CLUSTAL format seed alignment for MF_03039

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CFD1_CANGA        ------------MDPEEQLESTEGVPAKSLSLIKHILLVLSGKGGVGKSSVTTQTALTLC
CFD1_YEAST        ------------MEEQE-----IGVPAASLAGIKHIILILSGKGGVGKSSVTTQTALTLC
CFD1_KLULA        ------------MSAETEL---LGMP-ESLKDIKHIILVLSGKGGVGKSSVTTQTALTLC
CFD1_ASHGO        ------------MAEEI------VVEPESLREIEHIVLVLSGKGGVGKSSVTTQLGMALA
CFD1_CANAL        ------------MSSEL-----LQEVPKSIEHVKHIILILSGKGGVGKSSVTTQVALTLV
CFD1_DEBHA        ------------MDTSE-----PQESPKSLSNVKHIILILSGKGGVGKSSVTTQTALTLV
CFD1_YARLI        ------------MYSTA------TQSSPSLAGVKNIVLVLSGKGGVGKSSVTTQLALTLA
CFD1_ASPCL        ---------------------------MPLDGVKNIVLVLSGKGGVGKSSVTLQLALALS
CFD1_ASPFU        ---------------------------MPLDGVKNIVLVLSGKGGVGKSSVTLQLALALS
CFD1_ASPTN        ---------------------------MPLDGVKNIVLVLSGKGGVGKSSVTLQLALALT
CFD1_ASPOR        ---------------------------MPLDGVKNIVLVLSGKGGVGKSSVTLQLALALT
CFD1_EMENI        ---------------------------MPLEGIKNIILILSGKGGVGKSSVTLQLALALT
CFD1_COCIM        ---------------------------MPLDGVKNIVLVLSGKGGVGKSSVTLQLALTFC
CFD1_CHAGB        ---------------------------MSLSKVKHIVLVLSGKGGVGKSSVTTQLALSLS
CFD1_NEUCR        ---------------------------MSLAKVKHIVLVLSGKGGVGKSSVTTQLALSLS
CFD1_GIBZE        ---------------------------MGLTKVKHIILVLSGKGGVGKSSVTTQLALSLT
CFD1_PHANO        ---------------------------MPLDNVRNIVLVLSGKGGVGKSSITTQLALTLS
NUBP2_AEDAE       ----------------------------MLEKVKHIILVLSGKGGVGKSTVSTQLALTLS
NUBP2_CULQU       ----------------------------MLDKIKHIILVLSGKGGVGKSTVSTQLALTLA
NUBP2_ANOGA       ----------------------------MLDKVKHIILVLSGKGGVGKSTVSTQLALTLA
NUBP2_DROME       ----------------------------MLDKVKNVIVVLSGKGGVGKSTVSTQLSLALR
NUBP2_DROPS       ----------------------------MLDKVKNVIIVLSGKGGVGKSTVSTQLALALR
A4I1X9_LEIIN      MSSPSVAEGAAPLSGAGGTDAAAPVASAGLLQVKNIILVLSGKGGVGKSTVACQLALALA
Q4Q9E8_LEIMA      MQSPSVAEGAAPPSGAGGSDAAATVASAGLFQVKNIILVLSGKGGVGKSTVACQLALALA
A4HEP9_LEIBR      ------------------------MGSTGLLQVKNIILVLSGKGGVGKSTVACQLALALT
Q57WQ0_TRYB2      -------------------------MATSLSDVNHIILVLSGKGGVGKSTVACQLALALA
V5DR48_TRYCR      -------------------------MIPSLANVKHILLVLSGKGGVGKSTVACQLALALT
NUBP2_HUMAN       ----------------MEAA----AEPGNLAGVRHIILVLSGKGGVGKSTISTELALALR
NUBP2_BOVIN       ----------------MEAA----AEPGNLAGVRHIVLVLSGKGGVGKSTISTELALALR
NUBP2_MOUSE       ----------------MEAAAGERAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALR
