CLUSTAL format seed alignment for MF_03035

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLP1_HUMAN        -------MGEE--------ANDD----KKPTTKFELERETELRFEV-E---------ASQ
CLP1_MACFA        -------MGEE--------ANDD----KKPTTKFELERETELRFEV-E---------ASQ
CLP1_BOVIN        -------MGEE--------ANDD----KKPTTKFELERETELRFEV-E---------ASQ
CLP1_MOUSE        -------MSEE--------SNDD----KKPTTKFELERETELRFEV-E---------ASQ
CLP1_RAT          -------MSEE--------SNDD----KKPTTKFELERETELRFEV-E---------ASQ
CLP1_CHICK        -------MADD--------GGDE----KKQVAKFELERETELRFEV-E---------ASQ
CLP1_XENLA        -------MSSEDLSAPGPSAPDSSWSSTGPSTKFELERETELRLEV-E---------GTD
CLP1_XENTR        -------MSSEDLSAPGPSAPDS--SFTGPSTKFELERETELRLEV-E---------GTD
CLP1_NEMVE        -------MDTE---------QDAK---SEERQQWKLEKDTELRVEVAE---------GDR
CLP1_AEDAE        -------MSDDQPG---------------PRTEYKLETDSELRFEMEN---------GND
CLP1_CULQU        -------MGEEREA---------------TRTEYKLEMDSELRFEIEN---------KNE
CLP1_ANOGA        -------MTDDKAV---------------PRTDYKLESDSELRFEIEN---------KNE
CLP1_DROME        -------MSEDQ------------------GKDYTLESDSELRFEIEQ---------KDA
CLP1_DROPS        -------MSDHQN----------------RGQDFSLEADSELRFEIEQ---------KDA
CLP1_CAEBR        -------MG------------------EEQVQEFKLKEDCELRFAAGE---------DSE
CLP1_CAEEL        -------MS------------------EENVQEFVLKEDCELRFAAGD---------DSD
CLP1_BRUMA        -------MESGKSPL------------EENLQEFTLKEDSELRFEVA----------NGD
CLP1_ARATH        -------MAYGGPS-MNPPALSGAVPGSANLKQVKLERESELRIEV-----------SEE
CLP1_ASPFU        -------MSLPGLELSQTSS--EREFVPAPPTQITLSKGSEWRFEVAF----------GT
CLP1_ASPFC        -------MSLPGLELSQTSS--EREFVPAPPTQITLSKGSEWRFEVAF----------GT
CLP1_NEOFI        -------MSLPGLELSQTSS--EREFVPAPPTQITLSKGSEWRFEVAF----------GT
CLP1_ASPCL        -------MSLPGLELSQTSA--EREFVSAPPTQISLSKGSEWRFEVAF----------GT
CLP1_ASPOR        -------MSLPGLDLTQPSA--DNQFAPAPPTQVSLSKGSEWRFEVAF----------GT
CLP1_ASPTN        -------MSLPGLDLTQPSA--EREFAPAPPSQITLSAGSEWRFEVAF----------GT
CLP1_ASPNC        -------MSLPGLDLTQPSA--DREFAPAPPSQISLPKGSEWRFEVAF----------GT
CLP1_EMENI        -------MSLPGLELTQPSA--ESQSASAPPTQINLSAGSEWRFEVAF----------GT
CLP1_COCIM        -------MSLPGLELSQQPI--EARRAPPQPTQISLPKGSEWRFEVAF----------GN
CLP1_BOTFB        -------MSIPGLGQAVHAARTAAPAAVAHTNIHELQANSEWRFEVAI----------GS
CLP1_PHANO        ------MLSLPGLNLAPQPAEPLNAPTSTVTRTQDLAANTEYRFEVSF----------AR
CLP1_MAGO7        -------MSIPGLGLIPEKP------ATSASRTYTLEPRQEYRFSVSH----------GA
CLP1_NEUCR        -------MSIPGLGQIAPQA------PTTTQRTINLRPFGEWRFSIPHQHSTFSSNSSAA
CLP1_ASHGO        ------MSAIQSTQELLQPIG-FDTPVAE-SKTVLLSPGKEWRARIPA----------ES
CLP1_KLULA        ----------------MEFVE-FSEVSET-TKTSSLPQGHEWTVQVPA----------GS
CLP1_YEAST        ------MASLPGIDEHTTSEE-LITGDNE-WHKLVIPKGSDWQIDLKA----------EG
CLP1_YEAS7        ------MASLPGIDEHTTSEE-LITGDNE-WHKLVIPKGSDWQIDLKA----------EG
CLP1_VANPO        ------MSILPGIDSTPTTNE-LFEGTNE-IHKLEIEKGYEWKVEVNA----------ES
CLP1_CANGA        ---MAEVEALPGLKQPVDDAG-LLEDANQ-VHTLVIPSGHIWRVELSS----------DE
CLP1_DEBHA        ------MSAIPGFGGDLNSNI-DEDSNLNKSSVVEINGQSEWRFEVPF----------RT
CLP1_PICGU        -------MSIPGFGGDENP---VEDLSETNATTFHLEGKSEWRFEVPF----------KT
CLP1_PICST        -------MSIPGFGAEAQV---YSETGSKGLVEVAIPEGSEWRIEVPH----------KT
CLP1_CANAL        -------MSIPGFGSAEKV------NHTASSVTLTIPQSYEWRIEVPF----------NR
CLP1_YARLI        -------MSLPGLNFSTTE-----TNTTESTHTIDLKPETEWRYEVAI----------GG
CLP1_SCHPO        ------------------------------MKEIFIPKECEWRFEVDE-----------P
CLP1_LACBS        -----------------MSETGSNE-----IKQWTLEPETEYRFELDP----------GT
E3L742_PUCGT      -------------------MTQSSS-----CRPFSLPALHEYRFELDP----------GE
CLP1_MALGO        MEDIVDDVRSSTYQVVENDACGTGKANLLSLSLLYLRSTLKWMIELDA----------GE
CLP1_USTMA        ---------------MDGQAEGSSQ-----YRRVHLPPRSEYRFELEP----------HE
G4LUE4_SCHMA      -----------------MNGVKDFTRSNPSIRSYTLEKYQMLRFEVTS------------
CLP1_CRYNJ        ----------------------MAEQQTTELTNIDLEAGSEWRFELEA----------DE
                                                     :                        

CLP1_HUMAN        SVQLELLTGMA--------EIFGTELTRNKK---FTFDAGAKVAVFTWHGCSVQLSGRTE
CLP1_MACFA        SVQLELLTGMA--------EIFGTELTRNKK---FTFDAGAKVAVFTWHGCSVQLSGRTE
CLP1_BOVIN        SVQLELLAGMA--------EIFGTELTRNKK---FTFDAGAKVAVFTWHGCSLQLSGRTE
CLP1_MOUSE        SVQLELLAGMA--------EIFGTELTRNKK---FTFDAGAKVAVFTWHGCSLQLSGRTE
CLP1_RAT          SVQLELLAGMA--------EIFGTELTRNKK---FTFDAGAKVAVFTWHGCSLQLSGRTE
CLP1_CHICK        TVQMELLTGMA--------EVFGTELTRNKK---FTFDAGAKVAVFTWHGCTVQLSGRTE
CLP1_XENLA        PVRVELVSGLA--------EVFGTELTRNKK---YTFPPGSRAAIFTWHGCTVQLWGSPD
CLP1_XENTR        PVRVELVSGLA--------EVFGTELTRNKK---YTFPPGSRAAIFTWHGCTVQLWGSPD
CLP1_NEMVE        EAIIVLLSGNA--------EVFGTELVKNKK---FTFRPGSKLAIFTWQGCSVEIQGPLE
CLP1_AEDAE        KVTVTLLNGHA--------ELYGTELVMKKP---YEFGVGAKVAIFTYHGCTIELRGKPD
CLP1_CULQU        KVTVTLMNGHA--------ELFGTELVMRKP---YEFGVGAKVAIFTYHGCTIELRGKPD
CLP1_ANOGA        KVTVVLLNGQA--------ELFGTELVVKKP---YEFVTGAKVAIFTYHGCTIELRGKPD
CLP1_DROME        KVLVSLVSGFA--------ELFGTELVKKKQ---YEFGVGAKVAIFTYQGCVLHVSGKMD
CLP1_DROPS        KVLVTLVNGFA--------ELFGTELVKKKK---YEFGMGAKVAIFTYQGCVLHVTGKMD
CLP1_CAEBR        -VVLELVHGYA--------EIFGTEIILNKK---YNFPAKSRVAVFTWKSATIELVGATE
CLP1_CAEEL        -VCLELVKGYA--------EIFGTELLLNKK---YTFPAKSRVAAFTWKGATIELVGTTE
CLP1_BRUMA        -VMLELVDGRA--------EVFGTELIQHKK---YVFPAGSRVAVFTWKKAVVELVGKTE
CLP1_ARATH        PLRLRVVNGTA--------EIFGSELPPEIW---RTFPPRMKFAVFTWYGATIEMDGVTE
CLP1_ASPFU        AIRVKLLAGTA--------ELFGTELAASQT---YT-FSGTKAAIYTWHGCTLEVSAGDT
CLP1_ASPFC        AIRVKLLAGTA--------ELFGTELAASQT---YT-FSGTKAAIYTWHGCTLEVSAGDT
CLP1_NEOFI        AIRVKLLAGTA--------ELFGTELAASQT---YT-FSGTKAAIYTWHGCTLEVSAGDT
CLP1_ASPCL        AIRVKLLSGTA--------ELFGTELAASQT---YA-FSGTKAAIYTWHGCTLEVGAGDT
CLP1_ASPOR        VIRVKLLAGTA--------ELFGTELAPSQT---YT-FSGTKGAIYTWHGCTLEVGAGDT
CLP1_ASPTN        TVRVKLISGTA--------ELFGTELAPSQT---YT-FCGTKSAIYTWHGCELEVGAGDA
