLNHIIKERYPTFADALRDLDDPLNMLFLFANMPAT
PESC_LODEL        GEISSAAKLDANR--------PKYTLNHIIKERYPTFLDALRDLDDPLNMLFLFSNMPAI
PESC_DEBHA        GEVSDAQKLEGNR--------PKYTLEHIIKERYPTFLDALRDIDDPLNMLFLFANMPAT
PESC_PICST        GEVSDAQKLEANR--------PKYTLEHIIKERYPTFLDALRDIDDPLNMLFLFANMPAT
PESC_PICGU        GEVSDAARLESNR--------PKYSLDHVIKERYPTFLDALRDLDDPLNMLFLFANMPAT
PESC_YARLI        GDLHDAKRIDENR--------PRYHLDHIIKERYPTFMDALRDIDDALSMLFLFAALPAS
PESC_COPC7        GEWSAAKSLEENK--------PIYRLDHIIKERYPTFVDALRDIDDALCMVFLFATLPST
PESC_LACBS        GEWSSAKNLEENK--------PIYRLDHIIKERYPTFIDAVRDIDDALCMVFLFASLPTT
PESC_CRYNJ        QEWGLAKNLEDAK--------PVARLDHLVRERYPTFTLALQDLQDPLNLVHLFSTLPTN
PESC_MALGO        REWHAAKNLDENR--------PKYRLDHIIKERYPTFVDSLRDLDDALSTLFLFANIPSQ
E3K873_PUCGT      KEDGLAKNLDSAH--------DGYRIDHIIKERYPVFTDAIRDLDDALSLIILFANLPST
PESC_MONBE        DQPGVVKAIRRRE--------PKVKVNHLVKERYPSFVDAIRDLDDCLCMLFLFASFPQT
D7TWJ6_VITVI      KNRDLAERLLTRR--------PNYTLDRLIRERYPKFTDALRDLDDCLTMVHLFASLPAL
B9H456_POPTR      KNADLATLLRTRE--------PTYKLDRLVRERFPKFVDALRDLDDCLTMVHLFAALPAV
PESC_ARATH        KNEELARLLLTRQ--------PTYKLDRLIRERYPTFIDALRDLDDCLTMVHLFAVLPAS
C5WNV4_SORBI      KNRDLADRLLNRP--------PTYKLDRLVLERYPTFVDALRDLDDCLTMVHLFAALPAV
PESC_CHLRE        QNKELAKRLAALT--------PTYRLDHLVKERYPSFVDALRDLDDSLTMVHLFATLPAE
D0NK35_PHYIT      KDYEDAKRKHENR--------PTYELDHIVKERYPRFVDALGDLDDALCLVHLFALMPT-
C4M0Q1_ENTHI      KEFKTKEQLLKTK--------PVIDLASTIQERYPTFQDALNELGDCLSMVFMFASYRVS
Q4UA76_THEAN      GEKFDAKLKAKNR--------PRYSLAPIVKERCPSLVSALEDLDDAISTIAAVSGIPPN
Q4N2W3_THEPA      GEKFDAKLKAQTR--------PRYSLAPIVKERCPSLVSALEDLDDAISTIAAVSG----
A7ATP9_BABBO      EEFLDAKLAKKRT--------PRYSLKEIVKERCPALVNAVADLDDAVSTIAAVAA----
PESC_PLAF7        EDFTRSKNIVANF--------PVYKLEHIIKERYPILSYAVDHLDDALSCIIAYSQLPSN
PESC_PLAYO        EDNERCKNIIKNF--------PKYKLDHIIKERFPILVYAVEQLNDALTAIIAYSFLPSN
B3L4N0_PLAKH      EDEEKCKSLIKNF--------PKYTLDHIIKERFPVFSYAIEDLDDALSAIVAYSLLPSN
A5K4A1_PLAVS      EDEERCKNLIKNF--------PKYTLDHIIKERFPIFSYAIEELDDALSAVVAYSLLPSN
A8BZA6_GIAIC      ANVLEAKLLQAQM--------PIISLDHVVLERYPTFKDALSDFDDALCLLFMFSRLSSE
A2DN41_TRIVA      --RYNRKELDQTP-------EPVAPYDQLIRSRYPTFADAIKDLDDALTTVALFAQMSGS
                                               : .* *    :: .. * :            

PESC_LEIIN        IKSDT---------TIEIHHSLTSGMSEKAKEVCERWDRYVARARVLTKGFISIKGYYYE
PESC_LEIMA        IKSDT---------TIEIHHSLTSGLSERAKEVCERWDRYVARARVLTKGFISIKGYYYE
PESC_LEIBR        IKSES---------TIEIHHSLTSGLSEKAKEMCHRWNRYIARAHVLTKGFISIKGYYYE
Q38EE3_TRYB2      VASES---------TIETHHTLTSGLHRRARETCERWNSYVERAQALSKGFISIKGYYFE
PESC_DICDI        AK-------------------VRENQILACERLAREFQYYIIQSKSLRKVFVSVKGVYYQ
F0ZGY9_DICPU      PK-------------------IRENQIRACEKLAREFQYYVAKSNSLKKVFVSVKGIYYQ
D3BB01_POLPP      PK-------------------LRENHIVTCADLCREFQHYVTVSKSLKKVFVSIKGIYYQ
A0DEJ7_PARTE      KEL-----------------HIPNTLIRGCQKLLSQFLLYVSANNCLRKVFLSIKGIYYQ
A0D1P2_PARTE      KEL-----------------HIPNTLIRSCQKLINQFFLYVSAHNCLRKVFLSIKGIYYQ
Q23RV6_TETTS      KAL-----------------GVPRDSITKCIKLMREFNLFVIKSKSLRKVFISIKGIYYQ
Q5CXI7_CRYPI      DNY-----------------SIRSNMIKKSTYLIDEFMYLVSELGFLTKSFISIKGFYFQ
PESC_HUMAN        -------------------GKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQ
I3MLZ5_ICTTR      -------------------GKCHVQTIQLCRRLTVEFLHYIITARALRKVFLSIKGIYYQ
H0WSW0_OTOGA      -------------------GKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQ
G1LLM9_AILME      -------------------GKCHVHTIQLCRRLSVEFLHYVIAARALRKVFLSIKGIYYQ
PESC_MOUSE        -------------------GKCHVQTIQLCRRLTVEFLHYVITARALRKVFLSIKGIYYQ
PESC_RAT          -------------------GKCHVQTIQLCRRLTVEFMHYVIAARALRKVFLSIKGIYYQ
PESC_DANRE        -------------------GKCHVQTIQLCRRLSVEWMNYIISSRSLRKVFLSIKGIYYQ
PESC_SALSA        -------------------GKCHVQTITLCRRLTVEWMNYVVTSRSLRKVFLSIKGIYYQ
H3BC39_LATCH      -------------------GKCHVQTIQLCRRLTIEFMNYIIASRSLRKVFLSIKGIYYQ
PESC_XENLA        -------------------GKCHVQTIQLCRRLSVEFLNYVIDSRSLRKVFLSIKGIYYQ
PESC_XENTR        -------------------GKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQ
F6Y1Q9_XENTR      -------------------GKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQ
PESC_NEMVE        -------------------DKIQAAVVQDCRRLSVEFQHYIISSRSLRKVFFSIKGIYFQ
PESC_AEDAE        -------------------KVVTREITSLARRLTIEFMHYVIAAKALRKVFVSIKGYYFQ
PESC_CULQU        -------------------KTVTRDITSMARRLSIEFMHYCIASKALRKVFVSIKGYYFQ
PESC_ANOGA        -------------------KIITRELTRMSRRLTVEFMHYVIAAQALRKVFISIKGYYFQ
PESC_DROER        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROYA        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROSE        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROSI        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROME        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROAN        -------------------HLIPREQSNLCRRLTVEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROGR        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROVI        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROMO        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROPE        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROPS        -------------------HLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
PESC_DROWI        -------------------HLIPREQSALCRRLTIEFLHYVIASKSLRKVFISIKGYYFQ
E0VTT0_PEDHC      -------------------KHVPRDQSALCRRLTIEFMHAVIEAKALRKVFVSIKGYYYQ
E9FYB2_DAPPU      -------------------TKVPANLISLCRRLTVEFLHYVIAAKALRKVFISVKGIYYQ
PESC_CAEBR        -------------------RVLKEGMIDSCRKLTAEFMHYVIESQSLRNTFISIKGIYYQ
PESC_CAEEL        -------------------RVLKEGMIDSCRKLTAEFMHYVIESQSLRNTFISIKGIYYQ
PESC_BRUMA        -------------------KIITSSLVASSRRLTAEFNHYIIESNSLNKVFVSIKGIYYE
G4VRP5_SCHMA      -------------------TQFHPSLISISRRLCVEFLNLVVATQAVRKAFISIKGFYVQ
PESC_SCHPO        -------------------DKIGAATVANCERLCAEFQHYVIRSNSLRKAFLSIKGIYYQ
F4P5J1_BATDJ      -------------------QHISAAHIRECQRLSAEFQHYVIISRSLKKTFVSIKGIYYQ
I1CDW4_RHIO9      -------------------NKIKASIVADCQQLIAEFQAYVVKSKSLRRVFFSIKGIYYQ
PESC_COCIM        -------------------ANVPPKTIALCQRLCHEFQHYLIATNSLRKSFLSIKGIYYQ
C0NUL9_AJECG      -------------------TSVPSKTITLCQRLCHEFQHYLIATNSLRKSFLSIKGIYYQ
PESC_ASPFU        -------------------AHVPPKTIALCQRLCHEFQHYLITTNSLRKSFLSIKGIYYQ
PESC_ASPFC        -------------------AHVPPKTIALCQRLCHEFQHYLITTNSLRKSFLSIKGIYYQ
PESC_NEOFI        -------------------AHVPPKTIALCQRLCHEFQHYLITTNSLRKSFLSIKGIYYQ
PESC_ASPCL        -------------------AHVPPKTIALCQRLCHEFQHYLITTNSLRKSFLSIKGIYYQ
PESC_ASPOR        -------------------AHVPPKTIALCQRLCHEFQHYLIVTNSLRKSFLSIKGIYYQ
PESC_ASPTN        -------------------SHVPPKTIALCQRLCHEFQHYLITTNSLRKSFLSIKGIYYQ
PESC_EMENI        -------------------SHVPPKTIALCQRVTHEFQHYLITTNSLRKSFLSIKGIYYQ
PESC_PHANO        -------------------DHIPAKTIALCQRLTREFEHYVITSHALRKSFLSIKGIYYQ
PESC_PYRTR        -------------------DHIPAKTIALCQRLTREFEHYVITSHSLRKSFLSIKGIYYQ
PESC_BOTFB        -------------------STVPAKMIARCEKLCLEFEHYLIVSNSLRKSFLSIKGIYYQ
PESC_SCLS1        -------------------STVPAKMIARCEKLCLEFEHYLIVSNSLRKSFLSIKGIYYQ
PESC_CHAGB        -------------------TAVPAKMIARCERLCLEFEHYLITSHSLRKSFLSIKGIYYQ
PESC_NEUCR        -------------------SAVPAKMIARCERLCLEFQHYLIVSHSLRKSFLSIKGIYYQ
C7YII3_NECH7      -------------------SSVPAKMVARCERLCLEFQHYLIVSQSVTKSFLSIKGIYYQ
PESC_MAGO7        -------------------SSVPAKMIARCERLCLEFQHYLIVSHSLQKSFLSIKGIYYQ
D5GH60_TUBMM      -------------------ENLPPATVVNCARLTKEWAHYVIRAGALRKSFLSIKGIYYQ
PESC_ASHGO        -------------------DQVSTRVTKDAQELCNQWLALIARERLVRKVFVSIKGVYYQ
PESC_KLULA        -------------------DQVSSRITQSAQQMCDQWSAYIAKERCVRKVFVSIKGVYYQ
PESC_YEAST        -------------------NQVSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQ
PESC_YEAS7        -------------------NQVSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQ
PESC_VANPO        -------------------DQVSSKITKDANEICNQWLAYVARERLVRKVFVSIKGVYYQ
PESC_CANGA        -------------------NQISSRVIRDAQVICNQWLAYVAKERLIRKVFVSIKGIYYQ
PESC_CANAL        -------------------DKVSAKVVSEAEKLCNQWLAYVAKERCLKKVFVSIKGVYYQ
PESC_LODEL        -------------------DKVSTKIIADAEKLCNYWLAYVSKERLLKKMFVSIKGVYYQ
PESC_DEBHA        -------------------DKVSHRITKEAEKLTNQWLAYVAKERLIKKVFVSIKGVYYQ
PESC_PICST        -------------------DKVSHRVTKEAEKLTNQWLAYVAKERLIKKVFVSIKGVYYQ
PESC_PICGU        -------------------DKVSHRITKDAEKLCNQWLAYVAKERLIKKVFVSIKGVYYQ
PESC_YARLI        -------------------DDVSARLVSEAEAICTQWMAFVARERLVRKVFVSIKGVYYS
PESC_COPC7        -------------------ARLPREIIDNCARLSMQWQLYVMHTNSLRKVFLSIKGVYYQ
PESC_LACBS        -------------------TRLPPELMENCSRLAAEWQLYIMRSQSLRKVFLSIKGVYYQ
PESC_CRYNJ        PIPG--------------KTLVPSEVIAECSRLISEWKLWAIRTHSLRKMFLGIKGVYYE
PESC_MALGO        -------------------KSMAPEITAHCARLCAEWQLYVMRTHCLSKVFLSIKGIYFQ
E3K873_PUCGT      -------------------NHVSPKVIANCARLAAEWQIYVMKSRSLKHVFLSIKGIYYQ
PESC_MONBE        -------------------GVIRARMVEKCRRLCNEFMLYVVRARALRKVFLSIKGIYYQ
D7TWJ6_VITVI      E-----------------SEKIQVKRIHNCRRLSHEWQAYICRTHKLRKTFISVKGIYYQ
B9H456_POPTR      E-----------------RAKIDVELIHNCRRLSHEWQAYVSRTYKLRKVFISVKGIYYQ
PESC_ARATH        D-----------------RENLEVKRVHNCRRLTHEWQAYISRSHALRKVFVSVKGIYYQ
C5WNV4_SORBI      D-----------------GERVEVKRIHNCRRLSHEWQAYISRTHSLRKTFISVKGIYFQ
PESC_CHLRE        S-----------------KYDIPQRTVQLCRRLALEWQAYVVRSGALRRVFVSVKGYYFQ
D0NK35_PHYIT      ------------------GNGVHAQVTSMCLRLVREWQNYVVATRALTKVFVSIKGIYYQ
C4M0Q1_ENTHI      -------------------KGEKAEAVRLARRIAMEWEAYIKHTNALRKCFISYKGYFYT
Q4UA76_THEAN      LFIRKRILILFIGLSGDESRGLNPTLVSKCSTQLNHFLKYVADTGCLKKTFISIKGFYFQ
Q4N2W3_THEPA      -------------LSGDESRGLNPTLVSKCSTHLSHFLKYVADTGCLKKTFISIKGFYFQ
A7ATP9_BABBO      -------------LPADSKRGVDPKLTAACHLHLQHFLKYVSETRCLKKTFISIKGFYFQ
PESC_PLAF7        HK-----------------YGIKNNMVKTCEMLKDHFHYYVYKTNRIKKAFISVKGYYLQ
PESC_PLAYO        EN-----------------IGIKNNLINQSIILRNH-----------------VKGYYLQ
B3L4N0_PLAKH      EK-----------------VGIQNRFVTNCEVIKNHFHYYAYKTNRIKKAFITVKGYYLQ
A5K4A1_PLAVS      EK-----------------LGILNRFVTNCEKIKNHFHYYVYKTNRIKKGFISVKGYYLQ
A8BZA6_GIAIC      --------------------HAPQKIIDNCKRLCREWDAFIAATGCLVRAFVSTKGYYYQ
A2DN41_TRIVA      -------------------DILDSARVLKCRHLLAEFHYYVSHKHLLTKGFISKRGFHFE
                                               .                        :* .  