NUBP2_RAT         ----------------MEAA----AEPGNLAGVRHIILVLSGKGGVGKSTISTELALALR
NUBP2_XENLA       ----------------MEQT----QDGGNLSGVHHIILVLSGKGGVGKSTISTEIALALR
NUBP2_XENTR       ----------------MERS----QDGGNLSGVQHIILVLSGKGGVGKSTISTEIALALR
NUBP2_CHICK       ---------------MEEVV----AERSNLGGVRHILLVLSGKGGVGKSTISTELALSLR
NUBP2_DANRE       ----------------MDGS-----GKGNLDQVKHVLLVLSGKGGVGKSTITTELALAFR
NUBP2_MONBE       ---------------MAAPNEFYETLKQRLAGVKHIVLVLSGKGGVGKSTVASQMAIGLI
NUBP2_NEMVE       ----------------MCVV-----VPQGLRSVKHIILVLSGKGGVGKSTVATQLSWALY
NUBP2_TRIAD       ---------------MAEEG-----AQKATGKIKSVVLILSGKGGVGKSTVASQIALELA
NUBP2_DICDI       -----------------------------MDKIKHKILVLSGKGGVGKSTVSSQLALYLS
F0ZGG2_DICPU      -----------------------------MDKIKHKILVLSGKGGVGKSTVSSQLALYLA
CFD1_SCHPO        -----------------------------MDKVQHVILVLSGKGGVGKSSVTTQLALSLH
E3K0E7_PUCGT      -------------------MADDPALSRRLRNVKHIILVLSGKGGVGKSSVSVQLALSLL
CFD1_USTMA        -----MSASSSAISPSASHLGADPKIVRRLSSVSHIILVLSGKGGVGKSSVSAQLALSLS
CFD1_CRYNJ        -----------------MADIIETPVSRRLSTVKNIIIVLSGKGGVGKSSSSVQLALSLL
                                                  :   :::**********: : : .  : 

CFD1_CANGA        G--------MGYNVGVLDIDLTGPSLPRMFGIED--SSIYQSADGWMPIPVETN------
CFD1_YEAST        S--------MGFKVGVLDIDLTGPSLPRMFGLEN--ESIYQGPEGWQPVKVETN------
CFD1_KLULA        L--------KGYKVGVLDIDLTGPSLPRMFGLEN--KQVYQASKGWIPVSVPTT------
CFD1_ASHGO        C--------RGLKVGILDIDLTGPSLPRMVGMEG--KSVLQGPRGWIPVDVPTGM-----
CFD1_CANAL        N--------KGFNVGVLDIDLTGPSLPRMFGVEN--KQVHQSTQGWVPVSVYNNNNNQGT
CFD1_DEBHA        N--------KGFNTGVLDIDLTGPSLPRMFGVET--KQVHQSSAGWVPVSVYNNGQEKNE
CFD1_YARLI        A--------QGKKVGVLDIDLTGPSIPRFFGMED--KQVYQSSAGWVPVYTDAS------
CFD1_ASPCL        L--------QGKSVGILDIDLTGPSIPRLVGLED--AKITQAPGGWIPVPVHTAQNPSST
CFD1_ASPFU        L--------QGKSVGILDIDLTGPSIPRIVGLED--AKITQTPRGWLPVSVHPPENTAQD
CFD1_ASPTN        L--------QGKSVGILDIDLTGPSIPRLVGLED--AKITQSPAGWVPVPVHSATDNA--
CFD1_ASPOR        L--------QGKSVGILDIDLTGPSIPRLVGLED--AKITQAPGGWVPVTVHPASTND--
CFD1_EMENI        L--------QGKSVGVLDIDLTGPSIPRLVGLEG--AKITQSSNGWVPVPVHEAEAQTAS
CFD1_COCIM        L--------QGRSVGILDVDLTGPSIPRLVGLED--AKITQAPGGWLPVTVHPFHTPSSD
CFD1_CHAGB        Q--------AGHSVGVLDVDLTGPSIPRMFGIED--AKVTQAPGGWLPITVHEAD-----
CFD1_NEUCR        L--------AGHSVGVLDVDLTGPSIPRMFGIED--AKVTQAPGGWLPITVHEAD-----
CFD1_GIBZE        S--------AGHSVGILDVDLTGPSIPRMLSIEA--SKVTQVPGGWAPVLVHEAD-----