CLP1_ASPNC        TVRVKLLAGTA--------ELFGTELAPSQT---YT-FSGTKAAIYTWHGCTLE------
CLP1_EMENI        TVRVKLLTGTA--------ELFGTELAPSQT---YT-FSGTKAAIYTWHGCTLEVSAGDA
CLP1_COCIM        TTRVKLLAGTA--------ELFGTELATSQT---YT-FSGTKAAIYTWHGCTLEVGAGDP
CLP1_BOTFB        SIEVKVLSGTA--------EIFGTELAVNHT---YT-FHGTKSSIYTWHGCRLEVN----
CLP1_PHANO        TLTIKLQSGTA--------EFFGTELAPSTT---YS-FQGTKGAVFTWHGCKLEIG----
CLP1_MAGO7        SITITLTRGTA--------ERDGTELALNVA---YT-LSGVKSKILSWHGANLSIEG---
CLP1_NEUCR        GVTVRLVAGTA--------ERDGTELAPNCV---YTFLPGTKSKLFTDQGCTLEINNTG-
CLP1_ASHGO        KLTIKIVYGIA--------ELFGTELANGVE---YT-IQCANIAVYSVDHVKLEWKSLDE
CLP1_KLULA        KLTVIVKYGIA--------EILGTELANDVP---YT-FQGVIVNIYAIERSMIEWKCLEE
CLP1_YEAST        KLIVKVNSGIV--------EIFGTELAVDDE---YT-FQNWKFPIYAVEETELLWKCPDL
CLP1_YEAS7        KLIVKVNSGIV--------EIFGTELAVDDE---YT-FQNWKFPIYAVEETELLWKCPDL
CLP1_VANPO        KLVIEVKSGIA--------EIFGTELANDIE---YS-FYNNKFSILAVEDVSLEWRCPEI
CLP1_CANGA        KLSLKVTAGIG--------EIFGTELANNVE---YT-FWDWKFGIYAVEELEIEWKCPQL
CLP1_DEBHA        IMKLKVVNGIG--------EIFGTELPLNVE---IS-LTGVKYAIYAPLDEGCKVEYYCV
CLP1_PICGU        ILSLKVTEGVG--------EIFGTELPLNVP---VQ-LTGVKYALYAPLPEGCTVEYSTR
CLP1_PICST        ILKFKVTEGVA--------EIFGTELPINVE---LQ-ISGTKTMVYAP------IIYETF
CLP1_CANAL        ILKFKVLTGIV--------EINGTELANNTE---IQ-LSGTKTYLYSPVTDAV-IEYVLV
CLP1_YARLI        TLHVTLKSGTA--------EIFGTELPPNKE---LS-IQG-KGSIYTWQGCQFVYTAIAG
CLP1_SCHPO        AIQIRLVSGNA--------EYFGTELALGPP---YH-FTRVKGAIYTWQGCTLEVEGEPS
CLP1_LACBS        SLAIKLIQGNA--------EVFGAELAEGKH---YLFGSECKAAVFTWQGCTIEM-RHPS
E3L742_PUCGT      SITIKLVSGTA--------EISGFELTSGQE---YTFGDEIRSAIFSWHGADLEISRKAS
CLP1_MALGO        AVAIRFVPDPI-SGHYGDAEVFGAPLVAGSQERWYTFGNEAKFAISSWGGAEVEILGAAS
CLP1_USTMA        RLSIRLVQGRTQSGEDPDAEIFGAELVGGSQERWYPFGDEAKAAVSSWRGAEIEVAGSAS
G4LUE4_SCHMA      PSGLTLVSGAA--------EVFGTELVCGWE---LQLYPGQRGTVVTFHGCKLIVQDQGV
CLP1_CRYNJ        NIALRTLSSDP-------VFINSQELTPSAW---YPIYRHTKSALYAPTSARIQVTNLPA
                     .    .             .  :                    :             

CLP1_HUMAN        --------------------------VAYVSKDTPMLLYLNTHTALEQMRRQAE----KE
CLP1_MACFA        --------------------------VAYVSKDTPMLLYLNTHTALEQMRRQAE----KE
CLP1_BOVIN        --------------------------VAYVSKDTPMLLYLNTHTALEQMRRQAE----KE
CLP1_MOUSE        --------------------------VAYVSKDTPMLLYLNTHTALEQMRRQAE----KE
CLP1_RAT          --------------------------VAYVSKDTPMLLYLNTHTALEQMRRQAE----KE
CLP1_CHICK        --------------------------VAYVSKDTPMLLYLNTHTALEQMRRQAE----RE
CLP1_XENLA        --------------------------MAYVSRDTPMLLYLNTQVGLEQMRVQAE----RE
CLP1_XENTR        --------------------------VAYVSRDTPMLLYLNTQVGLEQMRAQAE----RE
CLP1_NEMVE        --------------------------VAYKSKETPMVMYLNLHMALEQMRERAD----KH
CLP1_AEDAE        --------------------------VAYVARETPMVQYLNCNSALEHLRTKAE----ED
CLP1_CULQU        --------------------------VAYVARETPMVQYLNSNSALEHLRAKAE----QD
CLP1_ANOGA        --------------------------VAYVAKETPMVMYLNANSALEHLRNKAE----QE
CLP1_DROME        --------------------------VCYISKETPMVQYVNCHAALEQFRMEAE----EK
CLP1_DROPS        --------------------------VCYISKETPMVQYVNCHAALEQFRTEAE----EK
CLP1_CAEBR        --------------------------SAYVAESTPMVIYLNIHAAMEESRKKREEQAVSN
CLP1_CAEEL        --------------------------SAYVAESTPMVIYLNIHAAMEEVRKKREEQAAGN
CLP1_BRUMA        --------------------------SAYVAEQTPMIIYLNTHAALEQLREHAESVVMQQ
CLP1_ARATH        --------------------------TDYTADETPMVSYINVHAILDARRRFAKASTSND
CLP1_ASPFU        ISTIDGLGSGGLNGEGARGYGAGGCQSEYTAEETPMVEYANVHFALEAMRQEAKATG---
CLP1_ASPFC        ISTIDGLGSGGLNGEGARGYGAGGCQSEYTAEETPMVEYANVHFALEAMRQEAKATG---
CLP1_NEOFI        ISTIDGLGPAGLNGEGARGYGAGGCQSEYTAEETPMVEYANVHFALEAMRQEAKATG---
CLP1_ASPCL        ISTIDGLGSAGMNGGAVRGYGAGGCQSEYTAEETPMVEYANVHFALEAMRQEAKATG---
CLP1_ASPOR        GPSVDGLAPGGLSGATPRGLGAGGCQSEYTAEETPMVEYANVHFALETMRQEAKATG---
CLP1_ASPTN        ISALE--ATGMNGAATAQGFGAGGCQSEYTAEETPMVEYANVHFALETMRQEAKATG---
CLP1_ASPNC        --------------------------SEYVAEETPMVEYANVHFALETLRQEAKATG---
CLP1_EMENI        VSGLDGTTSASGRG----GLGAGGCQSEYIAEETPMVEYANVHFALEGLRAEAKASG---
CLP1_COCIM        VPI-----GPVGSAPVPPGPGNGGCQVEYIAEETPMAEYANVHFALETMRHDAKAAG---
CLP1_BOTFB        -----------------------GPCEEYTAEETPMISYINTHFALENLRSDAKKAG---
CLP1_PHANO        ----------------------GEVESDYVAEETPMMSCANLHFALELLRDQSVSSGS--
CLP1_MAGO7        ---------------------ITDHESVAGPDDAANTAHLNLHAFLQRSREAAA------
CLP1_NEUCR        ------------------GYPLEDRVVEHPPEQSPMLSYINLHFGLQDHERAAAAQAQQQ
CLP1_ASHGO        LET-----------------------TVSPD--TNMPYLYNLHFALEKMRLSSFD-----
CLP1_KLULA        LEP-----------------------KVSENK-SYHAYIYNLNFALERLRLSSFN-----
CLP1_YEAST        TTN-----------------------TITVKPNHTMKYIYNLHFMLEKIRMSNFE-----
CLP1_YEAS7        TTN-----------------------TITVKPNHTMKYIYNLHFMLEKIRMSNFE-----
CLP1_VANPO        PEQ-----------------------KLMIGENKTAKYVYNLHFSLEKMRAASFD-----
CLP1_CANGA        HDR-----------------------ELSIVENTTAHNVYNLHFALEKMRSSTFD-----
CLP1_DEBHA        SNKAN----------STSTNEDDE-ISEYISEETSMNHYMNLHFALESYRQSISEHNFVN
CLP1_PICGU        INRDQ----------APGSSDSTD-ISEYISEDTPMNQYINLHMALESYRQETADYNYLN
CLP1_PICST        KNKTV----------MS--NESEE-IVEYLSNDSVMANYINLHLVVEAMRQQVSDNNILN
CLP1_CANAL        ENKDD----------LSLVSASDEGFVEYLSDESNMDSILNLHMYLESKRQYTKDYNFSS
CLP1_YARLI        PKG--------------------LMSDYTTEDTPHMTMAINLHFALEKMRNEAEQ-----
CLP1_SCHPO        --------------------------VEYVAEETPMSTYLNLHFALEGLRLQAENAAAND
CLP1_LACBS        TE------------------------YVSEETP--MAAYANLHIAFEQMRVRA-------
E3L742_PUCGT      TE------------------------YVAEEST--VPAYMALHLALERARLGS-------
CLP1_MALGO        TE------------------------YMADEPSPTYTYCTNLHLNLERARIRAREQLRTD
CLP1_USTMA        TE------------------------YLAEEPSPVYTAYSNLHLYLERKRIQARQALRAD
G4LUE4_SCHMA      AAY----------------------IIASSEDQEIVHVYMNIHANLEVSRQKAVKEQ---
CLP1_CRYNJ        --------------------------SHYTSTSTVQPQLLNLHLAMERQRILSKRGME--
                                                            :  .:  .          