PESC_LEIIN        AIVKG-----ERVRWLCPHEYAH--RFPPGIQQYVMLSFLEFYLE--MMKFVLFKLESDL
PESC_LEIMA        AIVKG-----ERVRWLCPHEYAH--RFPPGIQQYVMLSFLEFYLE--MMKFVLFKLESDL
PESC_LEIBR        AIIKG-----ERVRWLCPHEYAH--RFPPGIQQYVMLSFLEFYLE--MMKFVLFKLESDL
Q38EE3_TRYB2      AIVRG-----ERVRWLCPHEYAH--KFPAGVQQYIMISFLEFYLE--LMRFVLFKLERDL
PESC_DICDI        ADVMG-----ETITWITPLNYLS--KKEKEVDYGVMISFLEFYQA--LMKFVNYRLFTSI
F0ZGY9_DICPU      AEIMG-----ETITWITPLNYLS--KKEKQVDYGVMISFIEFYQA--LMKFVNYRLFSSL
D3BB01_POLPP      AEIMG-----ETITWLTPINYIN--KKEKKVDYGVMINFLEFYEV--MLKFVNYKLYTSL
A0DEJ7_PARTE      AVVQG-----ATITWIMPYPIQA--SLPLDVDYKIMMTFLEFYQV--LMKFVNFKLLG--
A0D1P2_PARTE      AVVQG-----ATITWIMPYPIQA--SLPLDVDYKIMMTFLEFYQV--LMKFVNFKLLG--
Q23RV6_TETTS      AEIEG-----QKITWIAPFQLPA--ELPAEVDYKVMLTFLEFYET--LIKFVNFKLFNSI
Q5CXI7_CRYPI      AKILG-----ETITWLVPHQFAQ--SIPDEVDFKVLSTFLEFYHS--LLKFVNFKLYQ--
PESC_HUMAN        AEVLG-----QPIVWITPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQLL
I3MLZ5_ICTTR      AEVLG-----QPIVWITPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQSL
H0WSW0_OTOGA      AEVLG-----QPIVWITPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQSL
G1LLM9_AILME      AEVLG-----QPIVWITPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQSL
PESC_MOUSE        AEVLG-----QPIVWIAPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQSL
PESC_RAT          AEVLG-----QPIVWIAPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQSL
PESC_DANRE        AEVLG-----QTITWIVPYQFAH--NHPTDVDYRVMATFTELYTT--LLGFVNFRLYQTL
PESC_SALSA        AEVLG-----QLITWLVPYQFAH--DHPTDVDYRVMATFTEMYTT--LFGFINFRLYQTL
H3BC39_LATCH      AEVLG-----HPVTWIVPYSFAH--NHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQSL
PESC_XENLA        ADILG-----QTLTWITPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFHLYQTL
PESC_XENTR        ADILG-----QTVTWITPYAFSH--DHPTDVDYRVMATFTEFYTT--LLGFVNFRLYQTL
F6Y1Q9_XENTR      ADILG-----QTVTWITPYAFSH--DKIRGILFHVFTRASIFFLSAFILGKVHKVILATI
PESC_NEMVE        AEIQG-----QTITWITPYQFCQ--DPPTDVDFRVMLTFVDFYKT--MMGFINFKLYNNL
PESC_AEDAE        AEIKG-----ELVTWIVPHYYPFQPQRKEYVDFKIMKSFADFFTV--MAGFVNYRLYNSI
PESC_CULQU        AEIKG-----ELVTWIVPHYYPYQPQRKEYVDFKIMKSFADFFTV--MAGFVNFRLYNSI
PESC_ANOGA        AEIKG-----ETVTWIVPHYFPYSPHRGEMVDLSIMKSFGDFFTV--MAGFINYRLYHSI
PESC_DROER        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLFHGL
PESC_DROYA        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLFHGL
PESC_DROSE        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLFHGL
PESC_DROSI        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLFHGL
PESC_DROME        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLFHGL
PESC_DROAN        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLFHGL
PESC_DROGR        AEIKG-----QKINWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLYHGL
PESC_DROVI        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNFRLYHGL
PESC_DROMO        AEIKG-----QKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTI--MLGFTNYRLYHGL
PESC_DROPE        AEIKG-----QKVTWIMPHYYPFKPQSRQEVDFKVMSIFVEFYTI--LQGFTNFRLFHGL
PESC_DROPS        AEIKG-----QKVTWIMPHYYPFKPQSRQEVDFKVMSIFVEFYTI--LQGFTNFRLFHGL
PESC_DROWI        AEIKG-----QKVTWIVPHYYPFKPQSRQDVDFKVMSIFVEFYTI--MLGFVNFRLFHGL
E0VTT0_PEDHC      IEFKG-----ETITWITPHNFCFQPQNKEDVDFKIMSIFVQFYVV--LLGFVNFHMYHSL
E9FYB2_DAPPU      VEIKG-----QPVTILINHLRGFKPTTASDVDYRIMTNFVDFYTS--MLGFINFRLYHSI
PESC_CAEBR        AEVHG-----EKITWVVPHERGL--PHVTDVDFTVLVTFVEFYIA--MLGFVNFKLYQDI
PESC_CAEEL        AEVHG-----EKITWVVPHERGL--PHVTDVDFTVLVTFVEFYIA--MLGFVNFKLYQDI
PESC_BRUMA        AEVMG-----ERVTWIVGHDRGM--GHVSEVDFSVMATFAEFYVT--MLEFVNFRLYQSV
G4VRP5_SCHMA      AEIDG-----IPVVWIMPHASVT--HTPTDVDYRILATCLEFDAT--LIGSLMCHLYRIN
PESC_SCHPO        AEIFG-----EQITWIVPYKFAQ--SVPTDVDFRIMHTFLEFYQA--LMGFVNFKLYNTL
F4P5J1_BATDJ      AEIRG-----QLITWITPFQFSQ--DAPIDVDFRVMDTFLEIYEP--LVGFVNYKLYSDL
I1CDW4_RHIO9      AEIKG-----QTITWVVPYQFSQ--NIPTDVDFRVMLTFLEFYRT--LVGFVNFKLYTEL
PESC_COCIM        ATIQG-----QDILWLVPYRFVQ--QVTGDVDYRIMATFVEFYTT--LLGFVNFRLYTSI
C0NUL9_AJECG      ATILG-----QDIMWLVPYRFVQ--RVTGDVDYRIMGTFVEFYTT--LLGFVNYKLYTSI
PESC_ASPFU        ATIQG-----QDILWLVPYRFVQ--RVNGDVDYRIMATFVDFYTT--LLGFVNFRLYSSI
PESC_ASPFC        ATIQG-----QDILWLVPYRFVQ--RVNGDVDYRIMATFVDFYTT--LLGFVNFRLYSSI
PESC_NEOFI        ATIQG-----QDIMWLVPYRFVQ--RVNGDVDYRIMATFVDFYTT--LLGFVNFRLYSSI
PESC_ASPCL        ATIQG-----QDIMWLVPYRFVQ--RVNGDVDYRIMATFVDFYTT--LLGFVNFRLYSSI
PESC_ASPOR        ATIQG-----QDIMWLVPYRFVQ--RVNGDVDYRIMATFVDFYTT--LLGFVNFRLYSTL
PESC_ASPTN        ATIQG-----QDIMWLVPYRFVQ--RVNGDVDYRIMATFVEFYTT--LLGFVNFRLYSSI
PESC_EMENI        ATIQG-----QDIMWLVPYRFVQ--RVNGDVDYRIMATFVEFYTT--LLGFVNYRLYSSI
PESC_PHANO        ATIQG-----QDILWLVPYRFVQ--RTGGDIDFRIMGTFVEFYTT--LLGFVNYRLYTSV
PESC_PYRTR        ATIQG-----QDILWLVPYRFVQ--RTGGDIDFRIMGTFVEFYTT--LLGFVNYRLYTSI
PESC_BOTFB        ATIQG-----QDILWLVPYRFNQ--RVTGDVDFRIMGTFVEFYQT--LLGFVNFRLYTSV
PESC_SCLS1        ATIQG-----QDILWLVPYRFNQ--RVTGDVDFRIMGTFVEFYQT--LLGFVNFRLYTSV
PESC_CHAGB        ASIQG-----EDILWLVPYKFNQ--RVVGDVDFRIMGTFVEFYMT--LLGFVNYRLYTAV
PESC_NEUCR        ANIQG-----EDILWLVPYKFNQ--RIVGDVDFRIMGTFVEFYMT--LLGFVNYRLYSSI
C7YII3_NECH7      ANIQG-----EDVLWLVPYKFNQ--RVVGDVDFRIMGTFIEFYMT--LLGFINFRLYTSL
PESC_MAGO7        ANIQG-----EDILWLVPYKFNQ--RVVGDIDFRIMGTFIEFYMT--LLGFVNFRLYTSI
D5GH60_TUBMM      AEVGGG----QEVLWLVPYSFAQ--DVPIDVDFRIMHTFVEFYTT--LVGFALFRLYAIE
PESC_ASHGO        ANVRG-----EEVRWLVPYKFPE--NIPSDVDFRIMLTFLEFYST--LLHFVLYKLYTDN
PESC_KLULA        ASVKG-----EDVRWLVPYKFPE--NIPSDVDFRIMLTFLEFYST--LLHFVLFKLYTDA
PESC_YEAST        ANIKG-----EEVRWLVPFKFPE--NIPSDVDFRIMLTFLEFYST--LLHFVLYKLYTDS
PESC_YEAS7        ANIKG-----EEVRWLVPFKFPE--NIPSDVDFRIMLTFLEFYST--LLHFVLYKLYTDS
PESC_VANPO        ASIRG-----EDVRWLVPFKFPE--NIPSDIDFRIMLTFLEFYST--LLHFVLYKLYTDS
PESC_CANGA        ANVKG-----EEVRWVIPFKFPE--NIPSDIDFRIMMTFLEFYST--LLHFVLFKLYTDS
PESC_CANAL        ATVKG-----QEIRWLIPYKFPT--NIPTDVDFRIMLTFLEFYST--LVHFVLYKLYNEA
PESC_LODEL        ATIKG-----QEVRWLIPYKFPT--NIPTDVDFRIMLTFLEFYST--LLNFVLYKLYNES
PESC_DEBHA        ANVKG-----QEVRWLVPFKFPT--NIPTDVDFRIMLTFLEFYST--LLHFVLFRLYNDA
PESC_PICST        ANVKG-----QEIRWLVPFKFPT--NIPTDVDFRIMLTFLEFYST--LLHFVLYRLYNDS
PESC_PICGU        ANVMG-----QEVRWLVPYKFPT--NIPSDVDFRIMMTFLEFYST--LLHFVLYKLYNNA
PESC_YARLI        ANIRG-----VEVMWLVPFRFPQ--NIPADIDFRVMLTFLEFYTT--LLHFVLYKLYNEN
PESC_COPC7        AEVMDQ-----TITWLVPYQFTQ--NIPTDVDVRVMLTFLELYQT--LLGFVFFKLYSDA
PESC_LACBS        AEIMDQ-----TVTWLVPYQFTQ--NIPADVDVRVMLTFLELYQT--LLGFILFKLYTDA
PESC_CRYNJ        CEVPGQGGEPVRVRWLEGFEFQQ--HVPHDVDFRILLTFLDLYRT--MVGFVLFKLYTDE
PESC_MALGO        AVVHGQ-----EITWLVPYMFTQ--TIPTDVDFRVMMTFLELYQT--LMGFVLFKLYTDE
E3K873_PUCGT      AEIEGQ-----RVTWLVPYAFTQ--TIPADVDFRIMLTFLELYQT--LLGFVFYRLFQNI
PESC_MONBE        AEIMG-----QTVTWIAPYQFAT--DVPTDVDFRVMGTFLQFYLT--LLGFVNFKLYATL
D7TWJ6_VITVI      AEVEG-----QKITWLTPHTLQQ--VLTDDVDFNVMLTFLEFYET--LLAFVNFRLYHSI
B9H456_POPTR      AEIEG-----QKITWLTPHAMQQ--VLPDDVNFSVMLTFLEFYET--LLGFVNFRLYHSI
PESC_ARATH        AEIEG-----QKITWLTPHAIQQ--VFTNDVDFGVLLTFLEFYET--LLAFINFKLYHSL
C5WNV4_SORBI      AEVQG-----QKITWLTPHALQQ--VLTDDVDFNVMLSFLEFYET--LLGFVNFKLYHSI
PESC_CHLRE        AEILG-----QSVTWLVPHALSQ--VLPPDVDYKVMLTFLEFYNT--LLQFVNFKLYHNL
D0NK35_PHYIT      ANVQG-----QTITWLVPHQFTP--TVDKRVDVRVMLTFLEFYEV--LLKFVNAQLYMQI
C4M0Q1_ENTHI      AVVYG-----IAITWMVPHQFAIE--KNETVDFNVLHEFLSFYVV--LMKFINYKLYTNA
Q4UA76_THEAN      AVILN-----VTVTWIQPHSFSQ--KLPYEVDFNVISTFVEYYLE--LVKLVNYKLYLMA
Q4N2W3_THEPA      AVILN-----VTVTWIQPHSFSQ--KLPYEVDFNVISTFVEYYLE--LVKLVNYKLYLMS
A7ATP9_BABBO      AEILG-----ETVTWILPHCFSQ--TLPEEVDFKVISTFVEYYIE--LIKLANFKLYAMA
PESC_PLAF7        AEILK-----KKVTWIIPHIFTP--YLDTSIDFKLISDFIEYYIA--LLKFVLFKLYKLD
PESC_PLAYO        AEILQ-----KKITWLIPHIFTP--YFDKSIDFKIITNFIEYYVT--LLRFILYKLYRLD
B3L4N0_PLAKH      AEILQ-----KKVTWVIPHTFTP--YLEKTIDFSIITTFIEYYIC--LLKFVLFKLYKMH
A5K4A1_PLAVS      AEILQ-----KKVTWLIPHTFTP--YLDKSIDFSLITTFIEYYIC--LLKFVLFKLYKMH
A8BZA6_GIAIC      AVVQG-----VKVTWLVPHRFQL--DVPDVVDFKVLKSFVEFYQT--FAGFVLYRLYSVL
A2DN41_TRIVA      AQIEG-----LPVVWLIPHQFTLS--KDPDVDYTVLLNFLELYEN--LLSFVNLRLFKLI
                    .         :  :              :   ::           :       :    

PESC_LEIIN        --------------ARDEADRLAAEDEEGVTRANAEDFANGGAL----------------
PESC_LEIMA        --------------ARDEADRLAAEDEEGVTRANAEDFANGAAL----------------
PESC_LEIBR        --------------ARDEADRLAIEDEEGLTRANAEDFASGAAL----------------
Q38EE3_TRYB2      --------------AEKQK----AEEEE--PNLNAENFDTTNKE----------------
PESC_DICDI        --------------GLTYPPTIDDAKLRKCDSLINIFES-KPQQQTK-------------
F0ZGY9_DICPU      --------------DLEYPPKIDEIKLGKAEGLFNIFDSLKTKTAIN-------------
D3BB01_POLPP      --------------GLKYPPTIDKSRLNNGEHLSSILTEKLNKTSTT-------------
A0DEJ7_PARTE      ----------------------------------------QDIEITD-------------
A0D1P2_PARTE      ----------------------------------------QEIEITD-------------
Q23RV6_TETTS      --------------NVKYPLEINK--------------SIEDQSYFS-------------
Q5CXI7_CRYPI      ------------------------------------------LNNLT-------------
PESC_HUMAN        --------------NLHYPPKLEGQAQAEAKAG-EGTYALDSES----------------
I3MLZ5_ICTTR      --------------NLHYPPKLEGQAQAEMKDS-EGVYALDSES----------------
H0WSW0_OTOGA      --------------NLHYPPKLEDQVEAKVKDS-EGTYALDSES----------------
G1LLM9_AILME      --------------NLHYPPKLEGQAHTEAKAS-EDTYALDSES----------------
PESC_MOUSE        --------------NLHYPPKLEGQAQAETKIS-EDTYALDSES----------------
PESC_RAT          --------------NLHYPPKIESQAQAEMKVS-EDTYALDSES----------------
PESC_DANRE        --------------NLVYPPKLDGQGEISLKAEFEEDYALESES----------------
PESC_SALSA        --------------NLVYPPKLDSKAESELKAEHEEDYAMDSES----------------
H3BC39_LATCH      --------------NLVYPPKLEGKMEMELKIKDEGKYAMDSES----------------
PESC_XENLA        --------------NLQYPPKLDSFSEVDLKSDGEDKYALETEV----------------
PESC_XENTR        --------------NLQYPPKLDYFSEADLKSDNEDKYALETEA----------------
F6Y1Q9_XENTR      --------------NSPYVSFLKGMVQADLKSDNEDKYALETEA----------------
PESC_NEMVE        --------------NMHYPPVLADKTDKKLDTN----YCKDTEV----------------
PESC_AEDAE        --------------NMVYPPQFSVSI--DSDESRNNEETFVSE-----------------
PESC_CULQU        --------------NLVYPPQFSVSL--DSEESRSNEDTFISE-----------------
PESC_ANOGA        --------------NLVYPPQFAHSL--DSDETMGNEQKFVSE-----------------
PESC_DROER        --------------NLAYPPQFPSSVLQDSEESLKDEASFVSD-----------------
PESC_DROYA        --------------NLAYPPQFPSSVLQDSEESLKDEASFVSD-----------------
PESC_DROSE        --------------NLAYPPQFPSSVLQDSEESLKDEASFVSD-----------------
PESC_DROSI        --------------NLAYPPQFPSSVLQDSEESLKDEASFVSD-----------------
PESC_DROME        --------------NLAYPPQFPSSVLQDSEESLKDEASFVSD-----------------
PESC_DROAN        --------------NLAYPPQFPTNMLQDNEDTFKDESSFVSD-----------------
PESC_DROGR        --------------NLAYPPQFPSGVLQDNDETLKDESSFVSE-----------------
PESC_DROVI        --------------NLAYPPQFPSNMLQDNADTLKDESSFVSD-----------------
PESC_DROMO        --------------NLAYPPQFPSSMLQDNEETLKDETSFVSE-----------------
PESC_DROPE        --------------NLAYPPQFPSSLLQDNEDTFKDEASFVSD-----------------
PESC_DROPS        --------------NLAYPPQFPSSLLQDNEDTFKDEASFVSD-----------------
PESC_DROWI        --------------NLAYPPQFPSSVLQDNSETLQDESSFVSD-----------------
E0VTT0_PEDHC      --------------NLMYPPKLSGYEINKDENEMLDDENFISE-----------------
E9FYB2_DAPPU      --------------NLQYPPKLPGININENATD-EDAVEEYNE-----------------
PESC_CAEBR        --------------GLFYPPQIGQVVEGDEM-----ESEEYKE-----------------
PESC_CAEEL        --------------GLFYPPQIGQVVKTDEM-----ETEEYKE-----------------
PESC_BRUMA        --------------GLFYPPKLAFKSDKLED-----DDQAEEG-----------------
G4VRP5_SCHMA      --------------NLVYPPKLAVRVEHDPNGYYCGQKESLFE-----------------
PESC_SCHPO        --------------GLRYPPKIDVAKSESAAGLAAYELEESSS---------------LP
F4P5J1_BATDJ      --------------NLVYPPKISTDSETSAIGLSAFIIESRENE----------DVVQSV
I1CDW4_RHIO9      --------------NMTYPPKVDET--------GGFHLDEHMP-----------------
PESC_COCIM        --------------GLVYPPKFDSRSDERGAELAAFTLEGRKVG-----------EMQKA
C0NUL9_AJECG      --------------GLVYPPKFDKSSDERGAELAAFTLEGRYFG-----------EAHKA
PESC_ASPFU        --------------GLRYPPKFDTRSDENGAELAAFTLEGRGVG-----------DAPKA
PESC_ASPFC        --------------GLRYPPKFDTRSDENGAELAAFTLEGRGVG-----------DAPKA
PESC_NEOFI        --------------GLRYPPKFDTRSDENGAELAAFTLEGRGVG-----------DAPKA
PESC_ASPCL        --------------GLRYPPKFDTRSDENGAELAAFTLEGRAVG-----------DVPKA
PESC_ASPOR        --------------GLRYPPKFDTRSDENGAELAAFTLEGRAVG-----------ETTKA
PESC_ASPTN        --------------GLRYPPKFDTRSDENGAELAAFTLEGRAVA-----------NAAKT
PESC_EMENI        --------------GLRYPPKFDTRLDENGAELAAFTLEGRTVG-----------DAPKA
PESC_PHANO        --------------GLVYPPKFNAKSDEQGGELAAFQLEGK--A-----------NATNG
PESC_PYRTR        --------------GLVYPPKFNARSDEQGGELAAFQLEGK--A-----------TATNG
PESC_BOTFB        --------------GLVYPPKFDAARDDQDAGLGAFSLEGNGIG-----------AIEQP
PESC_SCLS1        --------------GLVYPPKFDKARDDQDAGLGAFSLEGNGIG-----------AIEQP
PESC_CHAGB        --------------GLKYPPKFDQLKDDQGAELGAFALEGVNIA-----------TNDDT
PESC_NEUCR        --------------GLKYPPKFDQLKDENGAELGAFSLEGVNMA-----------TQGET
C7YII3_NECH7      --------------GLKYPPKFDQVMDENAAELGAFTLEGKALV-----------GAEEH
PESC_MAGO7        --------------GLKYPPKFDATKDDKAADLAAFTLEGAGLT-----------SNGAQ
D5GH60_TUBMM      --------------GLVYPPRFDKDMDENA------------------------------