CFD1_PHANO        L--------QGHTVGVLDIDLTGPSIPRFFGIEE--SKVRQAPGGWIPVDVHAQQTLSAH
NUBP2_AEDAE       E--------SKFKVGLLDIDLCGPSVPYLLGLEG--HDVHQCEEGWVPVYTNA-------
NUBP2_CULQU       E--------SGHKVGLLDIDLCGPSVPFLLGLEG--HDVHQCEQGWVPVFSGA-------
NUBP2_ANOGA       E--------ADHKVGLLDIDLCGPSVPYLLGLED--RDVHQCDEGWVPVYTSA-------
NUBP2_DROME       K--------NGFKVGLLDIDLCGPSVPYLLGLEG--RDIFQCDDGWVPVYTDE-------
NUBP2_DROPS       H--------SGHKVGLLDIDLCGPSVPFLLGLEG--SNIYQCDEGWVPIYTDA-------
A4I1X9_LEIIN      HV-------HHKQVGLLDVDVCGPSVPKICGLEG--RDVYRGEKGWMPVSSQAKAATAGS
Q4Q9E8_LEIMA      HV-------HHKQVGLLDVDVCGPSVPKICGLEG--CDVYRGEKGWIPVSSQAKAATAGS
A4HEP9_LEIBR      HV-------HGKQVGLLDVDICGPSVPKICGLEG--CDVYREEKGWIPVSLQANTAASAS
Q57WQ0_TRYB2      NV-------HGKKVGLLDVDICGPSVPTICGVTG--KDVYRGDAGWEPVSLFHEQHEA--
V5DR48_TRYCR      HV-------HGKHVGLLDVDICGPSVPTICGVVD--RDVYRDEKGWHPVSLVE-------
NUBP2_HUMAN       H--------AGKKVGILDVDLCGPSIPRMLGAQG--RAVHQCDRGWAPVFLD--------
NUBP2_BOVIN       H--------AGKKVGILDVDLCGPSIPRMLRAQG--RAVHQGDSGWVPVFVD--------
NUBP2_MOUSE       H--------QGKKVGILDVDLCGPSIPHMLRAQG--KAVHQCDNGWVPVFVD--------
NUBP2_RAT         H--------QGKKVGILDVDLCGPSIPHMLHAQG--KAVHQCDSGWVPVFVD--------
NUBP2_XENLA       H--------AGKKVGILDVDLCGPSIPRMLNAQS--KDVHQCDSGWVPVYVD--------
NUBP2_XENTR       H--------AGKKVGILDVDLCGPSIPRMLNAQS--KDVHQCDSGWVPVYVD--------
NUBP2_CHICK       H--------SGKKVGILDVDLCGPSIPRMFKVQD--NDVHQCDAGWVPVFVD--------
NUBP2_DANRE       H--------AGKKVGILDVDLCGPSIPRMLSVGK--PEVHQCDSGWVPVYADP-------
NUBP2_MONBE       H--------RGLKVGLLDIDLTGPSIPTMFGVAD--QQVHTSSEGWVPLYKY--------
NUBP2_NEMVE       N--------QGNKVGLLDIDLCGPSIPRMMNVEN--NDVHQCSDGWVPVYTG--------
NUBP2_TRIAD       N--------GGNKVGILDVDLCGPSIPRVLGLED--KDVHQCADGWIPVYAD--------
NUBP2_DICDI       H--------IGYKVGLLDVDLCGPSIPKMMGLES--KDVHKSTKGWVPVYTD--------
F0ZGG2_DICPU      H--------TGNKVGLLDVDLCGPSIPKMIGVEN--KEVHKSSKGWVPVYTD--------
CFD1_SCHPO        DSKVY---SRPLKTGILDIDLTGPSIPRMFGKDAERNRIHQSSAGWVPVYTDE-------
E3K0E7_PUCGT      NR------TKDAKVGLLDIDLTGPSIPRMLGLEG--RSVLQSTDGWVPVHTSFNNHHP--
CFD1_USTMA        SSASPSDRSRMARVGILDIDLTGPSIPRMLGLGG--ASVKQSTDGWVPVYTDA-------
CFD1_CRYNJ        AQ------SPTNRVGLIDLDITGPSLPRMVGLDTPTATVHQSSAGWVPVYVDQ-------
                               .*::*:*: ***:* .         :     ** *:           

CFD1_CANGA        ------------------------------GKGKLCVVSLGFLLGSRGTSVVWRGPKKTS
CFD1_YEAST        ------------------------------STGSLSVISLGFLLGDRGNSVIWRGPKKTS
CFD1_KLULA        ------------------------------SGGELKLMSLGFLLDDRGNSVVWRGPKKSA