CLP1_HUMAN        E-------------------------------------------ERGPRVMVVGPTDVGK
CLP1_MACFA        E-------------------------------------------ERGPRVMVVGPTDVGK
CLP1_BOVIN        E-------------------------------------------ERGPRVMVVGPTDVGK
CLP1_MOUSE        E-------------------------------------------ERGPRVMVVGPTDVGK
CLP1_RAT          E-------------------------------------------ERGPRVMVVGPTDVGK
CLP1_CHICK        D-------------------------------------------ERGPRVMVVGPTDVGK
CLP1_XENLA        G-------------------------------------------ERGPRVLVAGPSDVGK
CLP1_XENTR        G-------------------------------------------ERGPRVLVAGPSDVGK
CLP1_NEMVE        EAV-----------------------------------------ELGPRVMVVGPTDVGK
CLP1_AEDAE        D-------------------------------------------VRGPVAMVVGPMDVGK
CLP1_CULQU        D-------------------------------------------TQGPVVMIVGPMDVGK
CLP1_ANOGA        D-------------------------------------------AQGPIVMVVGPTDVGK
CLP1_DROME        D-------------------------------------------RYGPVAMVVGPMDVGK
CLP1_DROPS        D-------------------------------------------RRGPVAMVVGPTDVGK
CLP1_CAEBR        SSK-----------------------------------------PKGPRLLLVGPQDVGK
CLP1_CAEEL        SNK-----------------------------------------AKGPRLLLVGPTDVGK
CLP1_BRUMA        -EQ-----------------------------------------ARGPSLMIVGPTDVGK
CLP1_ARATH        PES-----------------------------------------SQGPRVIVVGPTDSGK
CLP1_ASPFU        --------------------------------------------KDGPRVLILGPENAGK
CLP1_ASPFC        --------------------------------------------KDGPRVLILGPENAGK
CLP1_NEOFI        --------------------------------------------KDGPRVLILGPENAGK
CLP1_ASPCL        --------------------------------------------KDGPRVLILGPENAGK
CLP1_ASPOR        --------------------------------------------KDGPRVLILGPENAGK
CLP1_ASPTN        --------------------------------------------KDGPRVLILGPEDAGK
CLP1_ASPNC        --------------------------------------------KDGPRVLILGPEDAGK
CLP1_EMENI        --------------------------------------------RDGPRVLILGPEDAGK
CLP1_COCIM        --------------------------------------------RDGPRVLILGPEDAGK
CLP1_BOTFB        --------------------------------------------QDGPRVLIVGPNNTGK
CLP1_PHANO        -------------------------------------------AEMGPRVLVVGPEHSGK
CLP1_MAGO7        ----------------------------------RNNGGGRS-APHGPRVLVAGKTGCGR
CLP1_NEUCR        HPTHHQQ-----------------------QQQGRGAGAGVARSKPGPRVLICGPPGVGK
CLP1_ASHGO        ----------------------------------------------GPRILVVGKASSGK
CLP1_KLULA        ----------------------------------------------GPRVLIVGNASTGK
CLP1_YEAST        ----------------------------------------------GPRVVIVGGSQTGK
CLP1_YEAS7        ----------------------------------------------GPRVVIVGGSQTGK
CLP1_VANPO        ----------------------------------------------GPKVMIVGGSNTGK
CLP1_CANGA        ----------------------------------------------GPRIMVVGEKNTGK
CLP1_DEBHA        SSSQK----------------------------------------TGPRVLVVGNRHSGK
CLP1_PICGU        PSSPR----------------------------------------SGPRVLILGNRSAGK
CLP1_PICST        PTELQ----------------------------------------SGPRVLIVGNGNSGK
CLP1_CANAL        SIDQQQ---------------------------------------SGPKVLIIGSKYSGK
CLP1_YARLI        -KPKDV---------------------------------------AGPRVLIAGPPNSGK
CLP1_SCHPO        ES------------------------------------------SYGPCVCLIGPRSCGK
CLP1_LACBS        ----------------LAKFHGSPLPP----------GDEPPTAPEPPRVLVLGPENSGK
E3L742_PUCGT      ----------------VAPKHFVPHVEPPPRLQVSSDAQEPDEEKHGPHVMVIGSLASGK
CLP1_MALGO        PSL-----QKILEDMDVSERTIPASYEQHG--AGASGSDLYRAAGQGPRVMIVGPESAGK
CLP1_USTMA        AKLLTTLASSVLDPSYIAPRTTDPNTETESDPSGTAAATVYRPEGQGPRVMILGPESAGK
G4LUE4_SCHMA      --------------------------------------------SRGPRVLVCGQESVGK
CLP1_CRYNJ        --------------------------------------------QRGPRVMIMGPQSSGK
                                                                 *   : *    *:

CLP1_HUMAN        STVCRLLLNYAVRLG---------------------------------------------
CLP1_MACFA        STVCRLLLNYAVRLG---------------------------------------------
CLP1_BOVIN        STVCRLLLNYAVRLG---------------------------------------------
CLP1_MOUSE        STVCRLLLNYAVRLG---------------------------------------------
CLP1_RAT          STVCRLLLNYAVRLG---------------------------------------------
CLP1_CHICK        STVCRLLLNYAVRLG---------------------------------------------
CLP1_XENLA        STLCRLLLNYAVRRG---------------------------------------------
CLP1_XENTR        STLCRLLLNYAVRRG---------------------------------------------
CLP1_NEMVE        STVCQLLLNYAVRMG---------------------------------------------
CLP1_AEDAE        STLCRIFLNYAVRLG---------------------------------------------
CLP1_CULQU        TTLCRIFLNYAVRLG---------------------------------------------
CLP1_ANOGA        TTLCRIFLNYAVRLG---------------------------------------------
CLP1_DROME        STLCRILLNYAVRVG---------------------------------------------
CLP1_DROPS        STLCRILLNYAVRVG---------------------------------------------
CLP1_CAEBR        TTVSRILCNYSVRHG---------------------------------------------
CLP1_CAEEL        TTVSRILCNYSVRQG---------------------------------------------
CLP1_BRUMA        TTVCRILCNYAVRVG---------------------------------------------
CLP1_ARATH        STLTKMLLSWAAKQG---------------------------------------------
CLP1_ASPFU        TSVAKILTAYATKVG---------------------------------------------
CLP1_ASPFC        TSVAKILTAYATKVG---------------------------------------------
CLP1_NEOFI        TSVAKILTAYATKVG---------------------------------------------
CLP1_ASPCL        TSLAKILTAYATKVG---------------------------------------------
CLP1_ASPOR        TSVAKILTAYATKVE---------------------------------------------
CLP1_ASPTN        TSLSKILTAYATKIG---------------------------------------------
CLP1_ASPNC        TSLSKILTAYATKVG---------------------------------------------
CLP1_EMENI        TSLSKILTAYAVKVG---------------------------------------------
CLP1_COCIM        TSLAKILTGYATKMG---------------------------------------------
CLP1_BOTFB        TSLAKLLTAYAVRMG---------------------------------------------
CLP1_PHANO        TSLVKVMTSYAAKTS---------------------------------------------
CLP1_MAGO7        TSLVRTLAAWATRTG---------------------------------------------
CLP1_NEUCR        TSLAKLLAALATRMG---------------------------------------------
CLP1_ASHGO        TSLCKILCSYALKSKA--------------------------------------------
CLP1_KLULA        SSLAQMLCSYALKIRH--------------------------------------------
CLP1_YEAST        TSLSRTLCSYALKFNA--------------------------------------------
CLP1_YEAS7        TSLSRTLCSYALKFNA--------------------------------------------
CLP1_VANPO        TALARTLCSYAIKYKS--------------------------------------------
CLP1_CANGA        TALCRTLCSYAIKNKP--------------------------------------------
CLP1_DEBHA        TSLVKTLASYGCKMD---------------------------------------------