PESC_ASHGO        --------------GLVYPPKLDIKKNKLIGGISAYILESKDA-------------PFLS
PESC_KLULA        --------------GLVYPPKLDIKKNKLIGGLSAYILESNDE-------------KSSL
PESC_YEAST        --------------GLIYPPKLDLKKDKIISGLSSYILESRQE-------------DSLL
PESC_YEAS7        --------------GLIYPPKLDLKKDKIISGLSSYILESRQE-------------DSLL
PESC_VANPO        --------------DLVYPPKVDIAKNKIISGLSSYILESETE-------------ENVL
PESC_CANGA        --------------GLVYPPKIDVEQDKILSGINAYILESQEE-------------TSVL
PESC_CANAL        --------------GLIYPPIIEKSI-----GLSGYVLQDKD---------------APL
PESC_LODEL        --------------GLIYPPHIDIAKLKAAGGLSSYVLQSKDGK-----------NVAIL
PESC_DEBHA        --------------NLIYPPTIDTEKLKGIGGLSSYVLQSKDQG-----------VKALL
PESC_PICST        --------------NLIYPPTIDIEKLKGIGGLSSYVLQSKDQG-----------VSALL
PESC_PICGU        --------------NLIYPPTIDIEKLKGIGGLSAYILQTKDS------------VNPLI
PESC_YARLI        --------------GLVFPPIINSTKLSGVGGINAYVLESRQN-------------AGVV
PESC_COPC7        --------------NLVYPPPLDINKDDMAAGVGAFNLQSTH---------------VQP
PESC_LACBS        --------------GLVYPPPLDAKKDESAAGIGAFSLQDIT---------------QPA
PESC_CRYNJ        --------------NLVYPPPLDVELDEQGESVGAFKLVERK---------------AAE
PESC_MALGO        --------------NLVYPPKLDESLDNQGAGFGSLMLMAADADVLTGKHSLRPMDDAAA
E3K873_PUCGT      --------------NLIYPPKLDSNLDEAAAGLNALILESSN-------QTLVADQTDSE
PESC_MONBE        --------------GMHYPPQFEAAQSEASETMSKHHRKQAKKT-----------ESRVA
D7TWJ6_VITVI      --------------NVKYPPILDSRLEALAAD---LYGLSRYFAANSS------------
B9H456_POPTR      --------------NVKYPPILDPQLEALASGMPYLYALSRYIVSNSR------------
PESC_ARATH        --------------NVKYPPILDSRLEALAAD---LYALSRYIDASSR------------
C5WNV4_SORBI      --------------NVNYPPILDPRLEALAAE---LYALCRYMSAGSRRMI----GNSQS
PESC_CHLRE        GAALPSLRVYPLFSQLRYPPVLDPRLEEAAAE---LAAIMKDIAGMEE--------EEPE
D0NK35_PHYIT      --------------GVAYPPKINLQLDAAGAQ---LAAIELERVQEDEE------MAESE
C4M0Q1_ENTHI      --------------GLNYPPEITKINGVEFLGTVQLEPLQLQKETEVIS-----------
Q4UA76_THEAN      --------------NIEYPPKTRPGLEDLGDEFYNFELKRVAS-----------------
Q4N2W3_THEPA      --------------NIEYPPKIRPGFEDLGDEFCYFELKRVAS-----------------
A7ATP9_BABBO      --------------GLSYPPVIKPNMENVTIDYVHMDVTGAATV----------------
PESC_PLAF7        --------------NMLYPPKQDNDLKNEKLAHLSYDKDYSTNENNID--------INMN
PESC_PLAYO        --------------GMSYPPKEYKDLKNEKLNHLSFDKNYITKE--------------LS
B3L4N0_PLAKH      --------------NMTYPPEQSELLKNEKLKHLSYDQCLISLCKEKF--------PNAH
A5K4A1_PLAVS      --------------NMAYPPEQGELLKSEKLSHLSYDEGLIALCREKF--------PGET
A8BZA6_GIAIC      ------------LNGYQYPPAVQEEADYILRLVGNIRAHATASE----------------
A2DN41_TRIVA      --------------GLKYPPEYDQKKWDSGFYIDAIIDNNEQP-----------------
                                                                              

PESC_LEIIN        ----------------AVLDVGANGAQAKEVKEAESKRSLMGEELHKV------------
PESC_LEIMA        ----------------AVLDVGANQAQAKAVKEAESKRSLMEEELHKV------------
PESC_LEIBR        ----------------AVLDVGANQAQAK-VKEAESKRSLMEEELLKV------------
Q38EE3_TRYB2      ----------------TVQGLGGTVGQVA------KRVELMDEELRKV------------
PESC_DICDI        --------------TNNTTKKSKSTTAAAAA-----TTPVDPKLKKLE------------
F0ZGY9_DICPU      --------------AQKKIEAAKAVAAAAAALDGSKTAKADPKLKKLE------------
D3BB01_POLPP      --------------TTTTTTSSKKNNKQALS------KEAIDTQKKVN------------
A0DEJ7_PARTE      --------------FSEEVKKLKSVS--------QNNQIEIDEAFKED------------
A0D1P2_PARTE      --------------FSEEVMKLKSLA--------QNNQIEIDEAFKED------------
Q23RV6_TETTS      --------------YSSFVLKHKDSQQTIENAEEENEKYAIDDKFKKD------------
Q5CXI7_CRYPI      --------------YPPTINTPIFDN---------GGRFLSLHAYNLS------------
PESC_HUMAN        -------------CMEKLAALSASLARVVVPATEEEAEVDEFPTDG--------------
I3MLZ5_ICTTR      -------------SMEKLAALSASLARVVVPATEEEAEVDEFPADG--------------
H0WSW0_OTOGA      -------------SMEKLAALSASLARVVVPAIEEEAEVDEFPADE--------------
G1LLM9_AILME      -------------SMEKLAALGASLTRMVVP-VEEEAEVDEFPADG--------------
PESC_MOUSE        -------------SMEKLAALSASLARVVVP-AIEEAEADEFPTDG--------------
PESC_RAT          -------------SMEKLAALSASLARVVVP-AVEEAEADEFPTDG--------------
PESC_DANRE        -------------YTEKLSALSASLARMVASVEEEEAELDHFPTEG--------------
PESC_SALSA        -------------YLEKLSALSASLARVVATVEEEENQLDNFPTEE--------------
H3BC39_LATCH      -------------YMEKLSALSASLARVMATIEDDEAELDEFLTEG--------------
PESC_XENLA        -------------YMEKLAALSASLSRVIPSEPNDDTEVDEFPADP--------------
PESC_XENTR        -------------YMEKLAALSASLSRVIPSEPEEENEVDEFPADP--------------
F6Y1Q9_XENTR      -------------YMEKLAALSASLSRVIPSEPEEENEVDEFPADP--------------
PESC_NEMVE        -------------EDEVLAALNHTLKIIQTQ--EEDLEVDEFPIDPNS------------
PESC_AEDAE        ----------------RIAALNMDLLRSDRQGTEEEDEEIDLKLLDND------------
PESC_CULQU        ----------------RIAALNSDLLRSDQMGTEEEDDQIDLDLLDGD------------
PESC_ANOGA        ----------------RIAALNVELLRSDG-GNGDTEEPELLEWTGND------------
PESC_DROER        ----------------RIAALNFELLRTDKVQEDEEELDIDMELLEQD------------
PESC_DROYA        ----------------RIAALNFELLRTDKVQEDEEELDIDMELLEQD------------
PESC_DROSE        ----------------RIAALNFELLRTDKVQEDEEELDIDMELLEQD------------
PESC_DROSI        ----------------RIAALNFELLRTDKVQEDEEELDIDMELLEQD------------
PESC_DROME        ----------------RIAALNFELLRTDKVQEDEEELDIDMELLEQD------------
PESC_DROAN        ----------------RIAALNFELLRTDKVQEDEEELDIDMELLEQD------------
PESC_DROGR        ----------------RIAALNFELLRTDKLQEDEEEPDIDMELLEQD------------
PESC_DROVI        ----------------RITALNFELLRTDKVQEDEEEPDIDMELLEQD------------
PESC_DROMO        ----------------RIAALNFELLRTDKVQEDEEEPDIDMELLEQD------------
PESC_DROPE        ----------------RIAALNFELLRTDKVQEDEEEPDIDMELLEQD------------
PESC_DROPS        ----------------RIAALNFELLRTDKVQEDEEEPDIDMELLEQD------------
PESC_DROWI        ----------------RIAALNFELLRTDKLMEDEEELDIDMELLEQD------------
E0VTT0_PEDHC      ----------------RVAALSTPITKTGKDIPEENEMD-QFPTEEGE------------
E9FYB2_DAPPU      ----------------LVAALNTSLV----ANVPEAEEELQIDEFPSA------------
PESC_CAEBR        ----------------KVYSLAKPLAKRK--DVEQTEDDEPLDLLG--------------
PESC_CAEEL        ----------------KVYSLAKPLAKRK--DVEQAEDDEPLDLLG--------------
PESC_BRUMA        ----------------RVYSLACPLSKFE--NYEEQIDA---SIGD--------------
G4VRP5_SCHMA      ----------------FMSSLSFPLKRTEPLNDVEVDDLTELQAID--------------
PESC_SCHPO        AIVHGNNKNARKNIATLKSKIRDIVNSDANVVEQSEKTTEDADEEPET------------
F4P5J1_BATDJ      SIAADGPPTAMGNQVSQSAQRLKTLNQKIGQIEAAQDSDSDMSDTAET------------
I1CDW4_RHIO9      -----------------KGNRQQQDEEEDEELDEFKSTAQDEEED---------------
PESC_COCIM        ISSEPQTNGQLAKSDSAANDIQAKVDNILKETTRNNEPDDEAV-DVE-----------DN
C0NUL9_AJECG      IETSQQPNGSAEKVATTSKELQAKVDNILEKTQLDTEPTDQSTEDRE-----------DN
PESC_ASPFU        IEAGNTQATTSTNNKEVSKEIQAKVDNVIKSAGLDEAKEEPAAETTE-----------ES
PESC_ASPFC        IEAGNTQATTSTNNKEVSKEIQAKVDNVIKSAGLDEAKEEPAAETTE-----------ES
PESC_NEOFI        IEAGNTQATTSTN-KEVSKEIQAKVDDVIKSAGLDEAKEEPAAETTE-----------ES
PESC_ASPCL        IEAGHTQRSSSAN-KEVSRDIQAKVDKVIKSAGLDQAKDEQTAETTE-----------ES
PESC_ASPOR        IEGT-KQTSSTAN-KEVSQDVQAKVDKVIKSAGLDQTKDDQAVQATE-----------ES
PESC_ASPTN        IEGSNKQSNNSSN-QEVSRDVQAKVDKVIKTAGLDKTKDEQTVEATD-----------EN
PESC_EMENI        IEPAKSSSD-AAN-QEVSAEVQKKVDNVIKKAGLDQASSEQPTETAE-----------EV
PESC_PHANO        ASNDHDDDVEINPEAQAKADKIAAMADDEDEQEVEMAEADAEDDDEE-----------EN
PESC_PYRTR        ASNGHAEDAEINPEAQAIADRIGAMPDVEEEEATTAVAKTGAEDDEE-----------EA
PESC_BOTFB        KQITNGDASK--PDPKLQAEIDKLMLQLNAPEKEVEETTKTSPDGED---------EEQA
PESC_SCLS1        KQITNGDASK--PDPKLQAEIDKLMLQLNAPEKEAEETSKTSPDGEE---------EEQA
PESC_CHAGB        KAITNGEAEH-GPDPKVQAEVDKIVQQLRVE---SDDKASEEGPADDVEG------EEKP
PESC_NEUCR        KAVTNGEEQQQGPDPKVQAEVDKIIKQLKEDESKSDETAEEDAEADD---------EEKP
C7YII3_NECH7      QQKQLEAAEH-KPDPKVQAAVNKVIKKIKGTEADDDSTSATENQVEG---------EDQD
PESC_MAGO7        PDAIMEGTSESTPDPKLQAKVNKLVKELKSGE-DEKPKAITNGEGES----------ETP
D5GH60_TUBMM      ----------------------------------------EAGERKD-----------VE
PESC_ASHGO        SVDGSAD-----SENQEVQVLDKKALRHAMKADDKAGSEADEGDADSN--------EQVT
PESC_KLULA        AVKPKEL-----SENVEVQELGANTLKTALKADSNEHDEEEQ-DQDQE--------QNVE
PESC_YEAST        KLDPTEI-----EEDVKVESLDASTLKSALNADEANTDETEKEEEQEKKQEKEQEKEQNE
PESC_YEAS7        KLDPTEI-----EEDVKVESLDASTLKSALNADEANTDETEKEEEQEKKQEKEQEKEQNE
PESC_VANPO        TATKLS------EPTGETSNIDSETLKLAMKADE-NVDDTNPEDEQ---------TENVE
PESC_CANGA        NAEVPSD-----APDKEAQSIDTKTLAQAMKADSKDKDDNSNDEAP----------ENVE
PESC_CANAL        KKKEE-------KNDEEGKNLSKKELNKAIKADQEQQEN---DEQDNN------NGESVE
PESC_LODEL        QKKQDDA-----GSNVEGKELSSAELKKAIKADKDQKDQDTIEDAEEV------TEPTVE
PESC_DEBHA        PNAKKAADSKDESKKVKETKLSKEEISKAVAADKSL-----NENAEDN------VSENVE
PESC_PICST        PQDKKIV---EDDVSVQGKELSTANISKALEADNE------GEEHEEV------EQETVE
PESC_PICGU        PKTKAAQ------TDAAGTKLDDKEISKAIEADQK--------DDDED------VEPGVD
PESC_YARLI        PQIEGNS-------EAKVENVSAAVLSKAAKADAGE-----EEEVEEE--------EEVE
PESC_COPC7        KRNETGKTVDVDGKKVSVKDVRQTIKSIVAADEPQ-VDVQMGD--PDE---------ASP
PESC_LACBS        AQPSRAKAVELDGRKISTKDVRQTIKNIEASHSTHDPDVEMSN--PET---------ATT
PESC_CRYNJ        GAD--------GKTQVSKKAVRKAIKGIKAAGDDADVDMDEGA--KET---------DE-
PESC_MALGO        AEASSNAITRKDGKKLSTRDVKRQIAQLTRSEDKAEHEPEDDESMPAL---------DAT
E3K873_PUCGT      AQASG---------RQTAKSVRNEIKSLISAQTTAPDEAEENE--------------QNE
PESC_MONBE        QALADVKAAMDEDLNDEEEELDAQTKQEAAPADRDQASFDTFEAMADP------------
D7TWJ6_VITVI      ATVLGSQAVSS-----SGAEQ-IDITKDGTQPDESELRLAQLQHQLPS----------NE
B9H456_POPTR      TSTLEPTAASS-----STSQQ-LEAQEKEMQADESELRLAQLQHQLPS----------NE
PESC_ARATH        GMAVEPKVDAS-----FSSQS-NDR-------EESELRLAQLQHQLPS----------SE
C5WNV4_SORBI      DEVMEDKDEKSKADGITEEEK-DVKNKASSKADESELRLAQLQHQLPT----------NE
PESC_CHLRE        EVDSEAGDEDDDDLPVLDSGT-RRRRAAAAGPAPRRWRCWVRTTRTRM----------TT
D0NK35_PHYIT      EQDKEETESNNISQQQKESEKRIKTLNGAIKDDDVEEYEEDEATYGEM----------SE
C4M0Q1_ENTHI      -------------KDQDVQELNEALKQVKGEGENLATEMLVNHDTGAS------------
Q4UA76_THEAN      ------------------------------------------------------------
Q4N2W3_THEPA      ------------------------------------------------------------
A7ATP9_BABBO      ------------------------------------------------------------
PESC_PLAF7        QELQSKCNVNTNEDLNTCQEKTKEKNHKSDNNPHEHTTNIDNNNFNNI------------
PESC_PLAYO        NELETKESTEDNIIEENEKKTKNGKTENCEKNDQENEKKTKNDKTKNC------------
B3L4N0_PLAKH      GQGQESNQGEGKPLTLDSSLVSDTQPVVL--SPEEGISQVEEQNQSKI------------
A5K4A1_PLAVS      TQVDSGLSSDGHLLVQSPQEGAPPAGEPS--QSEEHREEVKPSGLPKK------------
A8BZA6_GIAIC      ----------------VDLSLIYGPNGCDEPCDKNGGVRNLNPASVKP------------
A2DN41_TRIVA      ----------------VVESVAEAPADAKVDMDKVAGIFAKAAAETVE------------
                                                                              

PESC_LEIIN        ------------------------------------------------------------
PESC_LEIMA        ------------------------------------------------------------
PESC_LEIBR        ------------------------------------------------------------
Q38EE3_TRYB2      ------------------------------------------------------------
PESC_DICDI        -EKISKINSKEEKEIKEQIVEEDTNMLQVNSSGISKDFEDLVGNES-----DNIPKIMDV
F0ZGY9_DICPU      -EKISKISTKEEKSIKEPTESEEQNDLQVNASGISKDFEGLVDEENK----DDIPKILDH
D3BB01_POLPP      -EISKSLNQEDEEMEENEDDAANGGNLELNSKGISKDFEDLVGQEGDQEGATSVVKLTDQ
A0DEJ7_PARTE      -PTIQQMDQQQQETKK-------------------------------------------Y
A0D1P2_PARTE      -PTIQQMDQQQQETKK-------------------------------------------Y
Q23RV6_TETTS      -QQIQKMTNDNS-----------------------------------------------T
Q5CXI7_CRYPI      -KLNSNIPSNVEQKVE-------------------------------------------K
PESC_HUMAN        -EMSAQEEDRRKELEAQ---------------EKHKK-----------------------
I3MLZ5_ICTTR      -EMAVQEEDRRKELEAQ---------------EKHKK-----------------------
H0WSW0_OTOGA      -EIAVREEDHRKELEAQ---------------EKHKK-----------------------
G1LLM9_AILME      -ETTAQEEDRRKELEAQ---------------EKHKK-----------------------
PESC_MOUSE        -EVTAQEEDRKKELEAQ---------------EKHKK-----------------------
PESC_RAT          -EVTAQEEDRRKELEAQ---------------EKHKK-----------------------
PESC_DANRE        -EDQEKMEVREKMEQQQ---------------SKQKK-----------------------
PESC_SALSA        -EDQENMQAREKEQKEQ---------------EAQKR-----------------------
H3BC39_LATCH      -ENSEQLVERKKEQEDV---------------EKHKK-----------------------
PESC_XENLA        -ENAGLEEEQKRQLQEE---------------EKHKS-----------------------
PESC_XENTR        -ENAGQEEEQKKQLQEE---------------EKHKS-----------------------
F6Y1Q9_XENTR      -ENAGQEEEQKKQLQEE---------------EKHKS-----------------------
PESC_NEMVE        -EDAEAIQAQKEEETKL---------------ERLKN-----------------------
PESC_AEDAE        -KDSEQVRKMHEEALSL---------------SKLKN-----------------------
PESC_CULQU        -KDSEQVRKLREDAVSL---------------NKLKN-----------------------
PESC_ANOGA        -EELPHVSQIRQEAQNV---------------NKLKT-----------------------
PESC_DROER        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROYA        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROSE        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROSI        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROME        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROAN        -GDSKRIIKMKQEAQEV---------------ARLRT-----------------------
PESC_DROGR        -GDSKRIIKMKQDAQEI---------------TRLRT-----------------------