CFD1_ASHGO        ------------------------------EQGCLRVMSLGFLLDDRGDSVVWRGPKKTA
CFD1_CANAL        ----------------------------DSKRGNLSLMSLGFLLGDRGNSVVWRGPKKTA
CFD1_DEBHA        ----------------------------ENKRGNLSLMSLGFLIGNRNSSVVWRGPKKTA
CFD1_YARLI        --------------------------------RNLCLMSLGFLLSSRGDSVVWRGPRKTA
CFD1_ASPCL        ---------------------------TQP-RGSLRCMSLGFLLRDRGDAVIWRGPKKTA
CFD1_ASPFU        ---------------------------GAPPRGALRCMSLGFLLRDRGDAVIWRGPKKTA
CFD1_ASPTN        ---------------------------TGPATGSLRCISLGFLLRDRGDAVIWRGPKKTA
CFD1_ASPOR        ----------------------------GAQRGSLRCMSLGFLLRDRGDAVIWRGPKKTA
CFD1_EMENI        GNDAAVALSDDGGDENKDV-------ERAKPRGSLRCMSLGFLLRDRGDAVIWRGPKKTA
CFD1_COCIM        GLNGSQRANKPDDSNESSSSTVETAPQSTNFCGSLRCMSLGFLLRDRGDAVIWRGPKKTA
CFD1_CHAGB        ---------------------------PSTGIGSLRVMSLGFLLPRRGDAVVWRGPKKTA
CFD1_NEUCR        ---------------------------PSAGVGSLRVMSLGFLLPKRGDAVVWRGPKKTA
CFD1_GIBZE        ---------------------------ESKGLGSLHAMSLGFLLPKRGDAVVWRGPKKTA
CFD1_PHANO        RLQKTA---------------------EGQEIGALSCMSLGFILPNRSDAVIWRGPKKTA
NUBP2_AEDAE       -------------------------------DKNLAVMSIGFLLKNRTDAVIWRGPKKTA
NUBP2_CULQU       -------------------------------DQRLAVMSIGFLLKNRDEAVIWRGPKKTA
NUBP2_ANOGA       -------------------------------EKRLAVMSIGFLLKNRSDAVIWRGPKKTA
NUBP2_DROME       -------------------------------SQTLAVMSIGFLLKNREDPVIWRGPKKTM
NUBP2_DROPS       -------------------------------SKTLAVMSIGFLLKNRTDPVIWRGPKKTM
A4I1X9_LEIIN      PGSA---------------------PGAMAPSGDLKVMSIAYLLPSDKDAVVWRGPKKDA
Q4Q9E8_LEIMA      PGSA---------------------PGAAAPSGDLKVMSIAYLLPSDKDAVVWRGPKKDA
A4HEP9_LEIBR      PGAF---------------------PDATVRSGDLKVMSIAYLLPSDKDAVVWRGPKKDA
Q57WQ0_TRYB2      -------------------------DTAASATGNVKIMSIAFLLPSENDAVVWRGPKKDA
V5DR48_TRYCR      -------------------------DDSTPGAGNLKIMSIAFLLPSDKDAVVWRGPKKDA
NUBP2_HUMAN       ------------------------------REQSISLMSVGFLLEKPDEAVVWRGPKKNA
NUBP2_BOVIN       ------------------------------REQSISLMSVGFLLEQPDEAVVWRGPKKNA
NUBP2_MOUSE       ------------------------------QEQSISLMSVGFLLENPDEAVVWRGPKKHA
NUBP2_RAT         ------------------------------QEQSISLMSVGFLLENPDEAVVWRGPKKHA
NUBP2_XENLA       ------------------------------QEKSISLMSIGFLLEKPDDAVVWRGPKKNA
NUBP2_XENTR       ------------------------------QEKSISLMSIGFLLEHPDDAVVWRGPKKNA
NUBP2_CHICK       ------------------------------QEKSISLMSIGFLLEKPDDAVVWRGPKKNA