CLP1_PICGU        TALARILSSYAYKMD---------------------------------------------
CLP1_PICST        TSLAKLLSAYAIKSD---------------------------------------------
CLP1_CANAL        TTVSKILSAYANKMN---------------------------------------------
CLP1_YARLI        TSLAKILLAYATKCD---------------------------------------------
CLP1_SCHPO        TSVLKILESYALKQS---------------------------------------------
CLP1_LACBS        TTVCKILTNYAVRAGQNWSP----------------------------------------
E3L742_PUCGT      STLIKTLANWAVKSGRTKVEGPG-------------------------------------
CLP1_MALGO        TSLIKFLANYALRSPALANVKEGDDASRRAKHRSEPEIHPGPDVAHDDDDDDDVENRKDD
CLP1_USTMA        TSLVKLLANYALRSPAVASLGKGEAAKVAESLRTG-----GDGIIYPNMEDNLSEEAKKQ
G4LUE4_SCHMA      STLCRTLASYAARRK---------------------------------------------
CLP1_CRYNJ        TTVMKNLVNLALGTGMG-------------------------------------------
                  ::: : :   .                                                 

CLP1_HUMAN        ---------------------------------RRPTYVELDVGQGSVSIPGTMGALYIE
CLP1_MACFA        ---------------------------------RRPTYVELDVGQGSVSIPGTMGALYIE
CLP1_BOVIN        ---------------------------------RRPTYVELDVGQGSVSIPGTMGALYIE
CLP1_MOUSE        ---------------------------------RRPTYVELDVGQGSVSIPGTMGALYIE
CLP1_RAT          ---------------------------------RRPTYVELDVGQGSVSIPGTMGALYIE
CLP1_CHICK        ---------------------------------RRPTFVELDVGQGSVSIPGTMGALYIE
CLP1_XENLA        ---------------------------------RRPTLVELDVGQGSVSVPGTMGALCVE
CLP1_XENTR        ---------------------------------RRPTLVELDVGQGSVSVPGTVGALCVE
CLP1_NEMVE        ---------------------------------RRPISVDLDVGQGTASVPGSMGALLLE
CLP1_AEDAE        ---------------------------------RRPIYVDLDVGQGGIAIPGTIGALLVE
CLP1_CULQU        ---------------------------------RRPIYVDLDVGQGGIAIPGTIGALLVE
CLP1_ANOGA        ---------------------------------RRPIFVDLDVGQGGIAIPGTIGALLVE
CLP1_DROME        ---------------------------------RRPLYADLDVGQGSIAISGSVATILIE
CLP1_DROPS        ---------------------------------RRPLYADLDVGQGAIAISGNVATILIE
CLP1_CAEBR        ---------------------------------RTPILVDLDVGQNSVSVPGSVAALLVQ
CLP1_CAEEL        ---------------------------------RTPIFVELDVGQNSVSVPGTVAAVLVQ
CLP1_BRUMA        ---------------------------------RTPIFVDLDVGQGSISVPGTVGALYIE
CLP1_ARATH        ---------------------------------WRPTFVDLDVGQGSITIPGSIAAAPIE
CLP1_ASPFU        ---------------------------------RQPIVVNLDPAEGMLSVPGTLTATAFR
CLP1_ASPFC        ---------------------------------RQPIVVNLDPAEGMLSVPGTLTATAFR
CLP1_NEOFI        ---------------------------------RQPIVVNLDPAEGMLSVPGTLTATAFR
CLP1_ASPCL        ---------------------------------RQPIVVNLDPAEGMLSVPGSLTATAFR
CLP1_ASPOR        ---------------------------------RQPIVVNLDPTEGMLSVPGTLTATAFR
CLP1_ASPTN        ---------------------------------RQPIVVNLDPAEGMLSVPGTLTATAFR
CLP1_ASPNC        ---------------------------------RQPLVVNLDPTEGMLSVPGTLTATAFR
CLP1_EMENI        ---------------------------------REPIVVNLDPTEGMLSVPGTVSATAFR
CLP1_COCIM        ---------------------------------RQPLVVNLDPSEGMLSVPGALTATAFR
CLP1_BOTFB        ---------------------------------RQPIVVNTDSREGMLSIPGSLTAAAFK
CLP1_PHANO        ---------------------------------RQPMVVNLDPRQGMLSIPGSFSAAAYS
CLP1_MAGO7        ---------------------------------AQPMVVDADPGEGLLTLPGTLSAAVFG
CLP1_NEUCR        ---------------------------------SQPLVANLNPTDGLLCLPGTLGAAVFG
CLP1_ASHGO        ---------------------------------YTPIYVNLNPQEGAFSPPGFLTATPIS
CLP1_KLULA        ---------------------------------YQPLLVNLNPQDGVFSLPGSITATPIS
CLP1_YEAST        ---------------------------------YQPLYINLDPQQPIFTVPGCISATPIS
CLP1_YEAS7        ---------------------------------YQPLYINLDPQQPIFTVPGCISATPIS
CLP1_VANPO        ---------------------------------YQPMFINLNPEEGIFSVAGCLTATPIS
CLP1_CANGA        ---------------------------------YQPMFVNLNPVEPIFSPPGCVTAVPIS
CLP1_DEBHA        ---------------------------------RSPILVNLNPRDGVFSVPGSLTATPIS
CLP1_PICGU        ---------------------------------HHPVLVNLNPRDGVFSLPGSLTATPIS
CLP1_PICST        ---------------------------------STPVLVNLNPRDGVFSLPGSLTATPIS
CLP1_CANAL        ---------------------------------NTPVLVNLQPRDGVFALPGSLTATPIS
CLP1_YARLI        ---------------------------------RKPIYISLDPTSVNLGPPGGVHAVQIT
CLP1_SCHPO        ---------------------------------RHPICVNLDPTQPMLALPGSISAFHNA
CLP1_LACBS        ------------------------------------LLVNVDPSEGAWSAPGALSIAPVH
E3L742_PUCGT      -----------------------------------LLLVNLNPNDGGWTVPGTFSVAPLN
CLP1_MALGO        EESGINDMKHPKNRKKHSSADSQAKKTLSDITGWWPMIVALDPSEGAVPVPGCVSAIPLT
CLP1_USTMA        K---------------------REEEKRSDITGWWPVVVNLDPSDGAPPLPCCLSALPLS
G4LUE4_SCHMA      ---------------------------------HKPILVDVNVGLNQVCIPATIAAISVT
CLP1_CRYNJ        ---------------------------------WTPGAIGLDPSSPPNLIPGSLSISTPS
                                                           :        .  .      

CLP1_HUMAN        ----------RPADVEE----------------GFSIQAPLVYHFGSTTPGT-NIKLYNK
CLP1_MACFA        ----------RPADVEE----------------GFSIQAPLVYHFGSTTPGT-NIKLYNK
CLP1_BOVIN        ----------RPADVEE----------------GFSIQAPLVYHFGSTTPGT-NIKLYNK
CLP1_MOUSE        ----------RPADVEE----------------GFSIQAPLVYHFGSTTPGT-NIKLYNK
CLP1_RAT          ----------RPADVEE----------------GFSIQAPLVYHFGSTTPGT-NIKLYNK
CLP1_CHICK        ----------RPADVEE----------------GFSLQAPLVYHFGSTTPGT-NIKLYNK
CLP1_XENLA        ----------RPADVEE----------------GFSAQAPLVYHFGSTTPGT-NIKLYNK
CLP1_XENTR        ----------RPADVEE----------------GFSAQAPLVYHFGSTTPGT-NIKLYNK
CLP1_NEMVE        ----------RPADIEE----------------GFSLQAPLVYLFGHTSPSP-NEKLYNM
CLP1_AEDAE        ----------RPAPVAE----------------GFSQQAPLVYHFGHTNPSE-NDVFYDA
CLP1_CULQU        ----------RPAPVAE----------------GFSQQAPLVYHFGHTSPSD-NDVFYGV
CLP1_ANOGA        ----------RPAPVAE----------------GFSQQAPLVYHYGHSTPSA-NSTFYDV
CLP1_DROME        ----------RPANVEE----------------GFAKTAPLVYHFGHKSPSG-NSVLYNA
CLP1_DROPS        ----------RPASVEE----------------GFPKTAPLVYHFGHKSPSG-NSVLYNA
CLP1_CAEBR        ----------KTADVVD----------------GFERNMPIVYNFGHSSPSQ-NLSLYET
CLP1_CAEEL        ----------KTADVID----------------GFERNQPIVFNFGHTSPSA-NLSLYEA
CLP1_BRUMA        ----------KTADVVE----------------GFDKKAPLVYHFGNLSPGS-NIPLYDL
CLP1_ARATH        ----------MPLDPVE----------------GFPLDMALVYYYGHASPNM-NVELYKA
CLP1_ASPFU        ----------TMMNVEE-----GWGSSPMSGPSAVPVKLPLVYFYPLQNPLEAEGAVYRP
CLP1_ASPFC        ----------TMMNVEE-----GWGSSPMSGPSAVPVKLPLVYFYPLQNPLEAEGAVYRP
CLP1_NEOFI        ----------TMMNVEE-----GWGSSPMSGPSAVPVKLPLVYFYPLQNPLEAEGAVYRP
CLP1_ASPCL        ----------TMMNVEE-----GWGSSPMSGPSAIPVKLPLVYFYPLQNPLEAGASVYRP
CLP1_ASPOR        ----------TMMDVEE-----GWGSSPMSGPSAVPVKLPLVYFYPMQNPLEAEGSVYRP
CLP1_ASPTN        ----------TMMDIEE-----GWGSSPMSGPSAVPVKLPLVYFYPMQNPLEGDGSVYRS
CLP1_ASPNC        ----------TMIDVEE-----GWGSSPMSGPSAVPVKLPLVYFYPMQNPLEADGSVYKA
CLP1_EMENI        ----------AMLDVEE-----GWGSSPMSGPSAVPVKLPLVYFYPIVNPLEAEGSVFRP
CLP1_COCIM        ----------SMIDVEE-----GWGSSPMSGPSPIPVKLPLVYFYGLPACLDGDGSYYKA