PESC_DROVI        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROMO        -GDSKRIIKMKQEAQEI---------------ARLRN-----------------------
PESC_DROPE        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROPS        -GDSKRIIKMKQEAQEV---------------SRLRT-----------------------
PESC_DROWI        -GDSKRIIKMKQEAQEV---------------ARLRT-----------------------
E0VTT0_PEDHC      -EAEAEMEDKKLEIAKI---------------QKLKN-----------------------
E9FYB2_DAPPU      -EGEDKLDEAKREAEAI---------------ERLKT-----------------------
PESC_CAEBR        ----EDSDALAQKVKEA---------------KNIKT-----------------------
PESC_CAEEL        ----EDSDALAQKVREA---------------KSIKT-----------------------
PESC_BRUMA        ----EVDNVLNEKLCDV---------------EKRKQ-----------------------
G4VRP5_SCHMA      ----EQVSQAISKQIEV---------------QNVKK-----------------------
PESC_SCHPO        EENLDEFKPADGADNED------SKSLVSHISSSNTS-----------------------
F4P5J1_BATDJ      VPTLASWKASESE------------------HAKSAR-----------------------
I1CDW4_RHIO9      -DTLKKIQAASHE------------------AAELGR-----------------------
PESC_COCIM        VDAIDKFET--TAPEAD------TLPQPQMSGNEVAS-----------------------
C0NUL9_AJECG      TEAIDKFEP--IAPEAD------SLPQPQISGDEAGS-----------------------
PESC_ASPFU        SETIDKFEP--AAPEAD------TLPQPDLSGNEAGS-----------------------
PESC_ASPFC        SETIDKFEP--AAPEAD------TLPQPDLSGNEAGS-----------------------
PESC_NEOFI        SETIDKFEP--AAPEAD------TLPQPDLSGSEAGS-----------------------
PESC_ASPCL        SDTIDKFEP--AAPEAD------TLAQPDLSGSQAGS-----------------------
PESC_ASPOR        TEEIDKFEP--AAPEAD------TLLQPDISGDTAGA-----------------------
PESC_ASPTN        TDAIDRFEP--AAPEAD------TLPQPDISGEEAGA-----------------------
PESC_EMENI        TDAIDKFET--TAPEAD------TLPQPDMSGDQAGS-----------------------
PESC_PHANO        TEGIDKFEP--TAPDAD------ILPQPQASSAEIAS-----------------------
PESC_PYRTR        NEEIDKFEP--TAPDAD------ILPQPQASSAEVAS-----------------------
PESC_BOTFB        TETIDKFEP--AAPGGD------ILMQPSYSATDPST-----------------------
PESC_SCLS1        TETIDKFEP--AAPGGD------ILMQPSYSATDPST-----------------------
PESC_CHAGB        SDAIDKFEP--VAPGGD------VLPQPSYSSSDPAQ-----------------------
PESC_NEUCR        TDSIDKFEP--VAPGGD------VLPQPAYSSSDPSQ-----------------------
C7YII3_NECH7      AGVIDKFEP--AAPGGD------VLPQPSNTGNNPNN-----------------------
PESC_MAGO7        TDAIDKFEP--AAPGGD------VLLQPSYSTSDPSQ-----------------------
D5GH60_TUBMM      DLTIDTFTP--AAASDQL-----PQPTPSQTTSTSTA-----------------------
PESC_ASHGO        NIELDDFED-KNKNHGD------ILEQPSQYDSPTST-----------------------
PESC_KLULA        DVELDKFED-TNKNQGD------QLEQPSKFDSPVAT-----------------------
PESC_YEAST        ETELDTFED-NNKNKGD------ILIQPSKYDSPVAS-----------------------
PESC_YEAS7        ETELDTFED-NNKNKGD------ILIQPSKYDSPVAS-----------------------
PESC_VANPO        TVELDAFQD-NNKNKGD------ILAQPSQYESPVST-----------------------
PESC_CANGA        DVELDEFED-HNKNKGD------ILAQPSKFSSPTAT-----------------------
PESC_CANAL        DIELDEF----TSTKED------SLLQPSKYASSTAE-----------------------
PESC_LODEL        ETELDEFQNGTTNNAVD------TLVQPSQFSSPTSQ-----------------------
PESC_DEBHA        DVELDEF-SSTNKTAGD------LLSQPSKFASPTST-----------------------
PESC_PICST        NVELDKFEASATKTAVD------SLVQPSKYASPTST-----------------------
PESC_PICGU        EVELDEF-SATNKTTGD------LLSQPSQYASPTST-----------------------
PESC_YARLI        DDGLDSF----SAEKGD------ALAQPT-FNSTAGQ-----------------------
PESC_COPC7        GEEEQFVAHASKSAPDAVPELPTLHMLSSTPSSPSSR-----------------------
PESC_LACBS        EVEEEFISQASLSNPG---------LISSLPQSLSTS-----------------------
PESC_CRYNJ        EEDEDFVERPSKAQEVDDVASAPLTTYNSLLATSSTPARQ--------------------
PESC_MALGO        MQDQDSDEEADDEAGAADAFVAHASKTQGAGADQLTTLRDLQKQAGEDP----------L
E3K873_PUCGT      QMEVDPVVESNDEVEQG-------------------------------------------
PESC_MONBE        AVDSDMNVP----SGQD-------LEEAAAEADAATR-----------------------
D7TWJ6_VITVI      PGTLMHLVEDASCEDED-----------DEETRECKT-----------------------
B9H456_POPTR      PGALMHLMENAECENED-----------DQDTKECRR-----------------------
PESC_ARATH        PGALMHLVADNNKEVEE-----------DEETRVCKS-----------------------
C5WNV4_SORBI      PGALMNLVEESTADDAD-----------DDDTKECKG-----------------------
PESC_CHLRE        CRWVSDRAGGACGPGVDP----------SDEAAVCGS-----------------------
D0NK35_PHYIT      PLEAAFASNELAAQIYSE----------QRKERSEKS-----------------------
C4M0Q1_ENTHI      ---VQVTSHFVQSSGSG-------------------------------------------
Q4UA76_THEAN      -----------------------------------------------------------E
Q4N2W3_THEPA      -----------------------------------------------------------E
A7ATP9_BABBO      -----------------------------------------------------------T
PESC_PLAF7        -HLQDNCDLNKNEGKNLTNNIIHKNSEADNGHVHPDDHIDIDEH-------------NKL
PESC_PLAYO        -EKNDQKNDQKNDQKN-----DQKNDQKNEMKQIEHDIIXNDNT-------------KSV
B3L4N0_PLAKH      -LQEDEEIKHNIDEEN-----------------------------------------DTL
A5K4A1_PLAVS      -ESEDEEIKHNIDEQN-----------------------------------------DTL
A8BZA6_GIAIC      ------------------------------------------------------------
A2DN41_TRIVA      -NDEEKADSG--------------------------------------------------
                                                                              

PESC_LEIIN        RELFRGLTFFISREVPSKRFALVINACGGR---VATDYVP--------------------
PESC_LEIMA        RELFRGLTFFISREVPAKHFALVINACGGR---VATDYVP--------------------
PESC_LEIBR        RELFRGLTFYISREVPAKHFALIINACGGR---VATDYVA--------------------
Q38EE3_TRYB2      RRVFEGLSFYISREVPHKHAALVIKACGGR---VATGYVA--------------------
PESC_DICDI        TTLFKGFHFYISREVPRHMLEFVILSFGGR---VSFPGSGDKVKEVNQ------------
F0ZGY9_DICPU      SNLFKGFHFFLGREVPRHILEFIILSFGGR---VSVQGG--PVYEGNQ------------
D3BB01_POLPP      TNLFKGLKFFCSREVPKHALEFVIQSFGGE---VSWEGG--AFSESDQ------------
A0DEJ7_PARTE      SELFKGLTFFLYPEVPKTSLEFVILSFGGE---VMWENDNKNSQLTDP------------
A0D1P2_PARTE      SELFKGLTFFLFPEVPKSSLEFVILSFGGE---VMWENDNKNSQLTDP------------
Q23RV6_TETTS      SSLFKNCVFYLSSEVPRLSIEFIVLAFSGK---VHWAGDDSEVQWNDP------------
Q5CXI7_CRYPI      KRIFEGLTFFISREVPLLPLAFVIKSFGGK---VGWENQFSSIKQDDE------------
PESC_HUMAN        --LFEGLKFFLNREVPREALAFIIRSFGGE---VSWDKSLCIGATYDV------------
I3MLZ5_ICTTR      --LFEGLKFFLNREVPREALAFIIRSFGGD---VSWDKSLCIGATYDV------------
H0WSW0_OTOGA      --LFEDLKFFLNREVPREALAFIIRSFGGD---VSWDKSVCIGATYDV------------
G1LLM9_AILME      --LFEGLKFFLNREVPREALAFVIRSFGGD---VSWDRSLCIGATYDV------------
PESC_MOUSE        --LFEGLKFFLNREVPREALAFIIRSFGGD---VSWDKSLCIGATYDV------------
PESC_RAT          --LFEGLKFFLNREVPREALAFIIRSFGGD---VSWDKSLCIGATYDS------------
PESC_DANRE        --LFEGLKFFLNREVPRESLAFVIRCFGGE---VSWDKSLCIGSTYEA------------
PESC_SALSA        --LFEGLKFFLNREVPRESLAFILRCFGAE---VSWDKSLCIGGTYEV------------
H3BC39_LATCH      --LFEGKKFFLNREVPREPLAFVLRCFGGQ---ISWDKSVCIGATYDA------------
PESC_XENLA        --LFVGLKFFLNREVPRDALAFIIRSFGGE---VSWDASVCIGATYNS------------
PESC_XENTR        --MFVGLKFFLNREVPRDALAFIIRSFGGE---VSWDASVCIGATYNS------------
F6Y1Q9_XENTR      --MFVGLKFFLNREVPRDALAFIIRSFGGE---VSWDASVCIGATYNS------------
PESC_NEMVE        --LFSECKVFLSREVPRETLVFMIRSFGGQ---VSWDVSTAIGATFAE------------
PESC_AEDAE        --LFKGLKFFINREVPREPLVFIIRCFGGK---VSWDKHLFVGSTFDE------------
PESC_CULQU        --LFKGLKFFINREVPREPLVFILRCFGGR---ASWDRNLFVGATFDE------------
PESC_ANOGA        --LFKGLKFFLNREVPREPLVFIIRCFGGK---VSWDKTMFVGATFDE------------
PESC_DROER        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDSSIFAGSTYDE------------
PESC_DROYA        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDSSIFAGSTYDE------------
PESC_DROSE        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDSSIFAGSTYDE------------
PESC_DROSI        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDSSIFAGSTYDE------------
PESC_DROME        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDSSIFAGSTYDE------------
PESC_DROAN        --LFKGLKFFINREVPREPLVIIIRSFGGK---VSWDSSIFPGSTFDE------------
PESC_DROGR        --LFKGLKFFINREVPREPLVIIIRSFGGK---VSWDSTVFSGSTYDE------------
PESC_DROVI        --LFKGLKFFINREVPREPLVIIIRSFGGK---VSWDSSVFSGATYDE------------
PESC_DROMO        --LFKGLKFFINREVPREPLVIIIRSFGGK---VSWDSSVFSGSTYDE------------
PESC_DROPE        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDASVFPGATFAE------------
PESC_DROPS        --LFKGLKFFINREVPREPLVILIRSFGGK---VSWDASVFPGATFAE------------
PESC_DROWI        --LFKGLKFFINREVPREPLIILIRSFGGK---VSWDASVFAGATFDE------------
E0VTT0_PEDHC      --LFKDKKFFLNKEVPRESLVFVIRCFGGL---VSWDKTCFPGATFDE------------
E9FYB2_DAPPU      --LFKGLKFFISREVPRESVVFVIRACDGE---ASWDSSIFAGATYDE------------
PESC_CAEBR        --LFKGCVFYLNRECPKEALTFIIRNGGGV---VGWE--GAP-NDLKA------------
PESC_CAEEL        --MFKGCVFYLNRECPKEALTFIIRNGGGI---VGWE--GGP-TDLKA------------
PESC_BRUMA        --LFANYRFWLNREVPKDVLAIIIRSCGGL---VSWE--NCPAAQYYE------------
G4VRP5_SCHMA      --LFKNKRFFLMREVPREAICLIIRSCGGE---CSWDKIVSPGYTFQE------------
PESC_SCHPO        --LFSNFTFFLSREVPRFSLEFVIRAFGGK---VGWDPILGSGSPFS-------------
F4P5J1_BATDJ      --LFSSCVFWLPREVSRNSLEFIIKSFGGK---VGWDASSGSGSPYQ-------------
I1CDW4_RHIO9      --LFEGQRFFLSRETPRYALEFMIRSCGGQ---VSWDPSVGVNPPFA-------------
PESC_COCIM        --LFASFTFFISREAPRGPLEFLLRAFGCK--RVGWDAVLGEGAFTH-------------
C0NUL9_AJECG      --LFATFTFYISREAPRAPLEFLLRSFGCK--RIGWDSVLGDGAFTH-------------
PESC_ASPFU        --LFAPFTFYISREAPRAPLEFILRAFGCK--RIGWDAVLGDGAFTH-------------
PESC_ASPFC        --LFAPFTFYISREAPRAPLEFILRAFGCK--RIGWDAVLGDGAFTH-------------
PESC_NEOFI        --LFAPFTFYISREAPRAPLEFILRAFGCK--RIGWDAVLGDGAFTH-------------
PESC_ASPCL        --LFAPFTFYISREAPRAPLEFLLRAFGCK--RIGWDAVLGDGAFTN-------------
PESC_ASPOR        --LFAPFTFYISREAPKAPLEFILRSFGCK--RIGWDAVLGDGAFTH-------------
PESC_ASPTN        --LFAPFTFYISREAPKAPLEFILRAFGCK--RIGWDAVMGDGAFTH-------------
PESC_EMENI        --LFAPFTFYISREAPKTPLEFILRAFGCK--RIGWDTVLGGGAFTH-------------
PESC_PHANO        --LFAPFTFYLAREVPRASLEFILKAFGCK--RVGWDSILGDGAFTT-------------
PESC_PYRTR        --LFAPFTFYLSRETPRGSLEFILKAFGCK--RVGWDGVLGDGAFTT-------------
PESC_BOTFB        --LFSKFTFFLSRETPRQPLEFILRAFGCK--RIGWDAVLGEGAFTH-------------
PESC_SCLS1        --LFSKFTFFLSRETPRQSLEFILRAFGCK--RIGWDAVLGEGAFTH-------------
PESC_CHAGB        --LFSRLTFFLSRETPRQSLEFILRAFGCK--RIGWDSVLGEGSFTT-------------
PESC_NEUCR        --LFANFTFYLSRETPRQPLEFILRAFGCK--RIGWDSVLGEGAFTN-------------
C7YII3_NECH7      --LFSNLTIYLSRETPRQPLEFLLKSFGCK--RVGWDAVLGGGAFTT-------------
PESC_MAGO7        --LFANCTIYLSREAPRQALEFILRAFGCK--RIGWDEVLGDGAFTT-------------
D5GH60_TUBMM      --LFSGTTFYLSRETPREPLEFLLRSFGCK--RIGWDAVLGAGAYTE-------------
PESC_ASHGO        --LFSEFVFYIGREVPVDILEFLIVSCGGS--VISEAALDQ-ADAA--------------
PESC_KLULA        --LFSEFVFYVGREVPLDIVEFLILSCGGS--AVSEATLDQLTDKQ--------------
PESC_YEAST        --LFSAFVFYVSREVPIDILEFLILSCGGN--VISEAAMDQIENKK--------------
PESC_YEAS7        --LFSAFVFYVSREVPIDILEFLILSCGGN--VISEAAMDQIENKK--------------
PESC_VANPO        --LFSDFVFYVGREVPIDILEFLILSCGGS--VISEAALDKLETK---------------
PESC_CANGA        --LFEDFVFYVGREVPIEAIEFLILSCGGK--VISEAAMDQIEGNT--------------
PESC_CANAL        --LFSKFIFYIGREVPLDILEFCILSCGGK--IISEIAIDDLKINDP----------EAY
PESC_LODEL        --LFSKFIFFIGREVPLDILEFVILSCGGK--VISEISLDDLKLNDP----------KLY
PESC_DEBHA        --LLSKFIFYVGREVPLDILEFCILSCGGS--IISEIALDELQLNQP----------EEY
PESC_PICST        --LFSKFIFYVGREVPLDILELCILSCGGS--VVSEVALDDLKTNSP----------DAY
PESC_PICGU        --LFSKFVFYVGREVPLDILEFCILSCGGS--LVSEIAMDDLKINHP----------EAY
PESC_YARLI        --LFSNFTIFIGREVPLDIIEFLIIAFGGK--VISESAMDELIDNEDETRGNVIDEKTLK
PESC_COPC7        --LFAPYTFWLSRETSRSIFEFIIRSHGG---RVGWPASSGTGSPFD-------------
PESC_LACBS        --LFSPYTFFLSREVSRPIFEFMVRSFGG---KIGWSASFGSGSPFE-------------
PESC_CRYNJ        NLLFSPYTFYLSRETSSRTWEFVVRAMGG---KVITSLTAPTPADAP-------------
PESC_MALGO        PMLFSRYVFYISREVPRTVFEFILRSFGASPSNVGWDPVAGAGSQVA-------------
E3K873_PUCGT      --LFTPYAFFLSREVTRPMLEFVIKCSGG---EVGWDPILGAGSPYL-------------
PESC_MONBE        --IFQNLYFFLSREVPRYSLEFVIRSFGGN---VSWDALDEAEAGPY-------------
D7TWJ6_VITVI      --LFKNKKFFLSREVPRESLLFVIPAFGGV---VSWEGEGAPFKEADQ------------
B9H456_POPTR      --LFKNMKFFLGREVPRESLLFVIPAFGGV---VSWDGEAAPYKESDQ------------
PESC_ARATH        --LFKDLKFFLSREVPRESLQLVITAFGGM---VSWEGEGAPFKEDDE------------
C5WNV4_SORBI      --LFKNLKFYLSREVPRESLLFIIPAFGGT---VSWEGEGAPFKEVDE------------
PESC_CHLRE        --LFRGRVFFLGREVPREPLMLVIRAFGGV---AAWDGDGSPHAETDE------------
D0NK35_PHYIT      --LFSGLTFFLSREVPAACLELVLRSHGAT---LGWDGEGSPFDEKNT------------
C4M0Q1_ENTHI      --LFSGMVFYIQREVPRHPVAFVIETLGGI----IVDNVDD-------------------
Q4UA76_THEAN      PGLFANLRFFISKEVPLTPTSLVILSAGGV------------------------------
Q4N2W3_THEPA      PGLFANLRFFISREVPLTPTALVVLSAGGL------------------------------
A7ATP9_BABBO      EGIFTGMRFFISSEVPLVPTSLVITSAGGI------------------------------
PESC_PLAF7        KELFKNHIFYIHNDMPFDVLSIIILSCGGK---ISWNSRISPIHYDDN------------
PESC_PLAYO        KNLFKNHIFYIHSNMPFDVLSIIILSCGGT---ICWNSLYSPYKYDDK------------
B3L4N0_PLAKH      KDLFKNQVYYIHTDMPLDILSLIILSSGGA---IGWNSPYSPYQREDE------------
A5K4A1_PLAVS      KDLFKNQVYYIHTDMPLDILSLIILSCGGA---IGWNSPYSPYQLGDQ------------
A8BZA6_GIAIC      ---FIGQKHAISREVPREPLELVLLSGGAD--VFTYSSP---------------------
A2DN41_TRIVA      --VFGNYVFTIGRETPRDALALIIRSLGGR---IIWDESSK-------------------
                     :         : .     : :   .                                