NUBP2_DANRE       ------------------------------QQQQLALMSIAFLLEDSDEAVIWRGPKKTA
NUBP2_MONBE       -------------------------------DQRLAIMSIGFLLDSRDEAVIWRGPKKNA
NUBP2_NEMVE       ------------------------------PDQRLGVMSIGFLLHSKEDAVVWRGPKKNA
NUBP2_TRIAD       ------------------------------KNEKLAVMSIGFLLRNSKDAVVWRGPKKNA
NUBP2_DICDI       ------------------------------ESQKLGVISIQFLLGDKDTPVIWRGPKKNS
F0ZGG2_DICPU      ------------------------------ETQSLGVISIQFLLGDKDTPVIWRGPKKNS
CFD1_SCHPO        -------------------------------TKEIGLMSLGFLLTSKNDSVVWRGPKKAA
E3K0E7_PUCGT      ---------------------------SSDVQQSLKCMSIGFLLNDPKDSVVWRGPKKNA
CFD1_USTMA        -------------------------------SQHLAVMSVGFLLRSKNDSVVWRGPKKNA
CFD1_CRYNJ        -------------------------------GRRLGVMSIGFLLKDRGDSVVWRGPKKDG
                                                    :  :*: :::     .*:****:*  

CFD1_CANGA        MIRQFIKDVTWG------ELDYLLIDTPPGTSDEHISIAEELRFTNP-------------
CFD1_YEAST        MIKQFISDVAWG------ELDYLLIDTPPGTSDEHISIAEELRYSKP-------------
CFD1_KLULA        MIKQFIKDVDWG------DLDYLIIDTPPGTSDEHISIAEELRWAAP-------------
CFD1_ASHGO        MIKQFISDVYWG------ALDYLLIDTPPGTSDEHISIAEELRGARP-------------
CFD1_CANAL        MIKQFLKDVVW--GSTETPLDYLLIDTPPGTSDEHIAIAEELRWANPI------------
CFD1_DEBHA        MIRQFLKDVVWSGGENNVPLDYLLIDTPPGTSDEHIAIAEELRWANP-------------
CFD1_YARLI        MIRQFIRDVVWG------ELDYLLIDTPPGTSDEHISIAEELRFCDQI------------
CFD1_ASPCL        MIRQFLSDVYWG------PTDYLLVDTPPGTSDEHIALAEQLLTLASTDPS-AT--AAGL
CFD1_ASPFU        MIRQFLSDVSWG------PTDYLLVDTPPGTSDEHIALAEQLLTLASTDPAVAS--SMGR
CFD1_ASPTN        MIRQFLSDVSWG------ETDYLLVDTPPGTSDEHIALAEQLLTTATTDAAAAA--AGGR
CFD1_ASPOR        MIRQFLSDVYWG------ETDYLLVDTPPGTSDEHIALAEQLLRPATTNPA-AG--SSTM
CFD1_EMENI        MIRQFLTDVYWG------DTDYLLVDTPPGTSDEHIALAEELLKLSTTSPSSTG--VGAL
CFD1_COCIM        MIRQFLTDVLWG------ETDYLLIDTPPGTSDEHIALAEQLLTIQQTYSLRSS--RATA
CFD1_CHAGB        MVRQFLSDVFWD------ELDYLLIDTPPGTSDEHISLAETLLQKAHPEQ----------
CFD1_NEUCR        MVRQFLSDVFWD------ETDYLLIDTPPGTSDEHISLAENLLQKARPGQ----------
CFD1_GIBZE        MIRQFLKDVLWD------ETDYLLIDTPPGTSDEHISLAETLQKDATLGQ----------
CFD1_PHANO        MVRQFLTDVLWP------KVDYLLIDTPPGTSDEHISLLETLLKNTSTTPH------ASL
NUBP2_AEDAE       MIKQFLEDVAWE------DLDYLIIDTPPGTSDEHITVMECLKAVNA-------------
NUBP2_CULQU       MIKQFLEDVAWD------ELDYLVIDTPPGTSDEHITVMECLKGVNA-------------
NUBP2_ANOGA       MIKQFLEDVNWD------ELDYLIIDTPPGTSDEHITVMECLKTVRT-------------
NUBP2_DROME       MIRQFLTDVRWD------ELDYLIIDTPPGTSDEHITVMECLKEVGC-------------