CLP1_BOTFB        ----------SIVDVEE-----GWGSSSTSGPSPVPVKLPLCYYYGLPSPED-NVKLFKP
CLP1_PHANO        ----------SIVDIEE-----GWGSSPISGPSPIPVKMPLVYHYGLKDPEE--GKVFKP
CLP1_MAGO7        ----------TVMDVAS-EGGWGAAPS--SGPSAVPVKLPLVFYYGRR-RVEEDRDLYKG
CLP1_NEUCR        ----------TLMDVEEPAGGFGVTNTPISGPSAVPVKNPLTFYFGHE-KVEDDVDMWRQ
CLP1_ASHGO        ----------DILDVES---TMWGQSMTTGATKLHN-KQPMVKNFGLEMIAE-NRPLYME
CLP1_KLULA        ----------ELLDVES---SIWGQSITTGATKLHN-KQPLVKNYGLENIRD-NRPLYLS
CLP1_YEAST        ----------DILDAQL---PTWGQSLTSGATLLHN-KQPMVKNFGLERINE-NKDLYLE
CLP1_YEAS7        ----------DILDAQL---PTWGQSLTSGATLLHN-KQPMVKNFGLERINE-NKDLYLE
CLP1_VANPO        ----------DILDVQS---TIWGHSMTSGATMLHS-KQPLVKTFGLEHIKE-NQDLYLA
CLP1_CANGA        ----------STLDAQL---PRWGETMTSGATRLHG-KQPIIKNFGFETIAE-NRSLYKL
CLP1_DEBHA        ----------DAFDLES---VNGWGGSTTSGSTFHNPKQPLVKNYGFTSHSD-NLDLYKY
CLP1_PICGU        ----------DTFDLES---ANGYGGTTTSGSAVHNPKQPVVKNFGFLSPTD-NLELYKY
CLP1_PICST        ----------DSLDVES---ANGWGFTTTSGSLFHNPKQPIVKNYGFVDVNE-NLDLYKY
CLP1_CANAL        ----------DSFDVES---CNGYGLTTTSGTLVHNPKQPIVKNFGMADFND-NVDFYKL
CLP1_YARLI        ----------DLLDVET---YGGFGSSEISGPQKLQPLILLSKYFGLEKTTD-NFKLFKR
CLP1_SCHPO        ----------TILDIQD---ADGFGASTSTGPTHVLAKVPLVYNFGLDSPLD-NPKLYKL
CLP1_LACBS        ----GPIPTYSPANPLGSAATSAPMAMSSNALL------PVVYWYGHPDTKR-NPLLMDR
E3L742_PUCGT      ----VSIPTTTPVLPFGSTPTTGPAPSTPNPALFAPSLNALSFFYGHTQFSR-NTGLAEV
CLP1_MALGO        PMPTNWLPSPSPALPYGITTQTTGTLPPSVSTV--QSVMPISLWMGKENVRE-NERHSRR
CLP1_USTMA        PLPLASLPSASPAYAFGTNTSTTGAIPPGTSTA--HGVAPLSLWLGKENLRE-NERHFRR
G4LUE4_SCHMA      ----------KPYDLME---------------GWSLEEDPLVFCFGHTDPAS-NLNLFRE
CLP1_CRYNJ        ----------HPIPTHHLAHPLGSPPASTAANTISGDVETASWWLGALEPTNKNAEVWRV
                                                                              

CLP1_HUMAN        ITSRLADVFNQRCEVN--RRASVSGCVINTCGWVKGS-----------GYQALVHAASAF
CLP1_MACFA        ITSRLADVFNQRCEVN--RRASVSGCVINTCGWVKGS-----------GYQALVHAASAF
CLP1_BOVIN        ITSRLADVFNQRCEVN--RRASVSGCVINTCGWVKGS-----------GYQALVHAASAF
CLP1_MOUSE        ITSRLADVFNQRCEVN--RRASVSGCVINTCGWVKGY-----------GYQALVHAASAF
CLP1_RAT          ITSRLADVFNQRCEVN--RRASVSGCVINTCGWVKGY-----------GYQALVHAASAF
CLP1_CHICK        ITSRLADVFNQRCEVN--RRASVSGCVINTCGWVKGS-----------GYQALVHAASAF
CLP1_XENLA        LTSRLAHVFNLRCDSN--RRASVSGCLINTCGWVKGS-----------GYQALIHAASAF
CLP1_XENTR        LTSRLAHVFNLRCDSN--RRASVSGCLINTCGWVKGS-----------GYQALIHAASAF
CLP1_NEMVE        LSSKIADIVFQRFERN--KKACASGCVINTCGWVTGM-----------GYRIIVHAATAF
CLP1_AEDAE        LITKLAETTLERLQAN--KRAKHSGMIINTCGWVKQG-----------GYHHILHAAKEF
CLP1_CULQU        LISKLAETTLERLEAN--KKAKYSGMIINTCGWVKGG-----------GYRHILHAIKAF
CLP1_ANOGA        LISKLAETTLERLQAN--KKAKSSGMIINTCGWVKGS-----------GYSHILHTVEAF
CLP1_DROME        VVSKMAEVTLQSLNSN--KRTKSSGIIINTCGWVKGS-----------GYAHLLHAAKAY
CLP1_DROPS        VVSKMAEVTLQSLNGN--KRTKSSGIIVNTCGWVKGH-----------GYAHLLHAARAY
CLP1_CAEBR        LFKALASTINSQIEQN--DEARLGGMIINTCGWVDGE-----------GYKCIVKAASAF
CLP1_CAEEL        LFKEMATTLNAQIQEN--DEAKIGGMIINTCGWVDGE-----------GYKCIVKAASAF
CLP1_BRUMA        LVKQLAEAISKRRKSS--QDATYGGVIINTCGWVKGE-----------GYACLVNAAEEF
CLP1_ARATH        LVKELAQVLEKQFVGN--PESRAAGMVINTMGWIEGI-----------GYELLLHAIDTF
CLP1_ASPFU        IVSRLALSVTGRMAED--EDTRETGIIVDTPGILSAGK-------P-GSLEIINHIVTEF
CLP1_ASPFC        IVSRLALSVTGRMAED--EDTRETGIIVDTPGILSAGK-------P-GSLEIINHIVTEF
CLP1_NEOFI        IVSRLALSVTGRMAED--EDTRETGIIVDTPGILSAGK-------P-GSLEIINHIVTEF
CLP1_ASPCL        IVSRLALSVTGRMAED--EDTRETGIIVDTPGILSQGK-------A-GSLEVINHIVTEF
CLP1_ASPOR        IVSRLALSVMGRMAED--EEARETGIIVDTPGALSQGK-------P-GSLEMINHIVTEF
CLP1_ASPTN        IVSRLALSVMGRMAED--EDSRETGIIVDTPGVLSQSK-------A-GSLEMINHIVTEF
CLP1_ASPNC        IVSRLALSVTGRMAED--EDARETGIIVDTPGILSQSK-------A-GNVEMINHIVTEF
CLP1_EMENI        IVSRLALSVMGRMAED--EDAKETGIIVDTPGILSQSR-------A-GALEMINHIVTEF
CLP1_COCIM        IVSRLALAVTGRMAED--SDAREAGVIIDTPGIIGQGK-------G-ASEDVIHHIVTEF
CLP1_BOTFB        VVTRLALAATSRLQDD--AVCRETGMIIDTPGVISQGK-------G-G-YDLISHIVSEF
CLP1_PHANO        LVTRMALAVTSRLEED--KLSKQAGFIIDSSGAISQGR-------N-GVYENIEHIVSEF
CLP1_MAGO7        VVNSISSAISARAADD--PAVRSAGMLIDTP-PYVEG----------KGADVLIHIAEEL
CLP1_NEUCR        MTERLAVLARRKFERN--RDVRVAGLLVDTA-PVEAGD-------K-EGQELLGWAVRQF
CLP1_ASHGO        VLGQLAQTVDGRLKND--PLVRRSGVIVDSPPLQHLD----------ESYTELEVAITKF
CLP1_KLULA        TITQLASGVQQRLKND--PIVRRSGVIIDTPKLSHLDT---------EDWSEVGHMIEQF
CLP1_YEAST        CISQLGQVVGQRLHLD--PQVRRSGCIVDTPSISQLD----------ENLAELHHIIEKL
CLP1_YEAS7        CISQLGQVVGQRLHLD--PQVRRSGCIVDTPSISQLD----------ENLAELHHIIEKL
CLP1_VANPO        TLKQLSEVVKLRLQND--VLVHRSGCIIDTPPISVMD----------DDLTELTTTFKEF
CLP1_CANGA        VTKKLFETVSERLQND--SLVHRSGCIVDSPPLENCD----------DEYSELVEAIVGL
CLP1_DEBHA        QISKLGVAVVSRMEED--IAVKNSGLLIDTPPLSIKD------------FTIIENIVSDF
CLP1_PICGU        QVSKLGVVVMSRLEED--ADVRNSGVIIDTPALNIKD------------INVIENIVSDF
CLP1_PICST        QVSKLGVTVLSRLEED--IACRNGGVIIDTPALGIKD------------FTVIENIVSDF
CLP1_CANAL        LIEKLGIAVLSRLDQD--LNIKNSGVIIDTPALTSKN------------FDIVESMVSNF
CLP1_YARLI        SVAQLAVPVLSKLAHD--VEAQKSGLIIDTPRVPGNQN-------KTIEVNLLTDVVSDF
CLP1_SCHPO        SLSRLALAVHSRMSQS--KDARVSGCLVDTSSIQENAE-------K--YQDILHSIITDF
CLP1_LACBS        LIRNLGENVNDRFELD--QEGRSSGVIVDTPSSFASSST-----SNDHRQKLIKACMDAF
E3L742_PUCGT      LIKRVGSALETRIEKSGETALWRGGLLIDTPAEF----------SEKAKGGLVKSVVRAL
CLP1_MALGO        VIDWLAYYIEKRLVKD--WRARMSGLLLDMPGVI---TA-----DARTRYGFIQYCVRAF
CLP1_USTMA        VVDWLAEGVERRFARD--FRSRMSGLIIDTPGVI---TA-----DARNKYAFIQHCVKAF
G4LUE4_SCHMA      QVNRLAELINIRSEND--MSIFTSGCIINMSGFRKDDSDGGS--SKEKGIQAIRTTAAAF
CLP1_CRYNJ        LVEHMAEAWGMRCEKD--KIANISGLFLDTPAAFTVPTLGTKKDDPKARYTLVSHAIQAF
                      :          .        * .::                       :       

CLP1_HUMAN        EVDVVVVLDQERLYNELKRDLP--------------------HFVRTVLLPKSGGVVERS
CLP1_MACFA        EVDVVVVLDQERLYNELKRDLP--------------------HFVRTVLLPKSGGVVERS
CLP1_BOVIN        EVDVVVVLDQERLYNELKRDLP--------------------HFVRTVLLPKSGGVVERS
CLP1_MOUSE        EVDVVVVLDQERLYNELKRDLP--------------------HFVRTVLLPKSGGVVERS
CLP1_RAT          EVDVVVVLDQERLYNELKRDLP--------------------HFVRTVLLPKSGGVVERS
CLP1_CHICK        EVDVVVVLDQERLYNELKRDLP--------------------HFVRTVLLPKSGGVVERS
CLP1_XENLA        EVDVVLVLDQERLYNDLLRDLP--------------------HFVRTLLLPKSGGASERS
CLP1_XENTR        EVDVVLVLDQERLYNDLLRDLP--------------------HFVRTLLLPKSGGASERS
CLP1_NEMVE        KVNVIVVLDQERLYNDLKNQFG--------------------DKVQIVHLPKSGGVVVRS
CLP1_AEDAE        EVNAIFVLDQERLYNELLRDVAS-------------------KTVQVVYLPKSGGVVKRT
CLP1_CULQU        EVNAVFVLDQERLYNELLRDVE--------------------RAVQIVFLPKSGGVVERT
CLP1_ANOGA        EVTAIFVLDQERLYNELLRDVK--------------------GTVQVVFLPKSGGVVERT
CLP1_DROME        GACAIFVLDQERLYNELLRDVP--------------------KGVHVVLLPKSGGVVERS
CLP1_DROPS        GACAIFVLDQERLYNELLRDVP--------------------SSVHVVLLPKSGGVVERS
CLP1_CAEBR        EVDVVIVLDHERLYSDLSKELP--------------------EFVRLTHVPKSGGVEQRT