PESC_LEIIN        -----SNITHVVVDRPALPP----------------------GMKKHDQLEYVQPQYIFD
PESC_LEIMA        -----SNITHVVVDRPALPP----------------------GMKKHDQLEYVQPQYIFD
PESC_LEIBR        -----SNITHVVVDRPALPP----------------------GWQQHDQMEYVQPQYIFD
Q38EE3_TRYB2      -----ENITHFVVDRPALPP----------------------GFEKDDRIEYVQPQYLFD
PESC_DICDI        ------SITHQIVDRS-------------------------NSVKVHNTREYIQPQWVFD
F0ZGY9_DICPU      ------TITHQIIDRN-------------------------TITKTYHTREYIQPQWVFD
D3BB01_POLPP      ------SVTHQIIDRN-------------------------SQEKIYPNREYIQPQWVFD
A0DEJ7_PARTE      ------KITHIITER---------------------------QIQKNKKREYIQPQWVYD
A0D1P2_PARTE      ------KITHVITER---------------------------TVQKNKKREYIQPQWVYD
Q23RV6_TETTS      ------SITHFVTDRD------------------------PKTLQIIKNREYIQPQWIYD
Q5CXI7_CRYPI      ------GITHYVIDRPINFL--------------------KSFIDKHPNCEFIQPQWVFD
PESC_HUMAN        ---TDSRITHQIVDRPGQ-------------------------QTSVIGRCYVQPQWVFD
I3MLZ5_ICTTR      ---TDSCITHQIVDRPGQ-------------------------QTPVIGRYYIQPQWVFD
H0WSW0_OTOGA      ---TNSCITHQIVDRPGQ-------------------------QTSVIGSTLYQPQWVFD
G1LLM9_AILME      ---TDSCITHQIVDRPGQ-------------------------QTSVIGRYYVQPQWVFD
PESC_MOUSE        ---TDSCITHQIVDRPGQ-------------------------QTPIIGRYYVQPQWVFD
PESC_RAT          ---TDSGITHQIVDRPGQ-------------------------QTPIIGRYYVQPQWVFD
PESC_DANRE        ---TDETITHHIVDRPSM-------------------------DKQYINRYYIQPQWVYD
PESC_SALSA        ---TDETITHQIVDRPDM-------------------------DKQYINRYYIQPQWVFD
H3BC39_LATCH      ---TDETITHQVVDRPNP-------------------------EKPFLNRYYIQPQWVFD
PESC_XENLA        ---TDPSITHHIVDRPSI-------------------------QTQIINRYYLQPQWVFD
PESC_XENTR        ---ANPSITHHIVDRPSI-------------------------QTQIINRYYLQPQWVFD
F6Y1Q9_XENTR      ---ANPSITHHIVDRPSI-------------------------QTQIINRYYLQPQWVFD
PESC_NEMVE        ---TDESITHQIVDRPSQ-------------------------GHQFLSRYYIQPQWVAD
PESC_AEDAE        ---TDESITHQIVDRPSL-------------------------TKQYISRDYVQPQWIFD
PESC_CULQU        ---SDETITHQIVDRPSL-------------------------PKQYISRDYVQPQWIFD
PESC_ANOGA        ---SDETITHQIVDRPSM-------------------------EKQHISRDYIQPQWVFD
PESC_DROER        ---GDETITHQIVDRPSI-------------------------TTQYISRDYIQPQWVFD
PESC_DROYA        ---ADETITHQIVDRPSI-------------------------STQYISRDYIQPQWVFD
PESC_DROSE        ---GDETITHQIVDRPSI-------------------------STQYISRDYIQPQWVFD
PESC_DROSI        ---GDETITHQIVDRPSI-------------------------STQYISRDYIQPQWVFD
PESC_DROME        ---GDETITHQIVDRPSI-------------------------TTQYISRDYIQPQWVFD
PESC_DROAN        ---SDETITHQIVDRPSL-------------------------ATQYISRDYIQPQWLFD
PESC_DROGR        ---GDESITHQIVDRPSL-------------------------ATQYISRDYIQPQWIFD
PESC_DROVI        ---SDETITHQIVDRPSL-------------------------STQYISRDYIQPQWIFD
PESC_DROMO        ---SDETITHQIVDRPSL-------------------------STQYISRDYIQPQWVFD
PESC_DROPE        ---NDETITHQIVDRPSL-------------------------STQYISRDYIQPQWLFD
PESC_DROPS        ---NDETITHQIVDRPSL-------------------------STQYISRDYIQPQWLFD
PESC_DROWI        ---SDETITHQIVDRPSL-------------------------STQYISRDYIQPQWVFD
E0VTT0_PEDHC      ---KDETISYQIVDRPSF-------------------------TKQYLSRYYIQPQWVFD
E9FYB2_DAPPU      ---TDESITHQIIDRPSV-------------------------EKQYLSRYYIQPQWLFD
PESC_CAEBR        ---DSKNITHHIVDRPM--------------------------DKLEVNRLYVQPQWVFD
PESC_CAEEL        ---DSKNISHHVVDRPM--------------------------DKLEVNRLYVQPQWVFD
PESC_BRUMA        ---NDAQITHQIVDRPLLD------------------------SHKNISRCYVQPQWVFD
G4VRP5_SCHMA      ---DDPTIDYQVVDRPM--------------------------TDMKLTRYYVQPQWVFD
PESC_SCHPO        --ESDPVITHHICDRPHIS-------------------------QKYEGRIYIQPQWVYD
F4P5J1_BATDJ      --ISDSCITHHVCDRPVQTV-----------------GQLPIGVERFESREYIQPQWVYD
I1CDW4_RHIO9      --ESDETIGYQITDRPSVR-------------------------NRILSRKYVQPQWVAD
PESC_COCIM        -DETDPRITHQIVDRPPLPESALPPLPQNPGEGAEKAPRVR-PGTRMPGRMYIQPQWVWD
C0NUL9_AJECG      -DELDARITHQIVDRPQLPQTSLPPLPKNPEDGTEAAPSVR-PGTRVPGRTYIQPQWVWD
PESC_ASPFU        -DETDTRITHQIVDRPQLPESSLPAIPAASKDGSDAVQKVK-PGTRIPGRTYVQPQWVWD
PESC_ASPFC        -DETDTRITHQIVDRPQLPESSLPAIPAASKDGSDAVQKVK-PGTRIPGRTYVQPQWVWD
PESC_NEOFI        -DETDTRITHQIVDRPQLPESSLPAIPAASKDGSDAVQKVK-PGTRIPGRTYVQPQWVWD
PESC_ASPCL        -DETDPRITHQIVDRPQLPESSLPAIPAAAEEDSGAVQKVK-PGTRIPGRTYVQPQWVWD
PESC_ASPOR        -DETDTRITHQIVDRPALPESSLPAVPAASENGAGAVQKVK-PGTRIPGRTYIQPQWIWD
PESC_ASPTN        -NEADTRITHQIVDRPSLPEGALPAVPAAKE---GAVPAVR-PGTRIPGRTYIQPQWVWD
PESC_EMENI        -NEADPRITHQIVDRPSLPESSLPSIPAAATDG-GAVQKVK-PGTRVPGRTYVQPQWVWD
PESC_PHANO        -NESDPNITHQIVDRPPLANGASAAGAEDA-----ATPQVQWPHSTKPGRTYVQPQWVWD
PESC_PYRTR        -NESDPAITHQIVDRPALSNGAPASNVQETENGGAAAPKAQWPYSMMPGRTYVQPQWVWD
PESC_BOTFB        -NESDPSITHQVVDRP--PVQVQPEEDEEVKEDNQTAQRLR-PGARVPGRIYIQPQWIWD
PESC_SCLS1        -NESDPSITHQVVDRP--PMQVQPEEEEEIKEDNQTAQRLR-PGARIPGRIYIQPQWIWD
PESC_CHAGB        -DESDPSITHQIVDRP--VVQAAMNEEGDG-EDNQTSQKVG-PNHRYPGRLYVQPQWVWD
PESC_NEUCR        -DESDPSITHHIIDRP--VVQAATNEDGDG-EDNQTAQKVG-PNQRYPGRIYVQPQWVWD
C7YII3_NECH7      -DELDPAITHQIVDRP--PIQAVTEEDGDD-EDNQTSQKLA-ANRRVPGRTYIQPQWVWD
PESC_MAGO7        -NELDPNITHQIVDRP--PVTAVDNDEG---EDNQTAQKVG-G--RVPGRIYVQPQWVWD
D5GH60_TUBMM      -NSSDTSITHQIVDRP--STFPSPPPPSAAGGDNAPSTNAA-ATGRIPGRIYIQPQYVWD
PESC_ASHGO        -NVDVSKVTHQLVDRPV-------------------------VKNKVAGRTYIQPQWVFD
PESC_KLULA        -DIDLSKVTHQIVDRPV-------------------------LKNKVANRTYVQPQWIFD
PESC_YEAST        -DIDMSKVTHQIVDRPV-------------------------LKNKVAGRTYIQPQWIFD
PESC_YEAS7        -DIDMSKVTHQIVDRPV-------------------------LKNKVAGRTYIQPQWIFD
PESC_VANPO        -DIDFSKVTHQIVDRPV-------------------------LKNKVAGRTYIQPQWIFD
PESC_CANGA        -EFDLSKVTHQIVDRPV-------------------------LKHKVAGRTYIQPQWVFD
PESC_CANAL        KKLNLSNITHQIIDRPK-------------------------ILQKVPGRTYVQPQWVFD
PESC_LODEL        ASLDLNSITHQISDRKK-------------------------ILQKVPGRTYIQPQWVFD
PESC_DEBHA        KKLDLSNITHQIVDRPT-------------------------VASKVAGRTYVQPQWVFD
PESC_PICST        KKLDLSNITHQIIDRPK-------------------------ILQKVAGRTYIQPQWIFD
PESC_PICGU        KNLDLSTITHQIVDRPK-------------------------VASKVAGRTYIQPQWIFD
PESC_YARLI        QKFNLASVTHQITDRPT-------------------------LREKVPGRTYVQPQWVFD
PESC_COPC7        --ESDESITHVIIDRPVVQK-----------------EETPAERELRSRRKYVQPQWVVD
PESC_LACBS        --ETDETITHVIIDRPLVGR-----------------EESPSQRELRLRRKYVQPQWIVD
PESC_CRYNJ        --NAD-SITHVIIDRPIT-------------------VERMREMEAGRKWVWIQPQWVAD
PESC_MALGO        --VDDERVTHHILDRPVD----------------------GMSLDHAGHRVYIQPQWVVD
E3K873_PUCGT      --ESDPRITHHVIDRPEL----------------------PSSTAALPQRAFVQPQWVVD
PESC_MONBE        -GVDDPRITHHIVDRPA-------------------------VSQTFDGRHYVQPQWVYD
D7TWJ6_VITVI      ------SITYQIVDRPTQ-------------------------GHIFLSREYVQPQWVFD
B9H456_POPTR      ------SITHQIVDRPTQ-------------------------GHKYLSREYVQPQWIYD
PESC_ARATH        ------SITHHIIDKPSA-------------------------GHLYLSRVYVQPQWIYD
C5WNV4_SORBI      ------DITHQIVDRPTQ-------------------------SHVFLSREYVQPQWVFD
PESC_CHLRE        ------AVTHQIVDRPKQ-------------------------GHKFLSREYVQPQWVFD
D0NK35_PHYIT      ------RITHHLMDRPHQ-------------------------GHRYFNREYVQPQWVFD
C4M0Q1_ENTHI      -----ESITHQIGERGE---------------------------HKNIEREFIQPQWIFD
Q4UA76_THEAN      IVDSPKEATHAIVDKPLT--------------------------ELEFTCNYVQPQYVFD
Q4N2W3_THEPA      LVDSPKEATHAIVDKPLT--------------------------ELEFSCNYVQPQYVFD
A7ATP9_BABBO      LSDI-DNATHVVIDRPIT--------------------------ELDIKKDYVQPQYVFD
PESC_PLAF7        ------NITHEIYEK---DKNTIHLN----------------NPENEYKRIHIQPQYIFD
PESC_PLAYO        ------SITHEILEVSEENKNTQDSNKINN------------INEYTYKRSFIQPQYIFD
B3L4N0_PLAKH      ------RITHEILEPYGEAKQM---------------------GQEKIERMYVQPQYIFD
A5K4A1_PLAVS      ------KITHEILEPYGEAPQK---------------------GHQKMENMYVQPQYIFD
A8BZA6_GIAIC      ----PHGATHIIVDRPPHNIEGV-------------------VGARIDGCAYLQPQWCFD
A2DN41_TRIVA      ----DTSITHTITDRKVI-------------------------NERVLSRKYIQPQWVFD
                           : : :                                       ***:  *

PESC_LEIIN        CLNARLMLPVTGYRIGE-ELPPHVSPFSVSITNSAEDNAAVEQVKKDHPRIVGYVPARVH
PESC_LEIMA        CLNARLVLPVTGYRIGE-ELPPHVSPFSVSITNSAEDNAAVVQVKKDHPRIVGYVPARVH
PESC_LEIBR        CLNARQMLPVTGYRIGE-DLPPHVSPFSVSITNSAEDNAAVEQVKKDHPRIVGYVPARVH
Q38EE3_TRYB2      CLNARLLLPPNGYRIGE-ELPPHVSPFTVAITNSTEDIAAVEEARRDHPKIVSYVPKRVH
PESC_DICDI        SVNSKLLLPYSEYTIGV-IPPAHLSPFVEYE----EDSYIPARKQALDALINSKEFADAK
F0ZGY9_DICPU      SVNSKVLLPYSEYSIGV-IPPAHLSPFVEYE----DDDYIPARKAALDELINSKDFAKAI
D3BB01_POLPP      SVNSQILMDVTEYGIGV-VPPPHLSPFVEYD----ESSYIPARKQILDEMIQQKGFDAAS
A0DEJ7_PARTE      SINQLKLLSVADYAPES-TLPPHLSPFEQLN----LEEVQ--------------------
A0D1P2_PARTE      SINQLKLLSVADYAPES-TLPPHLSPFEQLN----LEEVQ--------------------
Q23RV6_TETTS      SINSGILLPVGEYAPGK-SLPPHLSPFVEYN----ETEYKPERQKQLDLLKGVEAELNEE
Q5CXI7_CRYPI      SMNESIRLPTRPYGPGE-KLPPHLSPFVDDS----TQGYIPTQRQVLDEIKESNSHKSQS
PESC_HUMAN        SVNARLLLPVAEYFSGV-QLPPHLSPFV----TEKEGDYVPPEKLKLL--------ALQR
I3MLZ5_ICTTR      CVNARLLLPVAEYFPGV-QLPPHLSPFV----SEKEGDYIPPEKLKLL--------ALQR
H0WSW0_OTOGA      SVNARLLLPVSEYFPGV-KLPPHLSPFV----SEKEGDYIPPEKLKLL--------ALQR
G1LLM9_AILME      CVNARLLLPVADYFPGV-QLPPHLSPFV----SEKEGDYIPPEKLKLL--------ALQR
PESC_MOUSE        CVNARLLLPVAEYFPGM-QLPPHLSPFV----SEKEGDYIPPEKLKLL--------ALQR
PESC_RAT          CVNARLLLPVAEYFPGV-QLPPHLSPFV----SEKEGDYIPPEKLKLL--------ALQR
PESC_DANRE        SVNAKIQLPVEEYFLGV-TLPPHLSPFV----EETEGDYVPPEKLKLM--------ALQR
PESC_SALSA        SVNAKMRLPVEDYFLGT-MLPPHLSPFV----EEKDGDYVPPEKLKLM--------ALQR
H3BC39_LATCH      CINSKMLLPVEDYFPGV-VLPPHLSPFV----EEKEGDYVPPEKLKLL--------ALQR
PESC_XENLA        CVNARLLLPVEDYFPGV-LLPPHLSPFV----HEKEGDYIPPEKLRLM--------AMQK
PESC_XENTR        CVNARMLLPVEDYFPGV-LLPPHLSPFV----QEKEGDYIPPEKLRLM--------ALQK
F6Y1Q9_XENTR      CVNARMLLPVEDYFPGV-LLPPHLSPFV----QEKEGDYIPPEKLRLM--------ALQK
PESC_NEMVE        SINQGKLLPVEEYFPGE-ELPPHLSPFV----KEEEGDYVPPERKAIM--------DQEM
PESC_AEDAE        SVNQRKLLPTNKYFIGA-VLPPHLSPFN----RDD-AIYVPPEEAAMQ--------AGDE
PESC_CULQU        CVNQRKLLPVNKYLIGA-VLPPHLSPFN----RDD-AIYVPPEEAALR--------DGVE
PESC_ANOGA        SVNQRRLLPTNKYFMGA-VLPPHLSPFT----SAN-ARYVPPEELAAR--------KAAE
PESC_DROER        CVNQRQLLPTNKYFIGE-TLPPHLSPFV----DSKRDSYIPPEEKALL--------DPSL
PESC_DROYA        CVNQRQLLPTNKYFIGE-TLPPHLSPFV----DSKRDSYIPPEEKALL--------DPSL
PESC_DROSE        CVNQRQLLPTNKYFIGE-TLPPHLSPFV----DSKRDSYIPPEEKALL--------DPSL
PESC_DROSI        CVNQRQLLPTNKYFIGE-TLPPHLSPFV----DSKRDSYIPPEEKALL--------DPSL
PESC_DROME        CVNQRQLLPTNKYFIGE-TLPPHLSPFV----DSKRDSYIPPEEKALL--------DPSL
PESC_DROAN        CVNQRQLLPTNKYFIGE-KLPPHLSPFV----DSKRDTYIPPEEKALH--------DPSL
PESC_DROGR        CVNQRQLLPTNQYFIGE-KLPPHLSPFV----DAKRDTYIPPEERALH--------DPSL
PESC_DROVI        CVNQRQLLPTNKYFLGE-PLPPHLSPFV----DAKRDTYIPPEEKALH--------DPSL
PESC_DROMO        CVNQRQLLPTNKYFLGE-ELPPHLSPFV----DAKRDTYVPPEEKALH--------DPSL
PESC_DROPE        CVNQRQLLPTNDYFLGE-TLPPHLSPFV----DSKRDSYIPPEEKALH--------DPSL
PESC_DROPS        CVNQRQLLPTNDYFLGE-TLPPHLSPFV----DSKRDSYIPPEEKALH--------DPSL
PESC_DROWI        CINQRQLLPTNKYFMGE-QLPPHLSPFV----DSKRETYIPPEEKALH--------DPSL
E0VTT0_PEDHC      SVNACQLLPVEKYLLGA-ILPPHLSPFTN---EGKDQIYIPPEEKMLK--------DPNF
E9FYB2_DAPPU      CINFRRLLPVEDYFIGA-NLPPHISPFV----TERLGDYIPPERQVLL--------ALER
PESC_CAEBR        CLNARRKLPTERYMPGV-ALPPHFSPFT----SEKAGDYIPFERLEEL--------RSMG
PESC_CAEEL        CLNARRKLPTERYMPGV-ALPPHFSPFT----SEKAGDYIPFERLEEL--------RSMG
PESC_BRUMA        SFNRRSCLSIKKYLPGA-ILPPHLSPFS----SDYDTYE---EQLNQL--------RLLS
G4VRP5_SCHMA      CLNAGRLLPTQDYLPGC-SLPPHLSPFI----GSSGTDELLDTAVMSL--------SNRG
PESC_SCHPO        SINKGILERTDLYACGA-TLPPHLSPFVKVG----ENDYDPEAELSAE--------ENDD
F4P5J1_BATDJ      SVNAGRLIKTAGYHPGD-TLPPHLSPFVSVE----EGDYIPEQDMDVD--------AEVA
I1CDW4_RHIO9      CINARKIIKPSLYEPGA-ELPAHLSPFVEAK----AGDYVPKAGIESD--------AEE-
PESC_COCIM        CVNEGKLLRHDLYAPGA-TLPPHLSPWVKAS----KGGYDPRLSLA----------EQES
C0NUL9_AJECG      CINEGKLLRPDLYAPGA-TLPPHLSPWVKPS----KRGYDPRASLA----------DQEE
PESC_ASPFU        CINEGRLVRPDLYAPGA-TLPPHLSPWVKPS----RGGYDPKASLA----------EQEE
PESC_ASPFC        CINEGRLVRPDLYAPGA-TLPPHLSPWVKPS----RGGYDPKASLA----------EQEE
PESC_NEOFI        CINEGKLVRPDLYAPGA-TLPPHLSPWVKPS----RGGYDPKASLA----------EQEE
PESC_ASPCL        CINEGKLVRPDLYSPGA-TLPPHLSPWVKPS----RGGYDPRASLA----------EQEE
PESC_ASPOR        CINEGKLLRPDLYAPGA-TLPPHLSPWVKPT----RGAYDPRASLA----------EQEE
PESC_ASPTN        CINEGKLLRPDLYAPGE-TLPPHLSPWVKPS----KGAYDPRATLA----------EQEE
PESC_EMENI        CINEGKLLRPDLYAPGA-TLPPHLSPWVNPK----KGGYDPRASLA----------EQEE
PESC_PHANO        CINQGKLLRPDLYAPGA-ELPPHLSPWVKPK----KGEYDPNLPLA----------AQQP
PESC_PYRTR        SINQGKLLRADHYSPGA-DLPPHLSPWVKPK----KGEYDPNLPLA----------AQQP
PESC_BOTFB        CINDEELKRPDLYAPGA-QLPPHLSPFVKKV----RGQYDPSAPLE----------DQER
PESC_SCLS1        CINDEELKRPDLYAPGA-QLPPHLSPFVKKV----RGQYDPSAPLQ----------DQER
PESC_CHAGB        SVNDEELKSPELYGPGA-ALPPHLSPFVKPT----QGQYDPTIPLE----------EQQS
PESC_NEUCR        CVNDEELKSPELYAPGA-ALPPHLSPFVKAA----PGQYDPTLPLE----------AQQT
C7YII3_NECH7      SVNDGELKEPHLYAPGA-SLPPHLSPFVKSV----QGAYDPTIPLE----------EQEP
PESC_MAGO7        SINDEELKEPNQYAPGA-QLPPHLSPFVKAR----AGQYDPTVPLE----------EQQT
D5GH60_TUBMM      CINSGRLLPPGEYAPGA-LLPPHLSPWVKPG----EG-YDPTAALP----------DVEH
PESC_ASHGO        SINKGELVPANLYLPGE-SLPPHLSPWGD------SVGYDPAAEL--------AEEEAES
PESC_KLULA        SINKCELVPANLYLPGE-PLPPHLSPWGD------STGYDPTAENDEDVEGSDAEEIDES
PESC_YEAST        CINKGELVPANKYLPGE-ALPPHLSPWGD------AIGYDPTAPVE------EGEEEE--
PESC_YEAS7        CINKGELVPANKYLPGE-ALPPHLSPWGD------AIGYDPTAPVE------EGEEEE--
PESC_VANPO        CLNKAKLVPANLYLPGE-TLPPHLSPWGD------ASGYDPNVSDA------EEEGED--
PESC_CANGA        CINKGELLSANLYLPGV-SLPPHLSPWGD------ALGYDPTKEVES-----EDESSDSS
PESC_CANAL        SINKQELINVNEYAAGE-TLPPHLSPWGD------AGGYDPNK--------EVEKEDGEA
PESC_LODEL        SINKGELVSVGDYAPGE-TLPPHLSPWGD------AGGYDPNAKAQVTAEAEEEEEEEEE
PESC_DEBHA        CLNKSELLPVSQYAPGE-TLPPHLSPWGD------AGGYNPDAE-------VKPTEQGEE
PESC_PICST        CINKSELLPVNKYAPGE-TLPPHLSPWGD------AGSYNPEAEK------VDQSENAEE
PESC_PICGU        SLNQGSLLPVNSYAPGE-TLPPHLSPWGD------AAGYDPESKK------TEEGEQEDE
PESC_YARLI        SINEGKLLPVSEYAPGE-RLPAHLSPWGD------AGTYDPTADV---------SDASDD
PESC_COPC7        SINAGKILLEDTYAQGK-LLPPHLSPFGEYE-----GAYDPTAATN------DADMDVET
PESC_LACBS        CINSGKILLEGPYGQGK-TLPPHLSPFGEYE-----GAYDPAAGPL------GPS-GVEQ
PESC_CRYNJ        CVNKQKIISSEGYGPGQ-LLPPHLSPWDGEG-----ELYRPWLEEQ------GEKAAEGQ
PESC_MALGO        CVNARQILPTDPYRPGQ-TLPPHLSPFVDDREVARKGGYVPEEARE------KLGLEAEY
E3K873_PUCGT      CINKSTLLPTEEYGPGK-ILPPHLSPFVDEEEVRRQGGYLPQASQP------AAAQGTAQ
PESC_MONBE        CINAKALLPTSTYTLGA-VLPPHLSPFVEEG----ADDYMPPERRA----------QLAA
D7TWJ6_VITVI      CVNARIILPTDAYMVGR-VPPPHLSPFID---NEAE-GYVPEYAEMIKRLQAAARKEVLP
B9H456_POPTR      CINARIILPTEAYMVGR-IPPPHLSPFVD---NDAE-GYIPDYAETIKRLQAAAKNEVLP
PESC_ARATH        CVNARIILPTEKYLVGR-IPPPHLSPFVD---NEAE-GYVPDYAETIKRLQAAARNEVLP
C5WNV4_SORBI      CVNARIILPTEGYLVGR-VPPPHLSPFVD---NDAE-GYIPEYAETIKRLQAAARNEVLP
PESC_CHLRE        SANFRVLMPTDLYAPGT-VPPPHLSPFVG---EADEDGYTPDFAKTVRRLQDAANAARLR
D0NK35_PHYIT      SVNNGMLLPLTRYVPGA-ELPPHLSPFVS---DQQE-GYTPEYRKELDKLKSASQ-VLRE
C4M0Q1_ENTHI      CVNENFILPCGEYTIGQ-KLPPHLSPYVNEE----EEGYVTERRKQ--------------
Q4UA76_THEAN      CLNCNVVLPTSQYSLGA-KLPHHLSPFED-------GVYVPDRKVELE------------
Q4N2W3_THEPA      CLNCNVVLPTSQYSLGS-KLPHHLSPFED-------GAYVPDRKVELE------------
A7ATP9_BABBO      CLNCGILLPVQQYAPGV-KLPHHLSPFVD-------DAEVPDRKVELD------------
PESC_PLAF7        CLNEKNILPCSDYLTEKENLPVHLSPFIE------DENFKNLVKKEEYTINKMLNQKIKE