NUBP2_DROPS       MIRQFLTDVKWE------ELDYLIIDTPPGTSDEHITVMECMREVPC-------------
A4I1X9_LEIIN      MIKQFVTDVNWG------PLDYLIIDTPPGTSDEHLTLCEVLRSFRP-------------
Q4Q9E8_LEIMA      MIKQFVTDVHWG------PLDYLIIDTPPGTSDEHLTLCEVLRSFRP-------------
A4HEP9_LEIBR      MIKQFLTDVSWG------PLDYLIIDTPPGTSDEHLTLCEVLRNFHP-------------
Q57WQ0_TRYB2      MIRQFVTDVHWG------ALDYLIIDTPPGTSDEHLTLCEVLKPFNT-------------
V5DR48_TRYCR      MIRQFVTDVQWG------TLDYLIIDTPPGTSDEHLTLCEILQPFNP-------------
NUBP2_HUMAN       LIKQFVSDVAWG------ELDYLVVDTPPGTSDEHMATIEALRPYQP-------------
NUBP2_BOVIN       LIKQFVSDVAWG------QLDYLLVDTPPGTSDEHMAVVDALRPHSP-------------
NUBP2_MOUSE       LIKQFVSDVAWG------QLDYLVVDTPPGTSDEHMATMEALRPYRP-------------
NUBP2_RAT         LIKQFVSDVAWG------ELDYLVVDTPPGTSDEHMATVEALRPYKP-------------
NUBP2_XENLA       LIKQFVSDVAWG------DLDFLIIDTPPGTSDEHISTVDALRPFNP-------------
NUBP2_XENTR       LIKQFASDVAWG------DLDFLIVDTPPGTSDEHIATVDALRPFNP-------------
NUBP2_CHICK       LIKQFVADVAWG------ELDFLIVDTPPGTSDEHISTVEALRPYKP-------------
NUBP2_DANRE       LIGQFVSDVAWG------ELDILLVDTPPGTSDEHLAVLENLRKHRV-------------
NUBP2_MONBE       MIQQFLSEVCWD------ELDCLVVDTPPGTSDEHLSIVDALKLCKP-------------
NUBP2_NEMVE       MIKQFLSDVCWG------DIDYLIIDTPPGTSDEHITVVENLKTCHP-------------
NUBP2_TRIAD       MIKQFLSDVVWG------DLDYLIIDTPPGTSDEHITVAENVRGLNL-------------
NUBP2_DICDI       MIKQFIDDVNWG------EIDFLIIDTPPGTSDEHISVTEELLKHNP-------------
F0ZGG2_DICPU      MIKQFIDDVNWG------ELDYLIIDTPPGTSDEHISVTEELLKHNV-------------
CFD1_SCHPO        MIRQFISDVSWG------ELDFLIIDTPPGTGDEHLTIVESLLSETSTVRD---------
E3K0E7_PUCGT      MIRQFLVDVCWG------ELDWLIIDTPPGTSDEHISLLEQLSPLLVHQSQATSPSEPRN
CFD1_USTMA        MIKQFLGDVRWG------TLDYLIIDTPPGTSDEHISILEYLRTFEP-------------
CFD1_CRYNJ        MIRQFLSEVRWG------DLDYLVIDTPPGTSDEHISLLTHLHPLFTPTMSNAT------
                  :: **  :* *         * *::******.***::    :                  

CFD1_CANGA        ---DGAIVVTTPQGVATADVKKEINFCRKVNLRILGVIENMSGFVCPYCTECTNIFSKGG
CFD1_YEAST        ---DGGIVVTTPQSVATADVKKEINFCKKVDLKILGIIENMSGFVCPHCAECTNIFSSGG
CFD1_KLULA        ---DGAIIVTTPQGVATADVRKEINFCKKVNFNILGVIENMSGFICPHCAECTDIFSRGG
CFD1_ASHGO        ---DGAIIVSTPQKVAVADVKKEINFCRKVNFKLLGVVENMSGFVCPHCSECTNIFARGG
CFD1_CANAL        ---DGAIIVTTPQQVATADVRKEINFCKKVNFQILGIVENMSGFICPHCSECTNIFSSGG
CFD1_DEBHA        ---DGAIIVTTPQQVATADVRKEINFCKKVNFDVLGVVENMSGFICPHCSECTNIFSSGG
CFD1_YARLI        ---LGAVIVTTPQGVALADVRKELSFCKKIGFPILGIIENMSGYVCPHCSECQNIFSKGG