CLP1_CAEEL        EVDVVIVLDHERLYSDLSKELP--------------------EFVRLTHVPKSGGVEQRT
CLP1_BRUMA        EVDVVIVLDHERLYNELQRDLP--------------------SFVKILHQPKSGGVENRS
CLP1_ARATH        NASVVLVLGQEKLFSRLKDVLRSK------------------SNVDVVKLHKSGGVVARV
CLP1_ASPFU        AS-------SERLYSTMMKNYDNKP-------TSSASAAASDERITVVKLSKSGGCVDRD
CLP1_ASPFC        AS-------SERLYSTMMKNYDNKP-------TSSASAAASDERITVVKLSKSGGCVDRD
CLP1_NEOFI        AITTILVIGSERLYSTMMKNYDNKP-------TSSASAAASDERITVVKLSKSGGCVDRD
CLP1_ASPCL        AINTILVIGSERLYSTMMRSYDNKP-------TASASAAASDERITVVKLSKSGGCVDRD
CLP1_ASPOR        SITTILVIGSERLYSLMMKNYDNKP-------TSSASAVASDERITVVKLSKSGGCVDRD
CLP1_ASPTN        SITTILVIGSERLYSTMMKNYDNKP-------TSSASAVASDERISVVKLSKSGGCVDRD
CLP1_ASPNC        AITTILVIGSERLYSIMMKNFDNKP-------TASASAAASDERISVVKLSKSGGCVDRD
CLP1_EMENI        SITTILVIGSERLYSLMMKSYDNKP-------SSSASSAASDERISVVKLSKSGGCVDRD
CLP1_COCIM        SISTILVIGSERLYSTMVKNYDNKPI------ATSATAAASDERISVVKLTKSGGCVDRD
CLP1_BOTFB        AVNIILVLGSERLHSEMLRRF-------------STHKTDNGEAITLVRLDKSGGCVDRD
CLP1_PHANO        SVNVLITLGSERLYSDLSRKYRNRD---------------PSESVNVIRLDKSGGCVNRP
CLP1_MAGO7        NVNIIVTIDTPSLHTELTQRFSGVK-------------NVLGEHVSVVALDKSSGVMERD
CLP1_NEUCR        DANFVVVLGSEQLKTELGQRFASEK-------------TSFEEPITVLGLDKSDGAVQID
CLP1_ASHGO        NIKTLVVCAPDD----SLAVELSDR----------FQTLVRS----IVRIPTSRGICNID
CLP1_KLULA        DINAIVVCAESD----DLAIELSEV----------FRTKIGS----IVRIPPPGSIIAID
CLP1_YEAST        NVNIMLVLCSET---DPLWEKVKKT----------FGPELGNN--NIFFIPKLDGVSAVD
CLP1_YEAS7        NVNIMLVLCSET---DPLWEKVKKT----------FGPELGNN--NIFFIPKLDGVSAVD
CLP1_VANPO        NVNVVILLSDEQE--DPLLTKLNDK----------LSTISSSF--NLLRLPILSGVIERD
CLP1_CANGA        RINYLIILCNDNDKGREIYTKVSKI----------VNTYVGE---RLLRVPTMAGVFEKD
CLP1_DEBHA        EVNIIVVIGNER-----LLIDLKKK----------FKHKIASSQLDFVKVPKSGGVIEVD
CLP1_PICGU        EVNVVVVVDNER-----LLIDLRKK----------FKHKISNSQLAMVKIPKSGGVVELD
CLP1_PICST        EVNLIVVLGNER-----LMIDLKKR----------FKHKSA---LQIVKVPKSEGLVEVD
CLP1_CANAL        LIDNIIVIGNER-----LAIELTKK----------FAYKST--QLNIIKLNKSSGCIEVE
CLP1_YARLI        GVNVIVVIGNDR-----LYADLMKK----------YPVGASGP--TVVKVPAFACMDD-D
CLP1_SCHPO        RINIIIVLGSERLYSSMKRKYADAT------------------WLSVVKVSSSGGCIDRE
CLP1_LACBS        RINVILVVGHEKLNVEMQRAYS--------------------SYVTVVKIPKSGGVVELD
E3L742_PUCGT      GVNILVVIGNEKLHLEISKLMSIN------------------KTVQVVRVPKNGGATDLD
CLP1_MALGO        KIDTIVVLGHEKLNLELTRIYANDTSGHAP---------------RIVKVPRSGGAVEVD
CLP1_USTMA        KVDTIVVLGHEKLNLEMTKLFASPAVTTVETAEIPGSAGQRLPRVNVIKLPKSGGVVELD
G4LUE4_SCHMA      EVDTLLVIEDGFLASFLREDLP--------------------PEVTIVRLPKSSGAITRS
CLP1_CRYNJ        DIDTIIVIGHEKLHIDLSRLPLVQS-----------------RQLNVIRIPKSGGAVDLD
                                                                              

CLP1_HUMAN        KDFRRECRDERIREYFYG----------------------------------FRGCFYPH
CLP1_MACFA        KDFRRECRDERIREYFYG----------------------------------FRGCFYPH
CLP1_BOVIN        KDFRRECRDERIREYFYG----------------------------------FRGCFYPH
CLP1_MOUSE        KDFRRECRDERIREYFYG----------------------------------FRGCFYPH
CLP1_RAT          KDFRRECRDERIREYFYG----------------------------------FRGCFYPH
CLP1_CHICK        KDFRRECRDDRIREYFYG----------------------------------FRGCFYPH
CLP1_XENLA        KECRRESRDQRVREYFYG----------------------------------PRGSLYPH
CLP1_XENTR        KECRRESRDQRVREYFYG----------------------------------PRGSLYPH
CLP1_NEMVE        RETRRKVRDERLRSYFYG----------------------------------QQANLYPH
CLP1_AEDAE        RSQRAEARDNRIREYFYG----------------------------------SKMPLYPH
CLP1_CULQU        KSQRAEARDNRVREYFYG----------------------------------SKMPLYPH
CLP1_ANOGA        KSQRTEARDQRIREYFYG----------------------------------SKMPLFPH
CLP1_DROME        KELRHEARDQRIKEYFYGN---------------------------------TRAPFYPF
CLP1_DROPS        KELRHECRDQRIKEYFYGN---------------------------------ARAPFYPF
CLP1_CAEBR        AQIRSATRGENVHRYFYGT---------------------------------RANNLFPF
CLP1_CAEEL        GQIRSKMRGENVHRYFYGT---------------------------------RANNLYPF
CLP1_BRUMA        KEVRISSRNAFVHKYFYGT---------------------------------RAMPLYPH
CLP1_ARATH        KEVRKRSRNFKIQEYFYG----------------------------------LSKELSPY
CLP1_ASPFU        AAFMKSVRESQIRTYFFGNPIPS---------------TASAALSMSASST-TNITLSPH
CLP1_ASPFC        AAFMKSVRESQIRTYFFGNPIPS---------------TASAALSMSASST-TNITLSPH
CLP1_NEOFI        AAFMKSVRESQIRTYFFGNPIPS---------------TASAALSMSASST-TNVTLSPH
CLP1_ASPCL        AAFMKAVRESQIRTYFFGNPIPS---------------TASAALSASASST-TNVTLSPH
CLP1_ASPOR        AAFMKGVRESQIRTYFFGNPIPS---------------TASAALSLSASST-TNVTLSPH
CLP1_ASPTN        AAFMKHVRESQIRTYFFGNPIPS---------------TASAALSVSASST-TNVTLSPH
CLP1_ASPNC        AAFMKAVSESQIRTYFFGNPIPS---------------TASAALSLSASST-TNVTLSPH
CLP1_EMENI        AAFMKAVRESQIRTYFFGNPVPT---------------TASSALSISSSST-TNVTLSPH
CLP1_COCIM        ATFMKYVRESQIRSYFFGSPVPS---------------TASSALSLSSTTTGTTMTLSPH
CLP1_BOTFB        DAFMQQMREATIKEYFFGD---------------------------------AKRTLSPH
CLP1_PHANO        EEYMKALRHAQVREYFFGH---------------------------------GDNTLAPS
CLP1_MAGO7        EGFLQHMGEASIKEYFFGD---------------------------------AKITLSPF
CLP1_NEUCR        KAWRQKSTETAIKEYFFGG---------------------------------IKARLSPF
CLP1_ASHGO        DVARRALQRSQIREYFYGNGS---------------------------------TVLSPY
CLP1_KLULA        DIMRRALQRVQIREYFYGTTE---------------------------------TVLSPY
CLP1_YEAST        DVYKRSLQRTSIREYFYGSLD---------------------------------TALSPY
CLP1_YEAS7        DVYKRSLQRTSIREYFYGSLD---------------------------------TALSPY
CLP1_VANPO        DVFKRSLQRLAIREYFYGSPS---------------------------------VVLSPY
CLP1_CANGA        DVYIRAQQRAAIREYFYGDTR---------------------------------TVLSPY
CLP1_DEBHA        DAYIRKSQEESIKEYFNGTIR---------------------------------SPLSPF
CLP1_PICGU        DSFIRQCQEETIKEYFNGDRK---------------------------------TPLSPF
CLP1_PICST        EAFIRRTQEESIKEYFNGNYK---------------------------------TRLSPF
CLP1_CANAL        DRFIRLQQEQTIKEYFNGNFK---------------------------------TRLSPF
CLP1_YARLI        ESYNRDAQQQEIQQYFYGDAKD--------------------------------MKLGPR
CLP1_SCHPO        EEWIQQFQARCIKQYFYGDDR---------------------------------MPLSPL
CLP1_LACBS        HSYRERVHNYQLHTYMYGQ---------------VIQAPPGISNATLGGESLTDLVLSPS
E3L742_PUCGT      ITYRRRLESNQIRSYFYG------------------------------GPALSQGQLSPF
CLP1_MALGO        EVYKQKLHDLQIRSYFYGMPPALTKEAAVTSMSMNDENTPASIPAGLDEHLGAVPTLSPY
CLP1_USTMA        ETYRSRLKALQVKTYFYG--------GSTSGSANTDGGVPKPVLPGHSDPLGGVPSLSPY
G4LUE4_SCHMA      PDQWTRQRDARVCAYLHGENP--------------------------------LRRLHPH
CLP1_CRYNJ        DHDRETAHIFQVRTYFYGEPP-----------------LPPQISSLVGKMVSLDFELSPY
                             :  *: *                                      : * 