PESC_PLAYO        CLNSNMILSCEDYNINK-TLPVHLSPFID------DDNYKDLVKKDEYTINKMLSEDPQY
B3L4N0_PLAKH      CLNRKKILPCSDYSVDVINLPVHLSPFIE------DDNFKNFVKKEEYAINKLLKEEAEK
A5K4A1_PLAVS      CLNRKKILPCSDYSVDVKNLPVHLSPFIE------DDNFKNFVKREEYAINKLLNEEAER
A8BZA6_GIAIC      SLNWGTTLPHAEYAPGA-VLPPHVSPFYDDS--ADADGYVPDRVKELDQLVREKNNMVDI
A2DN41_TRIVA      CLNKHSSLDCAPYQPGQ-VLPPHLSPWDA--------PVQPEAPEEID------------
                  . *         *       * *.**:                                 

PESC_LEIIN        EIRKLINPSYSAVDPEGKVAHLEGEYS-----------------------DEESHVAVPE
PESC_LEIMA        EIRKLINPSYSAVDPEGKVAHLEDEYS-----------------------DEESHVAVPE
PESC_LEIBR        EIRKLINPSYSPVDPEGKVAQLEDEYS-----------------------DEEMHVAVPE
Q38EE3_TRYB2      EIRKLINPQYTPTDPDGKAAELLLEEE-----------------------SDEENVAAQE
PESC_DICDI        INTNAEQ-----------------------------------------------------
F0ZGY9_DICPU      AQEEQEE-----------------------------------------------------
D3BB01_POLPP      VTLE--Q-----------------------------------------------------
A0DEJ7_PARTE      ------------------------------------------------------------
A0D1P2_PARTE      ------------------------------------------------------------
Q23RV6_TETTS      DEEDVEI-----------------------------------------------------
Q5CXI7_CRYPI      -----CL-----------------------------------------------------
PESC_HUMAN        GEDPGNL-------------NESEEE----------------------------------
I3MLZ5_ICTTR      GEDP----------------EEEEEE----------------------------------
H0WSW0_OTOGA      GEDPGNL-------------NESEEE----------------------------------
G1LLM9_AILME      GEHPGNM-------------DESEEED---------------------------------
PESC_MOUSE        GEDPGHL-------------EEEEEED---------------------------------
PESC_RAT          GEDPGNL-------------EEEEEDE---------------------------------
PESC_DANRE        GEKPQAE-------------EDEEEEG---------------------------------
PESC_SALSA        GEKPVQE-------------EDEEEE----------------------------------
H3BC39_LATCH      GEHTMEE-------------ESSEEE----------------------------------
PESC_XENLA        GENLGLD-------------EEDDDD----------------------------------
PESC_XENTR        GENPEDD-------------DDDDEE----------------------------------
F6Y1Q9_XENTR      GENPVRH-------------LENKKV----------------------------------
PESC_NEMVE        DTNQNEV-------------TEEEEV----------------------------------
PESC_AEDAE        FE--------KQER--AEGISDDEDEDFGM--------------EEARKQVQLDYALVKA
PESC_CULQU        LD--------AGARNGEERISDDEDED-----------------AEQRQQVQLDYALVKA
PESC_ANOGA        GEEEEETFEPAEVNADHEHISDDEEVQ-----------------DPENEQEMQDYALMKA
PESC_DROER        IETHAQS---DED---SEDEAEKEEEE-------------------TVDQELLDAQLQLA
PESC_DROYA        IETHAQS---DDD---SEDEAEKEEEE-------------------AVDQELLDAQLQLA
PESC_DROSE        IETHVQS---DDD---SEDEAQ-EEEE-------------------TVDQELLDAQLQLA
PESC_DROSI        IETHAQS---DDD---SEDEAQ-EEEE-------------------TVDQELLDAQLQLA
PESC_DROME        IETHAQS---DDD---SEDEAQ-EEEE-------------------TVDQELLDAQLQLA
PESC_DROAN        IETHEQS---DDD---SDEEAAQEEEE-------------------AVDQELLDAQLQLA
PESC_DROGR        IETHAQS---DDE---SEEETAAQEEEE-----------------DAVEQELLDAQLQRA
PESC_DROVI        IETHAQS---EDE---SEDDAAAEEE-------------------DTVEQELLDAQLQRA
PESC_DROMO        IETHAQS---DDE---SDEEEAAQNED------------------DTVDQELLDAQLQRA
PESC_DROPE        IETHEQS---EEE---SEEDEAEKEEE-------------------EADQELLDAQLQLA
PESC_DROPS        IETHEQS---EEE---SEEDEAEKEEE-------------------EADQELLDAQLQLA
PESC_DROWI        IETHVQS---DDDDDDSDAEADNQEEE-------------------EIEQQLLDAQLQRA
E0VTT0_PEDHC      KS---------------ENLKDYDSES---------------------------------
E9FYB2_DAPPU      GETLPAE---------EEEEEEEESED---------------------------------
PESC_CAEBR        ------------------------------------------------------------
PESC_CAEEL        ------------------------------------------------------------
PESC_BRUMA        ------------------------------------------------------------
G4VRP5_SCHMA      GLVGVAPGFGDGASIYRPPEADYLAGL---------------------------------
PESC_SCHPO        VSEAL-------------------------------------------------------
F4P5J1_BATDJ      VAEV--------------------------------------------------------
I1CDW4_RHIO9      ------------------------------------------------------------
PESC_COCIM        DGEAERQAE----EENEEEESEVEGLS--MDKEMVETENSEAGE---SDEESVDGGMDVD
C0NUL9_AJECG      EGEAERAAEAEEYEDDEQEESEEESTKSKQSKELLANLARDSGDENTSGDESVNGGMDIA
PESC_ASPFU        EGEAELD------EDSDEEMEEATSDK-----KAEAKADVGSESE--DEDESVDGGMDVA
PESC_ASPFC        EGEAELD------EDSDEEMEEATSDK-----KAEAKADVGSESE--DEDESVDGGMDVA
PESC_NEOFI        EGEAELD------EDSDEEMEEAANDK-----KAEAKADVGSESE--DEDESVDGGMDVA
PESC_ASPCL        EGEAEMA------EDSDEEMEEAADEKS----KTASKDEAESESEEDDDDESVDGGMDVA
PESC_ASPOR        EGEAEIAAEEEE-EDSDEEMEEATDGK-----KVDAKAEDSAEEENEDEDDSVDGGMDVA
PESC_ASPTN        EGEAEMAGEEEE-EESDEEMEEAPETK-----KADAKADES---ESEDEDESVDGGMDVA
PESC_EMENI        DGEADIDAE----EESDEEMEEAGEEK-----PAPTAANESEDSE----DESVDGGMDVA
PESC_PHANO        DGEAEAF------EDLADEDEDAFEVD------DDEDMDAVADRE---GSVEVGEGMDVA
PESC_PYRTR        EGEAEAF------EDEGDE-ETAFDVD------GDEDMEAIVDRE---GSVEVGEGMDVA
PESC_BOTFB        EDEELEM-------DSGSEDEADVSDE--------EAAVQKQDLVTAMDVDETAEGMDVA
PESC_SCLS1        EDEELEM-------DSGSEDEADVSDD--------ETAVKKQDPLTAMDVDETAEGMDVA
PESC_CHAGB        EGEAIDA-------EL--EDANEEAGE--------E-SDVEN-------------DMDVA
PESC_NEUCR        EAEAIEA-------DL--EDAEKGNAE--------DGSDVEN-------------DMDVD
C7YII3_NECH7      EEEAIEA-------QS--DGEG-------------EVDDTVE-------------GMDVA
PESC_MAGO7        EAEALKG-------DSDVEDEEEADGA--------EADEDDDE----AVLAIENGEMDVA
D5GH60_TUBMM      NEEVEGS----------------------------------------------DNGMQED
PESC_ASHGO        EEEEE-------------------------------------------------------
PESC_KLULA        ADEDA-------------------------------------------------------
PESC_YEAST        SESES-------------------------------------------------------
PESC_YEAS7        SESES-------------------------------------------------------
PESC_VANPO        DED---------------------------------------------------------
PESC_CANGA        EESDS-------------------------------------------------------
PESC_CANAL        EEDTD-------------------------------------------------------
PESC_LODEL        DEEEE-------------------------------------------------------
PESC_DEBHA        EEEE--------------------------------------------------------
PESC_PICST        EEEDE-------------------------------------------------------
PESC_PICGU        EEEE--------------------------------------------------------
PESC_YARLI        DEDD--------------------------------------------------------
PESC_COPC7        DGEE-----------------------------------------------------GEA
PESC_LACBS        ESE------------------------------------------------------SEA
PESC_CRYNJ        EGEEEEE-------------------------------------------------AAEQ
PESC_MALGO        VGGAD----------------------------------------------------EDE
E3K873_PUCGT      AAEVD----------------------------------------------------EEE
PESC_MONBE        AKNIHS------------------------------------------------------
D7TWJ6_VITVI      IPGAGKE-----------------------------------------------------
B9H456_POPTR      MPGVGKE-----------------------------------------------------
PESC_ARATH        LPGVGKE-----------------------------------------------------
C5WNV4_SORBI      LPGIGDE-----------------------------------------------------
PESC_CHLRE        AAGLALK-----------------------------------------------------
D0NK35_PHYIT      VGAVGEE-----------------------------------------------------
C4M0Q1_ENTHI      ------------------------------------------------------------
Q4UA76_THEAN      ------------------------------------------------------------
Q4N2W3_THEPA      ------------------------------------------------------------
A7ATP9_BABBO      ------------------------------------------------------------
PESC_PLAF7        EQ----------------------------------------------------------
PESC_PLAYO        NK----------------------------------------------------------
B3L4N0_PLAKH      NA----------------------------------------------------------
A5K4A1_PLAVS      NG----------------------------------------------------------
A8BZA6_GIAIC      TTLSVAA-----------------------------------------------------
A2DN41_TRIVA      ------------------------------------------------------------
                                                                              

PESC_LEIIN        MDMEDDVSLSGDELAEARRKPA---------------WQEEEVTEEVQRPKLSAFKVKKQ
PESC_LEIMA        MDMEDDVSLSGDELAEARRKPA---------------WQEEEVTEEVQRPKLSAFKVKKQ
PESC_LEIBR        MDMEDDVSLSGDELAEARKKPG---------------WQEEEVTEEVQRPKLSAFKVKKQ
Q38EE3_TRYB2      LDRDDDVQLSGDELQEARRRPK---------------WEDEQVTESVERTKLSALKVRQQ
PESC_DICDI        ---DDDNDNDNDNRKQVDSDGE-----------------SDDEDDEDLEHLETRYTEELR
F0ZGY9_DICPU      ---EDEEEEEKDNEEESDDE--------------------DEENEDDAEILEQRYTEELR
D3BB01_POLPP      ---DDLESDDNDDEEEKDSDEE-----------------DSDEDEDDIAAMEARYMKDIK
A0DEJ7_PARTE      ---SESEEEDGQQKE---------------------------------------------
A0D1P2_PARTE      ---SESDEEDGQQKE---------------------------------------------
Q23RV6_TETTS      ---SEDEDEEEEQVEEENEDED-----------------EEEIEAEENVEEDEEEDIDEE
Q5CXI7_CRYPI      ---SEDESTEIDELSEHDSDIE-----------------VQQAREDAYFDSIERE-----
PESC_HUMAN        ---EEEDDNNEGDGDEEGENE--------------------EEEEDAEAGSEKEEEARLA
I3MLZ5_ICTTR      ---KEEEEDIEGDGNEGGENE--------------------EEEEDVEAASEKEEEAHLA
H0WSW0_OTOGA      ---EKEEDN-EGDGNEGGENE--------------------EEE-DVETSSEKEEEARLT
G1LLM9_AILME      ---EEEADDGDGDGDEGGENEE-------------------EEEEDAEAGSEKEEEARLT
PESC_MOUSE        ---ED--DDNEGD--VAAENE--------------------EEDVEVESEEEEEEEVHLS
PESC_RAT          ---DDEGDDSEGDGDVAVENE--------------------EEVVEAESEEEEE--AHLS
PESC_DANRE        ---EEEEDDEEDE----------------------------EDDEQSEDEEEAEEEANLA
PESC_SALSA        --------DEDEE----------------------------EDDD--VDDEEFTEEKNLK
H3BC39_LATCH      ---EDSDGEDDEE----------------------------EGSEEEGDDDEREDEERLK
PESC_XENLA        -----DDDDEEED----------------------------DDDD------EEEEDKKLR
PESC_XENTR        -----DDEDEEED----------------------------DEDEDDEENEEEEEDKKLR
F6Y1Q9_XENTR      -----GQNVSRVC----------------------------LHLFCMLIIFSHITCTYLV
PESC_NEMVE        ------------------------------------------------------------
PESC_AEDAE        FREEKAEALNSG--------------------------EAKKEQAEEDNEDDDQEPDQDE
PESC_CULQU        FREEKTEALNSG--------------------------ALEEAPEEED--DDEEAPEEDE
PESC_ANOGA        FNDERTDSLNSGKKEGADDATDNGKDAAEKKQQQNGDGESDDEDEEEEDDDDGEEEEDVM
PESC_DROER        YQQETAEYKKYGGPDGVNEDEE----------------DPEDD---DEDDDEEEAEEEEL
PESC_DROYA        YQQETAEYKKYGGPDGVNEDEE----------------DPEDD---DEDDDEEE-EEEEL
PESC_DROSE        YQQETAEYKKFGGPDGVNEDEE----------------DPEDD---DDNEDDDE-EEEEL
PESC_DROSI        YQQETAEYKKYGGPDGVNEDEE----------------DPEDE---DDNEDDDE-EEEEL
PESC_DROME        YQQETAEYKKYGGPDGVNEDEE----------------DPDDE---DDNEDDDE-EEEEL
PESC_DROAN        YQQETAEYKKYGGPDGVNEDEE----------------DPEED---EEDEDEEE--EEEL
PESC_DROGR        YQEETAEYKKYGGADGVNEDEE----------------DSDDEQLYEDEDESDDDEEEEL
PESC_DROVI        YQQETAEYKKYGGADGVNEDEE----------------DSDEEDFDGEEQESDDDDEEEL
PESC_DROMO        YQQETAEYKKYGGPDGVNEDEE----------------DTDDD--FDGEQESDE-EEEEL
PESC_DROPE        YQQETAEYKKYGGPDGVNEDEE----------------DLSEED-DEEDDDEEDVDKEDV
PESC_DROPS        YQQETAEYKKYGGPDGVNEDEE----------------DLSEED-DEEDDDEEDVDKEDV
PESC_DROWI        YQQETAEYKKYGGTDGVNEDEE----------------DSVDDDDEEDEEEEEEEDVEQL
E0VTT0_PEDHC      ----------------------------------------------NSDSEENKNDLEDV
E9FYB2_DAPPU      ----------------------------------------------DSSEEEEDSKPKKN
PESC_CAEBR        -----------------------------------------KDVSELEAAIPKTMDELPM
PESC_CAEEL        -----------------------------------------KDVSDLEAAIPKTMDELPM
PESC_BRUMA        -----------------------------------------KASANVTNRMETEAENKVQ
G4VRP5_SCHMA      ---VSLAEIRGARVQAQSEGTI-------------------ESQSEVDNDLLDDSSTKKQ
PESC_SCHPO        ---DDNISGEAVP----------------------ISKKNDEPENVEQIDDAEEEDLEHQ
F4P5J1_BATDJ      ----------------------------------------------------EDLEATSQ
I1CDW4_RHIO9      ---------------------------------------------------------EEV
PESC_COCIM        IPGSDDEEEESEE-DNALRELG--------------GSDEAADVQSESEDDEEAARNQHQ
C0NUL9_AJECG      M--AEDTDESSND-GDGADKFE--------------GFDQDEDMSSESEDEEEKARSQHQ
PESC_ASPFU        G--TDDDESESE---DEEEDFD--------------GFEEE--AASESEDEEEAARTQHQ
PESC_ASPFC        G--TDDDESESE---DEEEDFD--------------GFEEE--AASESEDEEEAARTQHQ
PESC_NEOFI        G--TDDDESESE---EEEEDFG--------------GFEEEE-AASESEDEEEAARTQHQ
PESC_ASPCL        G--TDDDESESES-EEEDEDFG--------------GFEDDE-AASESEDEEEVARTQHQ
PESC_ASPOR        G--TDDDEDESE--EEMEDEFG--------------GFEE-E-AASESEDEEESARTQHQ
PESC_ASPTN        D--SDDDESESG--QE-EEDFG--------------GFDDNE-AASESEDEEEAARTQHQ
PESC_EMENI        E--TDDDDSESEEEEEEEDEFA--------------GIDDED-AGSESEDEEETARTQHQ
PESC_PHANO        DSDDDDEDDSESDAEGGADGFA--------------GFDDESEAESDIS-EGEAARLQHQ
PESC_PYRTR        DDSEDDSDDDESDEEDGPAGDE--------------D-DLDSDAESDIS-EGEAARLQHQ
PESC_BOTFB        G--SDDESDEAPD--KVDE-----------------SFGGFSEAEDSED-EEETAALRRQ
PESC_SCLS1        G--SDDESDEAPE--KADE-----------------SFGGFSEAEESED-EGETAALRRQ
PESC_CHAGB        S--DEDEEEEDEE--EFD------------------GVSVSEEEEGSED-EEESATLQRQ
PESC_NEUCR        E--AEDDEEEEEG--DEE------------------DAEEAEEEDAEED-EEESKTLQRQ
C7YII3_NECH7      N--SDEEEDGEDA--EDD------------------EFGGFSEDEQEED-EDEDDAEQRQ
PESC_MAGO7        G--SDDDDDEEDE--EADAGFG--------------GFSDAEVDDASEDDEQTSAALQRQ
D5GH60_TUBMM      L--ASDSEPEPEP----VLPLP--------------TTVTPIEGESSEEEEEEESEKNYQ
PESC_ASHGO        ---VSDEAEGDEE--------------------------ATLAAEEDEEDEAEAEELRAQ
PESC_KLULA        ---ESEEVEEDDT--------------------------AAVALNEDDED--DEDELRQQ
PESC_YEAST        ---ESEDQVEEED--------------------------QEVVAGEEDDD--DDEELQAQ
PESC_YEAS7        ---ESEDQVEEED--------------------------QEVVAGEEDDD--DDEELQAQ
PESC_VANPO        -----EDSEEGSG--------------------------AEVEENVDEDE--DDEELRAQ
PESC_CANGA        ---EIENEEEDTK--------------------------PAAITNEDDDE--DVEELAAQ
PESC_CANAL        ---EEEEEVEIED--------------------------GDEDQEDEEEE--EDEDLKAQ
PESC_LODEL        ---EEEEEIEVAD--------------------------GDEDQDDEEEEEIEDEDLKAQ
PESC_DEBHA        -----EEEIEGDE--------------------------IEEDVEEEDEE--EDEDLQAQ
PESC_PICST        ---VDEDDEDADE--------------------------DEEDEEEEDEE--EDEDLKAQ
PESC_PICGU        ------EEVEVEE--------------------------EDEN-QEEPEE--EDEDVKEQ
PESC_YARLI        ------EDIEVAP--------------------------EDYDKDDEEEE-AEAEAKQHQ
PESC_COPC7        DASGDEKESNTD---------------------------AVEAALASVAMD--DPASVRA
PESC_LACBS        DEVSEEDEEDQG---------------------------GLVQAAVEAVTG--DPVELRA
PESC_CRYNJ        DEGESEDEEEDGKEE---------------------VAAEYPPALLAAAQNPSDASLLHA
PESC_MALGO        DEDEDEDEDEDKAGSGRGDDKNVAAREQDAVEK--HDKTPARPALEALLADPTGAGLLEA
E3K873_PUCGT      DASGDEEQADETPVAGKGE-----------------AEAAERPALLAAATNAEDEDLLHA
PESC_MONBE        ---------------------------------------TDMTIDESEAPEEIDDEDIYR
D7TWJ6_VITVI      -DLDDPQNLLVEGIISRTE----------------------ANEVAERKQKMLALENQYH
B9H456_POPTR      -DLDDPQNLLVEGYISRAE----------------------ANEAVKTKKKMATLEKQYH
PESC_ARATH        -DLEDPQNLLYAGVMSRAE----------------------EAEAAKNKKKMAAQEKQYH
C5WNV4_SORBI      -DLD---NSLVAAMMDRTE----------------------SNEAAEKKRKLEMLEKQYH
PESC_CHLRE        -GADGS-EFVGEGADGAAA----------------------ADGEGAAGEDLAAAERQYA
D0NK35_PHYIT      -GASDSEEDDAEEAYAADL----------------------KAEVDGEDKESSDEEEESE