CLP1_HUMAN        AFNVKFSDVKIYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_MACFA        AFNVKFSDVKIYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_BOVIN        AFNVKFSDVKIYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_MOUSE        AFNVKFSDVKIYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_RAT          AFNVKFSDVKIYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_CHICK        AFDVKFSDVKIYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_XENLA        AFEIKFSEVRVYKVGA-PTIPD----------------SCLPLGMSQEDNQ---------
CLP1_XENTR        AFEIKFSEVRVYKVGA-PSIPD----------------SCLPLGMSQEDNQ---------
CLP1_NEMVE        SFEVKFSDVKLFKIGA-PLVPD----------------SCLPLGMDQGQNE---------
CLP1_AEDAE        SFDVKFSDVKIFKVGS-PALPD----------------SCLPLGMKKEDNF---------
CLP1_CULQU        SFDVKFSDVKIFKVGS-PALPD----------------SCLPLGMKREDNY---------
CLP1_ANOGA        SFDVKFSDIKIFKVGS-PPLPD----------------SCLPLGMKAEDNY---------
CLP1_DROME        SFEVKFQDLRLYKIGA-PPLPD----------------SCMPIGMKAEDNK---------
CLP1_DROPS        SFEVKFQELRLYKIGA-PPLPD----------------SCMPIGMKAEDNK---------
CLP1_CAEBR        TFDVPFDTVTLCKIGA-EQLPD----------------SCLPFGMEVENHE---------
CLP1_CAEEL        TFDVSFDDVTLCKIGA-EQLPD----------------SCLPFGMEVENHE---------
CLP1_BRUMA        TFELSFDEVQFCKIGC-ERLPI----------------ECLPFGMKVDDHR---------
CLP1_ARATH        ANTSSFSDLQVFRIGGGPQAPK----------------SALPAGSTSVSNP---------
CLP1_ASPFU        AQQLDFDSLAVYNYTIASSDED---EDEYDPSQFGASDTFLPGGRNDAEGPETKHAEETS
CLP1_ASPFC        AQQLDFDSLAVYNYTIASSDED---EDEYDPSQFGASDTFLPGGRNDAEGPETKHAEETS
CLP1_NEOFI        AQQLDYDSLAVYNYTIASSDED---EDEYDPSQFGTSDTFLPKGSNDAEGPEAKHAEETS
CLP1_ASPCL        AQQLDFDSLAVYNYTISLPDED---EDEYDPSQLGTGDTFIPGGSNEAERAEPQQAEDSS
CLP1_ASPOR        AQQLDFNTLSIYNYTIASLEED---EDEYDPSQLGAGDSFLPGGGNDAEASQAQQDE-PA
CLP1_ASPTN        AQQLDFNSLGLYNYNITSTEED---EDEYDPAQFGASDAFLPGGANDAEQGASQQDE-NP
CLP1_ASPNC        AQQLDFNALAVYNYTIASAEED---EDEYDPSQLGTGDAFLPGGSNDVDL----------
CLP1_EMENI        AQQLDFDAIALYNYTTSSAEEDQNDEDDYDPAQL-TTDSFLP-GNNEAES----------
CLP1_COCIM        TSQVDFNSLSIYSITIATEGEE----DEYDPSKF---DSFLPGGHEENDHNTSLTGTTSL
CLP1_BOTFB        TQVVNFDELSIYKVKEAHSMQS----------------AFLPGGEEEVEPTQYEKVE---
CLP1_PHANO        SQTCDFGDLHIFQIVEG--DEG---------------ALYRSGDYDEYDPSNVSLASIYT
CLP1_MAGO7        TQQVAFDELAIYTSPEASD---------------------YSAEPGALERIP--------
CLP1_NEUCR        TQSASFDELVVFKAPDEP----------------------YEGAP-VLERV---------
CLP1_ASHGO        TIGVDLLDAVVWRPKSSLTIDM--------------SKTSPNMVELERVE----------
CLP1_KLULA        TMGAGFEELTVFRPRNISEYGE--------------DKKDVDLTVFDKIE----------
CLP1_YEAST        AIGVDYEDLTIWKPSNVFDN-------------------EVGRVELFPVT----------
CLP1_YEAS7        AIGVDYEDLTIWKPSNVFDN-------------------EVGRVELFPVT----------
CLP1_VANPO        TIGVDFEDITVWRPINFIENPE--------------ETSQLLPTQLLPVE----------
CLP1_CANGA        NLGCDTSDITVWRPKSVLQG------------------ENTNLDTLEVAP----------
CLP1_DEBHA        KTELDAKDFVIYKCVDSSEANS--------------NLSFLPSGDSFTPEASEMSDGDKK
CLP1_PICGU        KTEVDVKDFRYFKGVLSSDFNP--------------SLSFLPSGDSYTTD--DMDEDRKK
CLP1_PICST        KTDIDVNDHTIYKCVLSSDVNS--------------ALSFLPA-----------------
CLP1_CANAL        KTDIELSGLKIYKNVLTKDLLS--------------QMAFLPGGDDFEKD--ETNPEEDP
CLP1_YARLI        IVTVDFSTLHVYKIKPSTQFDD--------------DKADMLERV---------------
CLP1_SCHPO        SMIVDSTQLVVYRVLEASESGP--------------KSSVLPLGFEEENTQSEKQDGNTS
CLP1_LACBS        SSVIKFEDLSIFRIGAETMAPS----------------SALPIGATRVVSEMQPVPVD--
E3L742_PUCGT      TIVVKFEDLTIYRIGDEAIVPS----------------SALPIGATRSVKPTTLTKVD--
CLP1_MALGO        STTIPLDLLSIYRVGQDRVAPS----------------SALPIGAERVLSEMQVVKLD--
CLP1_USTMA        STTIPFDLLEIYKVGQESLAPS----------------SALPIGASRTVTETQLVKLD--
G4LUE4_SCHMA      QITLKSSEYSIYKVGTEAIPDA-----------------LLPHGAQEEETW---------
CLP1_CRYNJ        SFQIPWSRLVVLRVGEENSAPS----------------SALPLGSSKILSPLRLTRVDPS
                                                                              

CLP1_HUMAN        ---------------------------------LKLVPVTPG-RDMVHHLLSVSTAEG--
CLP1_MACFA        ---------------------------------LKLVPVTPG-RDMVHHLLSVSTAEG--
CLP1_BOVIN        ---------------------------------LKLVPVTPG-RDMVHHLLSVSTAEG--
CLP1_MOUSE        ---------------------------------LKLVPVTPG-RDMVHHLLSVSTAEG--
CLP1_RAT          ---------------------------------LKLVPVTPG-RDMVHHLLSVSTAEG--
CLP1_CHICK        ---------------------------------LKLVPVTPG-RDMVHHLLSVSMADS--
CLP1_XENLA        ---------------------------------LKLVPVTPG-RDMAHHLLSVVPLDGGS
CLP1_XENTR        ---------------------------------LKLVPVTPG-RDMAHHLLSVVPLDGGG
CLP1_NEMVE        ---------------------------------TKLVPVVPT-KDLKHCLLAISAAES--
CLP1_AEDAE        ---------------------------------TKLVAVQPS-MQLLHHILAVSFAES--
CLP1_CULQU        ---------------------------------TKLVAVQPG-PQLLHHILAVSFAES--
CLP1_ANOGA        ---------------------------------TKLVAVQPG-PQLLHHILAVSFAES--
CLP1_DROME        ---------------------------------TKVVAVTPT-PALIHHVLALSFAES--
CLP1_DROPS        ---------------------------------TKVVAVTPT-PALIHHVLALSFAES--
CLP1_CAEBR        ---------------------------------TKIIIIEPS-VEIKHHLFSFSRGSI--
CLP1_CAEEL        ---------------------------------TKLVIMEPS-ADIKHHLFAFSRSTK--
CLP1_BRUMA        ---------------------------------TKVVPIEPS-EDLVHHLVSLSMCTA--
CLP1_ARATH        ---------------------------------LRVTPVNIDDRDLLHSVLAVSYAEE--
CLP1_ASPFU        FTSS--VPGLGGSSGDDAASGS-----SAVPLKKVLPPAPNTLANSLLAVTHTAPNAS--
CLP1_ASPFC        FTSS--VPGLGGPSGDDAASGS-----SAVPLKKVLPPAPNTLANSLLAVTHTAPNAS--
CLP1_NEOFI        FASS--VPGLGGSSGEDAASGS-----SAVPLKKVPPPAPNTLANSLLAVTHAAPNAS--
CLP1_ASPCL        FTPS--MPGLAGSSGEDATSAAN----SAVPLKKVPRPAPTVLANSLLAITHAAPSAP--
CLP1_ASPOR        RATP--LPGIVSSIESATPPVA-----SNVPLKKVLPPAPSTLANSLIAITNAPTTAS--
CLP1_ASPTN        SATP--LPGIVSSIESAVPSGA-----SNVPLKKLLPPAPSALANSLLAITHVPPTAT--
CLP1_ASPNC        -----------------------------------------ALANSLLAITHASSTAS--
CLP1_EMENI        -ASS--LPGLNSAANASAAAAAG----ALVPLKKVPGPAPSALANTLLAITHASPTSS--
CLP1_COCIM        QPPSGLLPGLRSELPSATTGFPSASTSSTTPFTNLPSPAPMSLANTLLAITNAAPNAS--
CLP1_BOTFB        --------------------------------------PTPSMLHCIFAVMHASTRDS--
CLP1_PHANO        RVTP-----------------------------------SPSLQNSLLAITTASPTDS--
CLP1_MAGO7        -------------------------------------QPLPEMAHWVLAMMDAAPNDP--
CLP1_NEUCR        -------------------------------------EITPEMAHWTLAVMIASVTDS--
CLP1_ASHGO        -------------------------------------VTAANLQHALVAITYAPRKST--
CLP1_KLULA        -------------------------------------VNSSNLQHAIIAITNISRKES--
CLP1_YEAST        -------------------------------------ITPSNLQHAIIAITFAERRAD--
CLP1_YEAS7        -------------------------------------ITPSNLQHAIIAITFAERRAD--
CLP1_VANPO        -------------------------------------VKPTTLQHALVAISYADRKAN--
CLP1_CANGA        -------------------------------------VDSSTLQYALVAITYASRKSD--
CLP1_DEBHA        EEFS-----------------------LDTYYSQLQEPSSSNLDNSIVAITQLPQNNK--
CLP1_PICGU        DENS-----------------------MDKFYTALEDPDASKLENLIIAITQLPQNNK--
CLP1_PICST        ------------------------------------EPSSSNLDNSILAITQLPSTHK--
CLP1_CANAL        EKKQ-----------------------LEKYYQAIEDPNSSNLENSIVAITHLPNNDKK-
CLP1_YARLI        -------------------------------------AEANILPNTVLTVMHAVPGSS--
CLP1_SCHPO        LRLHG----------------------KGEFLERISTEAMTILQNSILAVSSVGEDED--
CLP1_LACBS        --------------------------------PSQ---PGSGLLNAVLALLAPQNPDENE
E3L742_PUCGT      --------------------------------PEN---GRS--MSNILNLVLSIPQAEWD
CLP1_MALGO        --------------------------------PVNSSNDMSMLLHSVLALVEPPPRNQSK
CLP1_USTMA        --------------------------------PTNSAADQTSLLHSVLALIQPPRGGGGA
G4LUE4_SCHMA      ----------------------------------RNPIQVSVSRDLKNRLLAVSQASE--
CLP1_CRYNJ        GPGHVVRLLNRVLALVDVKPEDRIVPAKESEVKEEVKEEKNEKDGEIKQDGEGEKKGEGK
                                                                              

CLP1_HUMAN        ----------------------------TEENLSETSVAGFIVVTSVDLEHQ---VFTVL
CLP1_MACFA        ----------------------------TEENLSETSVAGFIVVTSVDLEHQ---VFTVL
CLP1_BOVIN        ----------------------------TEENLSETSVAGFIVVTSVDLEHQ---VFTVL
CLP1_MOUSE        ----------------------------TEENLSETSVAGFIVVTSVDVEHQ---VFTVL
CLP1_RAT          ----------------------------TEENLSETSVAGFIVVTSVDVEHQ---VFTVL
CLP1_CHICK        ----------------------------PDDNISETSVAGFIVVTGVDLERQ---VFTVL
CLP1_XENLA        ----------------------------AEEGIEERSVAGFIVITGVDTERQ---TLTLL
CLP1_XENTR        ----------------------------AEEGIEERSVAGFIVITGVDTERQ---TLTVL
CLP1_NEMVE        ----------------------------LEEDLVQTNVIGFLVVNEVDLDRE---VMVVL
CLP1_AEDAE        ----------------------------IEENVIQSNVAGFICVTDVNMEKE---VLTIL
CLP1_CULQU        ----------------------------TDDNVIQSNVAGFICVTNVSMEKE---VLTIL
CLP1_ANOGA        ----------------------------TDENVIQTNVAGFICVTNVNMDKQ---VLTVL
CLP1_DROME        ----------------------------VEDDVIGTNVAGFCCVTEVDMERQ---AVMLL
CLP1_DROPS        ----------------------------VDDDVIGTNIAGFCCVTEVDMERQ---VVMLL
CLP1_CAEBR        ----------------------------AEKNVLTSSVWGFCLITEVDMEKR---TISIL
CLP1_CAEEL        ----------------------------ADENVLKSPVFGFCLVTEVDLEKR---TMSIL
CLP1_BRUMA        ----------------------------VDQSVLTTNVMGFIVITAVDMERE---KLTVL
CLP1_ARATH        -----------------------------PDQIISSNVSGFVYVTEVNVQKK---KITYL
CLP1_ASPFU        -----------------------------PAEIRDASIMGFLYVADVDSEKG---KIRVL
CLP1_ASPFC        -----------------------------PAEIRDASIMGFLYVADVDSEKG---KIRVL
CLP1_NEOFI        -----------------------------PAEIRDASIMGFLYVADVDSEKG---KIRVL
CLP1_ASPCL        -----------------------------SSEIRDASIMGFLYVADVDSEKG---KIRVL
CLP1_ASPOR        -----------------------------AAEVRDASIMGFLYVAEVDSEKG---KIRAL
CLP1_ASPTN        -----------------------------PSEIRDSSIMGFLYVADVDSEKG---KIRVL
CLP1_ASPNC        -----------------------------PADVRDASIMGFLYVADVDAEKG---KIRVL
CLP1_EMENI        -----------------------------PSEIRDASTMGFLYVADVDSERG---KIRVL
CLP1_COCIM        -----------------------------LDEVRDASIMGFIYIADVDEKKGQGGKLRLL
CLP1_BOTFB        -----------------------------QDTIRDASVMGFVYVAEVDEKKK---RMKIL
CLP1_PHANO        -----------------------------QDVIRDSSVKGYIYVADVDEAKK---KVRLL
CLP1_MAGO7        -----------------------------PHKIRYAPVSGFVYVAAVDKERR---RMKIL
CLP1_NEUCR        -----------------------------PQAIRFSSVLGFIVIADVDQERR---RVKFL
CLP1_ASHGO        -----------------------------AEEVFRSGVLGVALITEVNDAKR---KMRIL
CLP1_KLULA        -----------------------------QDKLNTASIIGYGLITEVNDSKK---KLRVL
CLP1_YEAST        -----------------------------QATVIKSPILGFALITEVNEKRR---KLRVL
CLP1_YEAS7        -----------------------------QATVIKSPILGFALITEVNEKRR---KLRVL
CLP1_VANPO        -----------------------------ESNVQLAPTLGFGLITEVNDKRR---KLRIL
CLP1_CANGA        -----------------------------SEEVLQAPILGFGLITELNEKRN---KLKIL
CLP1_DEBHA        ----------------------------SARDLMNTCVLGYAHVSKFDDTKS---KMKVL
CLP1_PICGU        ----------------------------QPKDLLNTCVLGYIHVSRVDEARG---KMKVL
CLP1_PICST        ----------------------------SGRELLNTSILGYVHVSKFDDAKG---KIKVL
CLP1_CANAL        ----------------------------LGKDLLNTSVLGYIHVSKFDDQKK---RLKVL
CLP1_YARLI        -----------------------------EKEILDSEVQGYLHVTEVDEEKN---KVKIL
CLP1_SCHPO        -----------------------------EATVVDSCIIGYVFVSDVDDVKN---RMTLL
CLP1_LACBS        RY---------------------------DEEILDLTVSGFLIVTNLGMQQR---KMTIL
E3L742_PUCGT      -----------------------------------------------GLDPE---SDAAF
CLP1_MALGO        DETSSPDDPGHHDY--------------EDDELLGAAILGFVHVSDMDLHRK---KLTVL
CLP1_USTMA        GQPDSSTNP-------------------TDDEIIGAPILGFVHVADIDTVRK---KITVL
G4LUE4_SCHMA      -----------------------------PYQVPEAPVYGFVVVVNVSEDKS---SFTIL
CLP1_CRYNJ        GEGEGEGEGKDGEEEGEAEGEDDEEEVPFREEIGTREVMGFIVITAIDTFAR---KYTVL
                                                                 .           :

CLP1_HUMAN        SPAPRPLP-KNFLLIMDIRFMDLK----
CLP1_MACFA        SPAPRPLP-KNFLLIMDIRFMDLK----
CLP1_BOVIN        SPAPRPLP-KNFLLIMDIRFMDLK----
CLP1_MOUSE        SPAPRPLP-KNFLLIMDIRFMDLK----
CLP1_RAT          SPAPRPLP-KNFLLIMDIRFMDLK----
CLP1_CHICK        SPAPRPLP-KNFLLIMDIRFMDLK----
CLP1_XENLA        SPAPRPLP-KCVLLIMDIRFMDLK----
CLP1_XENTR        SPAPRPLP-KCVLLIMDIRFMDLK----
CLP1_NEMVE        SPAPRPLP-RKFLLLSEIKFMDFK----
CLP1_AEDAE        SPQPRPLP-QTILLVSDLQFMDSH----
CLP1_CULQU        SPQPRPLP-QTILLVSDFQFMDSH----
CLP1_ANOGA        SPQPRPLP-QTILLVSDLQFMDSH----
CLP1_DROME        SPQPRPLPPNALLLWSELQFMDNHT---
CLP1_DROPS        SPQPRPLPPNALLLWSELQFMDNHT---
CLP1_CAEBR        CPQ-NTIP-SKTLVYSEVTHLDDQIER-
CLP1_CAEEL        CPQ-RTIP-SKVLVFSDITHLDDQIKR-
CLP1_BRUMA        SPQPYPLP-SKILILSEVTFIDDKERT-
CLP1_ARATH        APSPGTLP-SKLLVAGSLAWLESV----
CLP1_ASPFU        APIGGRVP-PRAIVWGKKWPGEVVGLVG
CLP1_ASPFC        APIGGRVP-PRAIVWGKKWPGEVVGLVG
CLP1_NEOFI        APIGGRVP-PRAIVWGKKWPGEVVGLVG
CLP1_ASPCL        APIGGRVP-PRAIVWGKKWPGEVVGLVG
CLP1_ASPOR        APVGGRVP-PRAIVWGKKWPGEVVGLVG
CLP1_ASPTN        APVGGRVP-PRAIVWGKRWPGEVVGLVG
CLP1_ASPNC        APVGGRVP-PRAI--KKYIDSSKV----
CLP1_EMENI        APVGGRVP-SRAIIWGKKWPAEVVGLVG
CLP1_COCIM        APVGGRVP-NRAMIWGRKWPGEVVGLIG
CLP1_BOTFB        APLNTRVT-DRPLIWGS-WPEAPVNLMG
CLP1_PHANO        SPQPGMIP-GNAMVLGT-WPEDVPGLVG
CLP1_MAGO7        APVSGRLG-DKPLVWGK-WPEPHINLLG
CLP1_NEUCR        SPVSGRLG-NHPLIWGR-WPEPYLNLLA
CLP1_ASHGO        LPVPGRLP-DKAMILTAYRYLE------
CLP1_KLULA        LPVPSRIP-DRAMILTEYRYLE------
CLP1_YEAST        LPVPGRLP-SKAMILTSYRYLE------
CLP1_YEAS7        LPVPGRLP-SKAMILTSYRYLE------
CLP1_VANPO        LPVPGRLP-DKAMILTAYRYLE------
CLP1_CANGA        LPVPGRLP-PNAMILTSFRYLE------
CLP1_DEBHA        LPFPGALP-RNILISTSVGYTE------
CLP1_PICGU        SPMVAAIP-RNILLVTTIGYTE------
CLP1_PICST        LPFPGGFP-RNMLISTNIGFNE------
CLP1_CANAL        FPFPGVFP-KNVLISTNIGYNE------
CLP1_YARLI        TPVPGRLP-SQVMLLGDTRYHE------
CLP1_SCHPO        SPVPEQLP-SNALIMGTCKWQE------
CLP1_LACBS        APNQGSVVGKTAIMGSFEWQEQ------
E3L742_PUCGT      EACSGPSLGFIHL---------------
CLP1_MALGO        SPKPGKLPSTTALIGNLQWQDM------
CLP1_USTMA        SPSAGRLPSKTAIIGSLDWQDV------
G4LUE4_SCHMA      SPSPHPPP-NNLFLLTSICYVDPESL--
CLP1_CRYNJ        SPTPGRLPTTVAIAGAIEWVDSA-----
                   .          :