C4M0Q1_ENTHI      -----------------------------------------LDAIKNNTKYDYEEEQKKE
Q4UA76_THEAN      ------------------------------------------------------------
Q4N2W3_THEPA      ------------------------------------------------------------
A7ATP9_BABBO      ------------------------------------------------------------
PESC_PLAF7        ---YKDFSKENNNIFKS------------------------PNYKEEEEEENDDRETANL
PESC_PLAYO        ---SIQKNK-TNSENKX------------------------NNYNDNENDMSED-EYNNA
B3L4N0_PLAKH      ---QNSDTEDTQKNEHG------------------------HVNKEDEFLKSDD-EVSKE
A5K4A1_PLAVS      ---LNRDAQETTTHEHG------------------------QANKDDELLKSDD-EVSKE
A8BZA6_GIAIC      --VKGLQEHGLLE---------------------------AKDEAAAKVSSVDSLATQLA
A2DN41_TRIVA      -----------------------------------------DREVLADDDDDENAEISSE
                                                                              

PESC_LEIIN        REMNLM------------------------------------NAPTNEVVARRRQALRKA
PESC_LEIMA        REMNLM------------------------------------NAPTNEVVARRRQALRKA
PESC_LEIBR        REMNLM------------------------------------NAPTNEVVARRRQALRKA
Q38EE3_TRYB2      RELNLM------------------------------------NAPTNEAVARRRLAQQKA
PESC_DICDI        KEQSKKRKSSE------------------VDDDDEEEEDGEEDGEEEEEEEDGEEESESE
F0ZGY9_DICPU      KEQDRKRKSR--------------------DDDEESEEEDEEDSDEEESED--EEMEQDK
D3BB01_POLPP      KEEISKKRKS--------------------TEDEEEEEEEEEEEEEAEEVD-----DQEE
A0DEJ7_PARTE      ------------------------------------------------------------
A0D1P2_PARTE      ------------------------------------------------------------
Q23RV6_TETTS      EEDDDEEEEEVDGE------------EELEEDDDDEEDEEEEINYDEESDVEDIKKQDVE
Q5CXI7_CRYPI      --------------------------------------QSLSTSNEIDSIDNEHKDSSNF
PESC_HUMAN        ---------------------------------------------ALEEQRMEGK--KPR
I3MLZ5_ICTTR      ---------------------------------------------ALEDKRMEAK--KPK
H0WSW0_OTOGA      ---------------------------------------------ALEEQRMEKK--KPQ
G1LLM9_AILME      ---------------------------------------------ALEEQRMEGK--KPR
PESC_MOUSE        ---------------------------------------------ALEQHRLEEK--KPQ
PESC_RAT          ---------------------------------------------ALEQQRLGGK--KPQ
PESC_DANRE        ---------------------------------------------EMEEKRSQGKSLSVK
PESC_SALSA        ---------------------------------------------KMEDTRAQGKTLSVK
H3BC39_LATCH      ---------------------------------------------EMELKRSQGKKLNVK
PESC_XENLA        ---------------------------------------------QLENKKVGQKNLNVK
PESC_XENTR        ---------------------------------------------HLENKKVGQNKLNVR
F6Y1Q9_XENTR      ---------------------------------------------LPVLHIFYTQKLNVR
PESC_NEMVE        ------------------------------------------------------------
PESC_AEDAE        ---------------------------------------------TKKQR--SEKKQKMA
PESC_CULQU        ---------------------------------------------QTKQK--NEKKKKMA
PESC_ANOGA        ---------------------------------------------PKKQKPVSNKPKGMA
PESC_DROER        ---------------------------------------------DEKSKRLQEEKQKMS
PESC_DROYA        ---------------------------------------------DEKTKRLQEEKQKMS
PESC_DROSE        ---------------------------------------------DEKTKRLQEEKQKMS
PESC_DROSI        ---------------------------------------------DEKTKRLQEEKQKMS
PESC_DROME        ---------------------------------------------DEKTKRLQEEKQKMS
PESC_DROAN        ---------------------------------------------DEQAKRLKEEKQKMS
PESC_DROGR        ---------------------------------------------DEKAQRLLEEKQKMS
PESC_DROVI        ---------------------------------------------DEKEKRLLEEKQKMS
PESC_DROMO        ---------------------------------------------DEKTKRLQEEKKKMS
PESC_DROPE        ---------------------------------------------DEQTKRKQQEKEKMS
PESC_DROPS        ---------------------------------------------DEQTKRKQQEKEKMS
PESC_DROWI        ---------------------------------------------DDKTKRLLEEKQKMK
E0VTT0_PEDHC      ---------------------------------------------KSSDDEDPETTKGMS
E9FYB2_DAPPU      ---------------------------------------------DTTKSQVVKEKKGMK
PESC_CAEBR        ---------------------------------------------RRKEVKPEK-PKGIH
PESC_CAEEL        ---------------------------------------------RRKEVKPEK-PKGIH
PESC_BRUMA        ---------------------------------------------ERKKIQKEKEVPIIN
G4VRP5_SCHMA      NDLKTN-----------------------------------VQTKERCKLKKVSKGKEPK
PESC_SCHPO        RELEAE-----------------------------------AGGVAYSEYV--KQNSKSA
F4P5J1_BATDJ      AELEAE-----------------------------------AAGVQFSNYD--KASVPHA
I1CDW4_RHIO9      EEVEEE-----------------------------------AK-----------------
PESC_COCIM        MELEAE-----------------------------------AAGLPFTG----ADGTGTS
C0NUL9_AJECG      KELEAE-----------------------------------AAGLPFSA----SSQAESG
PESC_ASPFU        KELEAE-----------------------------------AAGLPFSS----NGATSDG
PESC_ASPFC        KELEAE-----------------------------------AAGLPFSS----NGATSDG
PESC_NEOFI        KELEAE-----------------------------------AAGLPFSS----NGATSDE
PESC_ASPCL        KELEAE-----------------------------------AAGLPFSS----NGATSDA
PESC_ASPOR        KELEAE-----------------------------------AAGLPFSS----SSAGGDS
PESC_ASPTN        KELEAE-----------------------------------AAGLPFSS----NGATDDA
PESC_EMENI        KELEAE-----------------------------------AAGLPFSS----SGAGDDA
PESC_PHANO        RELEAE-----------------------------------ATGKKLDV----KAPTKKE
PESC_PYRTR        RELEAE-----------------------------------ATGKKLEV----KKPTRKE
PESC_BOTFB        RELEAE-----------------------------------LSGVALQ-----EKEVDPR
PESC_SCLS1        RELEAE-----------------------------------LSGVALQ-----EKEVDPR
PESC_CHAGB        RELEAE-----------------------------------ISGKSVKG----DKKMDAK
PESC_NEUCR        LELEAE-----------------------------------LQGKKVQ-----NTKVDSK
C7YII3_NECH7      QELEAE-----------------------------------LTGGAVK-----SKTPNNK
PESC_MAGO7        IELEAE-----------------------------------LSGKSVKASEADKQAADPK
D5GH60_TUBMM      RELATE-----------------------------------AAGAGLPAP---SEQDMKK
PESC_ASHGO        KELELE-----------------------------------AQGVTYSEAA--DSAAP--
PESC_KLULA        KELELE-----------------------------------AQGISYSEAK--DVIDSES
PESC_YEAST        KELELE-----------------------------------AQGIKYSETS--EADKDVN
PESC_YEAS7        KELELE-----------------------------------AQGIKYSETS--EADKDVN
PESC_VANPO        KELELE-----------------------------------AQGVKYSDIK--DTEVKS-
PESC_CANGA        KELELE-----------------------------------ASGIAYSKAK--DEGLHDD
PESC_CANAL        KELELE-----------------------------------AAGVKFSEIN--EEDKKSH
PESC_LODEL        KELEME-----------------------------------VAGKKFSELQ--NAEEGSK
PESC_DEBHA        KELELE-----------------------------------AAGVKSADAQ--KKDK---
PESC_PICST        KELELE-----------------------------------AAGVKFSEIA--EKEK---
PESC_PICGU        RELEME-----------------------------------ASGVKFSDTV--EDKK---
PESC_YARLI        RELEAE-----------------------------------AKGTKADPAA--APKKA--
PESC_COPC7        AELAAE-----------------------------------AAGLDYNIFETKVKKASKS
PESC_LACBS        AELAAE-----------------------------------AAGVDYGTFEAKVKKLNKK
PESC_CRYNJ        AELEAE-----------------------------------TNGVSHSAFRAQLKEATKV
PESC_MALGO        AELEAE-----------------------------------ATG--GEDALLDLRAKHAA
E3K873_PUCGT      AEIEAE-----------------------------------ELGISHDQFQKDLRRATKE
PESC_MONBE        KELEAE-----------------------------------LRGDDTAEAP----EEPKG
D7TWJ6_VITVI      NELQLE-----------------------------------LQGVQYSSSVSN-MNKQSS
B9H456_POPTR      EELQRE-----------------------------------LQGAVMKKS------KQGS
PESC_ARATH        EELKME-----------------------------------INGSKDVVA---------P
C5WNV4_SORBI      DELKME-----------------------------------IDGVAFSSLSNKEANKSPD
PESC_CHLRE        SELAKEDEEAAMADIMMTRKARKMYNNMKQKEAAKQERVQQLESKKAKLAATGAAGPMGQ
D0NK35_PHYIT      EEEQDE------------------------------------------------SLKRKA
C4M0Q1_ENTHI      EESKK---------------------------------------IQVKDLESDFVDGLVE
Q4UA76_THEAN      -----------------------------------------------------KIIREAT
Q4N2W3_THEPA      -----------------------------------------------------KIIREAT
A7ATP9_BABBO      -----------------------------------------------------NLIREAL
PESC_PLAF7        ILNNKR------------------------------------QAALNNQLERENEDINQL
PESC_PLAYO        IRQKLR------------------------------------NDALNNQMEAENE-----
B3L4N0_PLAKH      KLQLFR------------------------------------NACLNNQMELEDED----
A5K4A1_PLAVS      KLQLLR------------------------------------NACLNNQMELEDED----
A8BZA6_GIAIC      KAHATS---------------------------------------LREELNLGCDEQEAS
A2DN41_TRIVA      IRQR------------------------------------------AMEIEHAEGIAQEL
                                                                              

PESC_LEIIN        QEKSRQTETSEARLQRKMSEVKRQEAATRKMQLQVARKKAARFYKMISGVVQGTAKKAAT
PESC_LEIMA        QEKSRQTETSEARLQRKMSEVKRQEAATRKMQLQVARKKAARFYKMVSGVVQGTAKKVAT
PESC_LEIBR        QENLRQSETPEARLQRKMSEVKRQEAVTRKMQLQVARKKAARFYKMVSGVVQGTAKKAAT
Q38EE3_TRYB2      KEARKQQETDEHRLRRKLADVKRQEVATRKMQLQVARKKAARYYKMVNGVVQGNERREKM
PESC_DICDI        SESEQVAKPVLTKKQRDELNKQKQAEEDTKLAELMIRKKDKWIYNKVKETNQQRATANQT
F0ZGY9_DICPU      PVAANTTPAQMTKKQREDLKKQKQNEEELKLAETMIRKKERWIYNKIKETNQQKVAATQN
D3BB01_POLPP      VESEEEDEKKLNKKKTD--KKKKKEQEELKLAEMMIRKKDKWLYQRIKNRNEAADRNKNK
A0DEJ7_PARTE      --HKPYQNNKKQKEKQAKQ----QEKETKKLAETMLSRKNKRLYDMIKRKEDEEKQKKNK
A0D1P2_PARTE      --HKPYQNNKKQKEKQAKQ----QEKETKKLAETMLSRKNKRLYDMIKRKEDEEQQKKNK
Q23RV6_TETTS      ESENEYDHEKEQQKKAKKQIK--ETKEQKELAKALMTRKNKKMYELIQKSKQDKLQKVKE
Q5CXI7_CRYPI      TTESELTNTKDKVNIARKLAKKRKEEEQREQQKTLLKKKHKRLLQRIEYSNKIASEKAER
PESC_HUMAN        VMAGTLK------LEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANK
I3MLZ5_ICTTR      VMAGTVK------LEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANK
H0WSW0_OTOGA      VMEGTMK------LEDKQRLAQEEESEAKRLAIMMMKKREKYLYNKIMFGKRRKIREANK
G1LLM9_AILME      VMEGTVK------LEDKQRLAQEEENEAKRLAIMMMKKREKYLYNKIMFGKRRKIREANK
PESC_MOUSE        VMAGTVK------LEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANK
PESC_RAT          VMAGTVK------LEDRQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANK
PESC_DANRE        VTPGKAK------AENRARAAEEEKAEEKRLAIMMMKKKEKYLYDKIMFGKKRKVREANK
PESC_SALSA        VTPGKVKPWETGSVGNKVRLEQEEKAEEKRLAIMMMKKKEKYLYDKIMFGKKRTTREVNK
H3BC39_LATCH      VTAGTLK------LEDRTKAAQREQGEEKRLAIMMMKKREKYLYDKIMFGKKRKVREANK
PESC_XENLA        VTAGKVK------VEDRTQVAEQEKNEEKRLAIMMMKKKEKYLYNKIMFGKKRKVREANK
PESC_XENTR        ITAGKVK------VEDRTQAAEQEKTEEKRLAIMMMKKKEKYLYNKIMFGKKRKVREANK
F6Y1Q9_XENTR      ITAGKVK------VEDRTQAAEQEKTEEKRLAIMMMKKKEKYLYNKIMFGKKRKVREANK
PESC_NEMVE        ---------------------PDMTREEKELAVAAMPRKDRRLYEKIMHSKKKKRSEVRK
PESC_AEDAE        VVSGRVFK-------ENPKEQKQLTKQEEALRAKMVKSRHKKLYRNLLDKQKKATKEANL
PESC_CULQU        VVSGKIFK-------ENPSEQKKLTKQEEALRARMVKSRHKKLYRKMLEKQKKQTKEANL
PESC_ANOGA        VRRGTVYR-------ENEAEKKIVDKQEEALRARMVKSRHRKLYSKLVEREKKADKNARL
PESC_DROER        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
PESC_DROYA        VQSGKVHK-------VNKRQLHKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
PESC_DROSE        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQSKEKEEWL
PESC_DROSI        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQSKEKEEWL
PESC_DROME        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
PESC_DROAN        VQSGKVHK-------VNKRQLHKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
PESC_DROGR        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQSKEKEEWL
PESC_DROVI        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQAKEKEEWL
PESC_DROMO        VQSGKVHK-------VNKRQLHKAEVDEHRLQARMVKPRHRNLFRKLIREKQSKEKEEWL
PESC_DROPE        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
PESC_DROPS        VQSGKVHK-------VNKRQVHKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
PESC_DROWI        VESGKVHK-------VNKRQIRKAEVDEHRLQARMVKPRHRNLFRKLIREKQTKEKEEWL
E0VTT0_PEDHC      VKPGEVFR-------ESKIKKFIEKKQEHSLKERMVPNKYRKLYQSMMEGRKKRAKEIWL
E9FYB2_DAPPU      VMRGRVEM-------PDIKGMDEEEKEHYKFRELMIRNKDKRLYRSMMKNRKSREREAKR
PESC_CAEBR        IAVGQMHK-----KSKEKFHETVEKGQELKMRELMISKKHQRVYHSMKTTFKRNRNDALK
PESC_CAEEL        IAVGQMHK-----KSKEKFHETVEKGQELKMRELMISKKHQRVYHSMKTTFKRNRNDALK
PESC_BRUMA        VNKGRMHK-----ENLQKKLN--EKGHELKLREMLIPKKRRRVYSKIKRGIKRRVHEEKK
G4VRP5_SCHMA      VTPGRAES-----KTVKMYKEKEEANAERKLRELMLPKKHKNVYKKMVHSIKRKEKEVRQ
PESC_SCHPO        KKTK-------KRQRDTLTAEEKEEKEAKELSKMMMSNKQRKLYSKLKNENSKNENYNNA
F4P5J1_BATDJ      KNAALTV---TDKKKSMLTETEQEDREAKELAKNMMSKRDKKLYDGIQKRKEKKAEHVEI
I1CDW4_RHIO9      -----------PKKR---TAAEIEEEEVKEMATVMMTSKQKKLYTKMKYGIQQKEDEKAK
PESC_COCIM        SKKSKKQ-KPLAKKHAAQKKKEQEELE---RQKMMMSRKKRKLLDKMLYSNKKKDEEAEK
C0NUL9_AJECG      TIKGKKQQAPLAKKRAAQKKKEEEELE---RQKMMMSRKKRKLLDKMIYSNKKQDAEAEK
PESC_ASPFU        SKKKASQ----AKKIAAKKRKEEEELE---RQKMMMSRKKRKLLEKMIYSNKKQSEEAAK
PESC_ASPFC        SKKKASQ----AKKIAAKKRKEEEELE---RQKMMMSRKKRKLLEKMIYSNKKQSEEAAK
PESC_NEOFI        SKKKASQ----AKKIAAKKRKEEEELE---RQKMMMSRKKRKLLEKMIYSNKKQSEEAAK
PESC_ASPCL        SKKKASQ----AKKIAAKKRKEEEEIE---RQKMMMSRKKRKLLEKMMYSNKKQSEEAAK
PESC_ASPOR        TKKKSSQ----AKKVASKKRKEEEELE---RQKMMMSRKKRKLLEKMMYSNKKQSEEAAK
PESC_ASPTN        KKKKSSQ----AKKIAAKKRKEEEELE---RQKMMMSRKKRKLLEKMMYSNKKQSEEAAK
PESC_EMENI        AAKKKSQ----AKKRAAKKRQEEEELE---RQKMMMSRKKRKLLEKMMYSNKKTAEESAK
PESC_PHANO        QNAAIRK------KFDKKKRAEEEERD---RQKMMLSNKKRKLLKRIEYGENKRDTESEN
PESC_PYRTR        ENATIRK------KAEKKKRAEEEERE---RQKMMLSNKKRKLLKRIEYGENKRDNESEN
PESC_BOTFB        AKAKTDA----KKKAAKKAKEEDEELE---RSKMMMSRKKRKILEKMVYSNKKKDAEAEA
PESC_SCLS1        VKAKTDA----KKKAAKKAKEEDEELE---RSKMMMSRKKRKILEKMVYSNKKKDAEAEA
PESC_CHAGB        TKAKLEA----KKALERKKKSEAEDLE---RAKGMLSKKKRKLFEQMQYTNNKKSAEDLK
PESC_NEUCR        TKAKLEQ----RKALEKKAREEAEDLE---RAKGMLSKKKRKLFEQMQYTNNKKSAQDEK
C7YII3_NECH7      AKAKEEA----RKALNKKAREEAEDIE---RAKGMLSKKKRKLYEQMVYTNTKKSAEDQK
PESC_MAGO7        SKAKQQK----RKELQRKAKEEAEDLE---RAKGMLSKKKRKLFEQMTYSNNKKDAESEK
D5GH60_TUBMM      QKKKNKE------KMSRQQREEEDQKE---MKKIMMSRRKRKLYEKMLYSNAKKESEVEG
PESC_ASHGO        SKKASKQ-----KKRKTEE---EEEKD---LKLIMMSNKQRKLFKKMKYSNQQKEQEIET
PESC_KLULA        SDKKKKK-----KRKATEE---EEEKD---LKLIMMSNKQRKLYKKMKYSNEKKDEKIEQ
PESC_YEAST        KSKNKK------RKVD-EE---EEEKK---LKMIMMSNKQKKLYKKMKYSNAKKEEQAEN
PESC_YEAS7        KSKNKK------RKVD-EE---EEEKK---LKMIMMSNKQKKLYKKMKYSNAKKEEQAEN
PESC_VANPO        KNKKRK------AAST-EA---EEEKD---LKMIMMSNKQRKLYKKMKYSNAKKEEKVEN
PESC_CANGA        VASKKK------RKVTDED---EEEKK---LKMIMMSNKQRKLYKKMKYSNQQKEDKIEE
PESC_CANAL        SKKSKGT-----SNKEAD-----EEKE---LKKIMMSNKQKKLFKKMQYGIEKKENREKQ
PESC_LODEL        QKKQKKN-----ASTKAALTPEEEAKE---LAKIMMTNKQKKLYKKMQYGIEKKTNRVDE
PESC_DEBHA        -KSSK-------GKKRSAE---DEEKD---LKKIMMSNKQRKLYKKMQYGIDKKEARQDD
PESC_PICST        -KAAKKA-----SKKRPAEE--DEEKE---LKKIMMTNKQRKLYKKMQYGIDKKETRTQE
PESC_PICGU        -KKPS--------KKRSAE---EEEKD---LKKIMMTNKQRKLYNKMQYGINKKETRQDE
PESC_YARLI        KRKADKM-----TKAEKQE---EEDKK---LRMIMMSNKQKKLYKKMQYSNDKKSDREAE
PESC_COPC7        KKPD-TASKA----------TEEAEKD---MNKMMMSNKQRKLYEKMKYSQQKKAAEKEK
PESC_LACBS        QMKK-PITDG----------VEDGEKD---MNKMMMSNKQKKLYEKMKYSQKKKEIEVSK
PESC_CRYNJ        HAKKVPASQK----------EKKGEED---LRKIMMSNKKAKLYEKMQYSNREKAAEKEK
PESC_MALGO        SLKSHKKKKRTSTTQSPQLSEEAEARD---MAKTLLSNKQRKLYTRMGQATGKKKEEKMR
E3K873_PUCGT      EARKARKSKTDPSKKNNKKADDPMDEDNSKMAEMLLSSKQRKLYSKMSYTKHQRAEEKRK
PESC_MONBE        NTAKRKK-----TKAEKGKAAEEERKE---MAKLMMSKRDRTLYNRIVHSKKQKQVEAQK
D7TWJ6_VITVI      VEDTEAWE-------ESLPDMQQIAEDTTTMSKVVMSRKKRRLYEAMQIGKERKRAHVNL
B9H456_POPTR      EEDAKASE-------ESVPDPKQIAEDIDTMSKLGMSRKKRGLLEAIEKRKERDTARISK
PESC_ARATH        VLAEGEGE-------ESVPDAMQIAQEDADMPKVLMSRKKRKLYDAMKISQSRKRSGVEI
C5WNV4_SORBI      AKDDTQSD-------HEADAIKQEEKDDDDIGTALMSRKQQGLYKAMKMGKEKKKEKIEL
PESC_CHLRE        VKPAAAGK-------AAAAKAAAPAKVAASGGKGAAAKGKEAPAPAKGKGTPAAKGKEAP
D0NK35_PHYIT      EPETTEKK-------SKRVKKEEEAAELKELAKTMMSKKAKRLYDRMQYGLGKKADKIQK
C4M0Q1_ENTHI      EMGEEKKG---KAKAPSVSKEAKKAEQEKKRKMAVLSGKDRRIVMKNEMLERRQTKKVNK
Q4UA76_THEAN      GKKPEERG-DKDQSNYIEDLTEELVS-------VVFGQNFYRILSSGSLEDL--------
Q4N2W3_THEPA      GKKPEEEGGDKKKDSYIEDLSEELNPELRKLRRSLMPKKHKRLLSKIEYAKERKEAEARK
A7ATP9_BABBO      RKNLPEDD-PEDLKEKRMEFQENIKQETNMVNAIFRIKSPMQTPEVKHMAKAMMSNKTRK
PESC_PLAF7        KENDTILNKQTDQTQILKTQNLKSQEQEIQRHKIVLSKKKRKLFARIDMAQKRQKATIDK
PESC_PLAYO        -NNYNPQNDLKQENDLLNVQKINNQEN-IKRNKLALSKKKRKLYNKIEQAENRQKLTIEK
B3L4N0_PLAKH      -NYVSVVDTNTNASH-AKEVQSAQTRENIQRHKIALSKKKRKLYTRIERAERKQKLAINK
A5K4A1_PLAVS      -NYVPVEETSTKDTQKAKEVQSAKTRENIQRHKILLSKKKRKLYTRIENAERKQKMTIDK
A8BZA6_GIAIC      ESESSEINPDDFYRKDTRTLDAERLSEETRMRRAMLNATKARIYDRMVKENEEIARRRQE
A2DN41_TRIVA      GVAKEQTETLEDLKQKKKQMKEKKKEERERLLAGTLPARKAKIYHELKEKEDAKLKKKKG
                                                                              

PESC_LEIIN        LEAKAKHIAEGKLHKTEDGKGLVNTRLEARRQRAEAKSKKLKERKAGNPYKKLPKWVQ--
PESC_LEIMA        LEAKAKHIAEGKLRKTEDGKGLVNKRLEARRQRAEAKGKKLKERKAGNPYKKLPKWVQ--
PESC_LEIBR        LEAKAKHIAEGKLHKTEDGKGLVNARLAARRQRAEAKGKKLKEKKADNPYKKLPKWVQ--
Q38EE3_TRYB2      LTAKAKQLSEGRISAAKDGSGLVNNKLEARRAKAEAAGKKLKEKKPSNPYSKLPKWVR--
PESC_DICDI        LLEKRNKVESGKDVNGNVK-------VAP--------------QPKKPAPLVKK------
F0ZGY9_DICPU      LMDKRNKIESGKDVNGREK-------QSQPAKQQPTKQQPAKQQPAKQQPAKSK------
D3BB01_POLPP      LLTKRERIESGKTVDGIPKSQIVKQDRGDVYDHNYIPKPVLKEKPGKPAAANKKQPTNKT
A0DEJ7_PARTE      LQEKKKMIQSKQQ-----------------------------------------------
A0D1P2_PARTE      LQEKKKMIQSKQQ-----------------------------------------------
Q23RV6_TETTS      LQKKAAKLKNKAKKN---------------------------------------------
Q5CXI7_CRYPI      LESRRKLLSKNN------------------------------------------------
PESC_HUMAN        LAEKRKAHDEAVRSEKKAKKARPE------------------------------------
I3MLZ5_ICTTR      LAEKRKAHDEAVRSEKKAKKARPV------------------------------------
H0WSW0_OTOGA      LAEKRKAHDEALRSEKKAKKAKVV------------------------------------
G1LLM9_AILME      LAEKRKAHDEAVRSQKKARKARPV------------------------------------
PESC_MOUSE        LAEKRKAHDDAVRSEKKAKRTRPV------------------------------------
PESC_RAT          LAEKRKAHDDAVRSEKKAKRTRPV------------------------------------
PESC_DANRE        LAAKRKAHDDASKADKKK-KKKKC------------------------------------
PESC_SALSA        LTAKRKAHEDASKAQKKQ-KKAKKQ-----------------------------------
H3BC39_LATCH      LAAKRKAHDNAAKAEKKKSKKSKKE-----------------------------------
PESC_XENLA        LALKRKAHDEAVKVERKKKAKKH-------------------------------------
PESC_XENTR        LALKRKAHDESVKVERKKKAKKH-------------------------------------
F6Y1Q9_XENTR      LALKRKAHDESVKVERKKKERLIPV-----------------------------------
PESC_NEMVE        LESKRKVHDEE-KAKKKLKSS---------------------------------------
PESC_AEDAE        LREKRQQIDKQKRKEQTQKRKAQRKEILA-------------------------------
PESC_CULQU        LKEKRQQIDKKQRVEQTQKRKTQRKEILAK------------------------------
PESC_ANOGA        LANKRERIEKQKRAEQMEKQKQQRKQILA-------------------------------
PESC_DROER        LRKKRRTIEASEKEARKTAKREARKEAAAAAAKASKLGK---------------------
PESC_DROYA        LRKKRRTHEANEKEARKTAKREARKEAAAAAAKASKLGK---------------------
PESC_DROSE        LRKKRRTIEASEKEARKTAKREARKEAAAAAAKASKLGK---------------------
PESC_DROSI        LRKKRRTIEASEKEARKTAKREARKEAAAAAAKASKLGK---------------------
PESC_DROME        LRKKRRTIEANEKEARKTAKREARKEAAAAAAKASKLGK---------------------
PESC_DROAN        LRKKRRTFEAGEKEARKTAKRAARKEAAAAAAKASKLGK---------------------
PESC_DROGR        LRKKRRNIDTDAKEQKKTAKRDARKAAAAAAAAAAQLGAK--------------------
PESC_DROVI        LRKKRRTIETDAKEAKKLAKREARKAAAAAAAAAAQLGAK--------------------
PESC_DROMO        LRKKRRNIDNDTKEAKKLVKREAKKAAAAAAAAASQLGVK--------------------
PESC_DROPE        LRKKRRNIDADTKEAKKAAKREARKLAAEAAARAAKLVK---------------------
PESC_DROPS        LRKKRRNIDADNKEAKKAAKREARKQAAEAAARAAKLVK---------------------
PESC_DROWI        LRKKRRNIDADAKEAKKTAKREAKKAAAEAAAKALKMA----------------------
E0VTT0_PEDHC      LNKKRKRIDAEARKEAKKKIVDN-------------------------------------
E9FYB2_DAPPU      LENKRKFHEKEEKTLKKSTSTGKELTAKWSIQPLSSTTSDTQIKKIKKDV----------
PESC_CAEBR        L-KKKAKLVKATAEA---------------------------------------------
PESC_CAEEL        L-KKKAKLAKATEA----------------------------------------------
PESC_BRUMA        LNEKRLKMLKAAD-----------------------------------------------
G4VRP5_SCHMA      LEAKRRRIDMGTG-----------------------------------------------
PESC_SCHPO        LRNRKRDIEKRKKLKVEN------------------------------------------
F4P5J1_BATDJ      LKNKKRALKKHQN-----------------------------------------------
I1CDW4_RHIO9      LEQKKKAIKKAKKATN--------------------------------------------
PESC_COCIM        LRRKRRKIEQGTKGR---------------------------------------------
C0NUL9_AJECG      LRQKRRKIEQGLKKK---------------------------------------------
PESC_ASPFU        LRSKRRKLEKGAAK----------------------------------------------
PESC_ASPFC        LRSKRRKLEKGAAK----------------------------------------------
PESC_NEOFI        LRSKRRKLEKEATK----------------------------------------------
PESC_ASPCL        LRSKRRKLEKGAAK----------------------------------------------
PESC_ASPOR        LRSKRRKLEKGAEK----------------------------------------------
PESC_ASPTN        LRSKRRKLEKTGEK----------------------------------------------
PESC_EMENI        LRSKRRKIEKGAAGK---------------------------------------------
PESC_PHANO        LRRKRTRLEKAKAAAERA------------------------------------------
PESC_PYRTR        LRRKRARVEKAKAAAEAV------------------------------------------
PESC_BOTFB        LRAKRRKIEKSGKAAPRE------------------------------------------
PESC_SCLS1        LRAKRRKIEKSGKAAPRE------------------------------------------
PESC_CHAGB        LRQKRRRLEKEKKA----------------------------------------------
PESC_NEUCR        LRAKRRKLEKEKAQKA--------------------------------------------
C7YII3_NECH7      LRAKRRKLEKEKAKGKAK------------------------------------------
PESC_MAGO7        LREKRRRIERKMAKGKAT------------------------------------------
D5GH60_TUBMM      LKRKRRRLEGERSKGKKGGKGSEEM-----------------------------------
PESC_ASHGO        LKQKKKQIAKTKAKLKKLEN----------------------------------------
PESC_KLULA        LKQKKKQIAKTKAKLAKLDKK---------------------------------------
PESC_YEAST        LKKKKKQIAKQKAKLNKLDSKK--------------------------------------
PESC_YEAS7        LKKKKKQIAKQKAKLNKLDSKK--------------------------------------
PESC_VANPO        LKKKKKQISKTKEKLTKLEGKK--------------------------------------
PESC_CANGA        LKKKKKQLAKKEKTLKKVEKK---------------------------------------
PESC_CANAL        LTKKKKQLNKKKEQLKKLN-----------------------------------------
PESC_LODEL        LTKKRKQLEKKKKQLKDV------------------------------------------
PESC_DEBHA        LTKKRRKLEKTKAELGKLNKKN--------------------------------------
PESC_PICST        LAKKKRKIEKTKAQLDKLSKK---------------------------------------
PESC_PICGU        LAKKRRKIDKKKAELQKLN-----------------------------------------
PESC_YARLI        LKKRRKLNEKKEKR----------------------------------------------
PESC_COPC7        LEQRKKQLQKAGGK----------------------------------------------
PESC_LACBS        FGISLDAVLTSSIAGDTDY-----------------------------------------
PESC_CRYNJ        LEKKRKAIEKRKAKEAKA------------------------------------------
PESC_MALGO        LEAKKRALSKNKKP----------------------------------------------
E3K873_PUCGT      LESKKKNLMKKQK-----------------------------------------------
PESC_MONBE        LTARRQQIDKEKSAKKSKK-----------------------------------------
D7TWJ6_VITVI      LKERKQKIEAAQGSEKS-------------------------------------------
B9H456_POPTR      LKERKKKLKSSEN-----------------------------------------------
PESC_ARATH        IEQRKKRLNDTQPSS---------------------------------------------
C5WNV4_SORBI      LKKRKKNADSSASSKKRH------------------------------------------
PESC_CHLRE        APAKGKGAAAAKEAPAKGGKDAAPAKRQRR------------------------------
D0NK35_PHYIT      LEDKRAKIEADKEKPKETATNEVSKKRKRKTKGKNAN-----------------------
C4M0Q1_ENTHI      FKERLAKSKEQK------------------------------------------------
Q4UA76_THEAN      ------------------------------------------------------------
Q4N2W3_THEPA      LASRKKN-----------------------------------------------------
A7ATP9_BABBO      LLTRIEVMP---------------------------------------------------
PESC_PLAF7        FMKKINKNKSK-------------------------------------------------
PESC_PLAYO        FIKKSKNKKKQK------------------------------------------------
B3L4N0_PLAKH      FINKA-------------------------------------------------------
A5K4A1_PLAVS      FINKTREKKLAGGAKKKKKN----------------------------------------
A8BZA6_GIAIC      LERRRDELRHTIELEKAKVAMGVDLRPPALPNEDEQ------------------------
A2DN41_TRIVA      AAKEDADTVRVNEEAMEEEEK---------------------------------------
                                                                              

PESC_LEIIN        ------------------------------------------
PESC_LEIMA        ------------------------------------------
PESC_LEIBR        ------------------------------------------
Q38EE3_TRYB2      ------------------------------------------
PESC_DICDI        ---------------------------SQQKQQQASKKQKK-
F0ZGY9_DICPU      ---------------------------SSSASQPVVKKQKK-
D3BB01_POLPP      TSTKSTTTTTTTKSNVSKATPAAPTATTKKPQAQPNKKPKTK
A0DEJ7_PARTE      ------------------------------------------
A0D1P2_PARTE      ------------------------------------------
Q23RV6_TETTS      ------------------------------------------
Q5CXI7_CRYPI      ------------------------------------------
PESC_HUMAN        ------------------------------------------
I3MLZ5_ICTTR      ------------------------------------------
H0WSW0_OTOGA      ------------------------------------------
G1LLM9_AILME      ------------------------------------------
PESC_MOUSE        ------------------------------------------
PESC_RAT          ------------------------------------------
PESC_DANRE        ------------------------------------------
PESC_SALSA        ------------------------------------------
H3BC39_LATCH      ------------------------------------------
PESC_XENLA        ------------------------------------------
PESC_XENTR        ------------------------------------------
F6Y1Q9_XENTR      ------------------------------------------
PESC_NEMVE        ------------------------------------------
PESC_AEDAE        ------------------------------------------
PESC_CULQU        ------------------------------------------
PESC_ANOGA        ------------------------------------------
PESC_DROER        ------------------------------------------
PESC_DROYA        ------------------------------------------
PESC_DROSE        ------------------------------------------
PESC_DROSI        ------------------------------------------
PESC_DROME        ------------------------------------------
PESC_DROAN        ------------------------------------------
PESC_DROGR        ------------------------------------------
PESC_DROVI        ------------------------------------------
PESC_DROMO        ------------------------------------------
PESC_DROPE        ------------------------------------------
PESC_DROPS        ------------------------------------------
PESC_DROWI        ------------------------------------------
E0VTT0_PEDHC      ------------------------------------------
E9FYB2_DAPPU      ------------------------------------------
PESC_CAEBR        ------------------------------------------
PESC_CAEEL        ------------------------------------------
PESC_BRUMA        ------------------------------------------
G4VRP5_SCHMA      ------------------------------------------
PESC_SCHPO        ------------------------------------------
F4P5J1_BATDJ      ------------------------------------------
I1CDW4_RHIO9      ------------------------------------------
PESC_COCIM        ------------------------------------------
C0NUL9_AJECG      ------------------------------------------
PESC_ASPFU        ------------------------------------------
PESC_ASPFC        ------------------------------------------
PESC_NEOFI        ------------------------------------------
PESC_ASPCL        ------------------------------------------
PESC_ASPOR        ------------------------------------------
PESC_ASPTN        ------------------------------------------
PESC_EMENI        ------------------------------------------
PESC_PHANO        ------------------------------------------
PESC_PYRTR        ------------------------------------------
PESC_BOTFB        ------------------------------------------
PESC_SCLS1        ------------------------------------------
PESC_CHAGB        ------------------------------------------
PESC_NEUCR        ------------------------------------------
C7YII3_NECH7      ------------------------------------------
PESC_MAGO7        ------------------------------------------
D5GH60_TUBMM      ------------------------------------------
PESC_ASHGO        ------------------------------------------
PESC_KLULA        ------------------------------------------
PESC_YEAST        ------------------------------------------
PESC_YEAS7        ------------------------------------------
PESC_VANPO        ------------------------------------------
PESC_CANGA        ------------------------------------------
PESC_CANAL        ------------------------------------------
PESC_LODEL        ------------------------------------------
PESC_DEBHA        ------------------------------------------
PESC_PICST        ------------------------------------------
PESC_PICGU        ------------------------------------------
PESC_YARLI        ------------------------------------------
PESC_COPC7        ------------------------------------------
PESC_LACBS        ------------------------------------------
PESC_CRYNJ        ------------------------------------------
PESC_MALGO        ------------------------------------------
E3K873_PUCGT      ------------------------------------------
PESC_MONBE        ------------------------------------------
D7TWJ6_VITVI      ------------------------------------------
B9H456_POPTR      ------------------------------------------
PESC_ARATH        ------------------------------------------
C5WNV4_SORBI      ------------------------------------------
PESC_CHLRE        ------------------------------------------
D0NK35_PHYIT      ------------------------------------------
C4M0Q1_ENTHI      ------------------------------------------
Q4UA76_THEAN      ------------------------------------------
Q4N2W3_THEPA      ------------------------------------------
A7ATP9_BABBO      ------------------------------------------
PESC_PLAF7        ------------------------------------------
PESC_PLAYO        ------------------------------------------
B3L4N0_PLAKH      ------------------------------------------
A5K4A1_PLAVS      ------------------------------------------
A8BZA6_GIAIC      ------------------------------------------
A2DN41_TRIVA      ------------------------------------------