CFD1_ASPCL        SRLAGAVLVTTPQAIATSDVRKEANFCVKTKIPVLGVIENMSGYSCPCCGEVSNLFSSGG
CFD1_ASPFU        PRLAGAVLVTTPQAVATSDVRKEANFCVKTQIPALGVIENMSGYTCPCCGEVSNLFSSGG
CFD1_ASPTN        PRLAGAVLVTTPQAIATSDVRKEVNFCVKTRIPTLGVIENMSGYACPCCGEVSNIFSSGG
CFD1_ASPOR        PRLAGAVLVTTPQAVATSDVRKEVNFCVKTQIPMLGVIENMSGYTCPCCGEVTNLFSSGG
CFD1_EMENI        PRLTGAVLVTTPQAIATSDVRKEVNFCVKTNIPTLGVIENMSGYTCPCCGEVSNLFSSGG
CFD1_COCIM        PKLAGAVLVTTPQAISTSDVRKEINFCVKTRIPVLGVIENMSGYTCPCCGEVSNVFSRGG
CFD1_CHAGB        --LAGAVVVTTPQAVATADVRKELNFCTKTGIRVLGVVENMSGFVCPNCSECTNIFMSGG
CFD1_NEUCR        --LAGAVVVTTPQAVATADVRKELNFCTKTNIRVLGVVENMCGFVCPNCSECTNIFMSGG
CFD1_GIBZE        --VAGAVVVTTPQAVATADVRKELNFCTKTNIRVLGVVENMSGYVCPHCSECTDIFGSGG
CFD1_PHANO        PYLAGAVVVTTPQAISISDVKKELNFCKKTGIRVLGVVENMAGFVCPNCSECTNVFSKGG
NUBP2_AEDAE       ---DGAIIVTTPQEMALEDVRKEVTFCKKTGINIIGIVENMSGFVCPNCTECTNIFSSGG
NUBP2_CULQU       ---DGAIIVTTPQEMALEDVRKEVTFCKKTGIAILGIVENMSGFVCPNCAECTKIFSSGG
NUBP2_ANOGA       ---EGAIIVTTPQEMALEDVRKEVTFCKKTGIPILGIVENMSGFVCPNCSECTNIFSSGG
NUBP2_DROME       ---HGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFSSNG
NUBP2_DROPS       ---NGAIIVTTPQSVALDDVRKEITFCKKTGIKLLGIVENMSGFVCPNCTNCTNIFSSNG
A4I1X9_LEIIN      ---SGAVVVTTPQDVSTDDVKKELSFCHKLQLRCLGIVENMSGFVCPHCAHCTDIFSKDG
Q4Q9E8_LEIMA      ---SGAVIVTTPQDVSTDDVKKELSFCHKLQLRCLGIVENMSGFVCPHCAHCTDIFSKGG
A4HEP9_LEIBR      ---SGAVVVTTPQDVSTDDVKKELSLCYRLELRCLGIVENMSGFACPYCAHCTDIFSKGG
Q57WQ0_TRYB2      ---AGAVIVTTPQDVATDDVKKELSLCHKLELRCLGVVENMSGFVCPHCAHCTDIFSKGG
V5DR48_TRYCR      ---TGAVIVTTPQDVATDDVKKELSFCHKMGIRCLGVVENMSGFVCPHCAHCTDIFSRGG
NUBP2_HUMAN       ---LGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGG
NUBP2_BOVIN       ---LGALVVTTPQAVSVGDVRRELTFCRKVGLRVIGLVENMSGFVCPHCSECTNVFSKGG
NUBP2_MOUSE       ---LGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFTCPHCAECTNVFSSGS
NUBP2_RAT         ---LGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFACPHCAECTNVFSSGG
NUBP2_XENLA       ---MGALLVTTPQAVSVGDVRRELTFCKKTGLRVIGIVENMSGYVCPHCTECTNIFSKGG
NUBP2_XENTR       ---MGALLVTTPQAVSVGDVRRELTFCKKTGLRVIGIVENMSGYVCPHCTECTNIFSKGG
NUBP2_CHICK       ---LGAILVTTPQAVSVGDVRRELTFCKKTGLRVLGIVENMSGFVCPHCSECTNIFSKGG
NUBP2_DANRE       ---DGAVLVTTPQAVSTGDVRREITFCKKTNLKILGIVENMSGFVCPHCSECSNIFSKGG
NUBP2_MONBE       ---DGAILVTTPQGVALSDVRREAEFCRKARLKVLGVVENMSGFACPHCKDCTNLFSKGG
NUBP2_NEMVE       ---DGAILVTTPQGVAISDVRREITFCKKTKIPVLGIVENMSGFVCPHCSECTNVFSKGG
NUBP2_TRIAD       ---TGAVMVTTPQAVALGDVRREITFCKKVGIPIVGIVENMSGYTCPNCSECTNIFSKGG
NUBP2_DICDI       ---DGAILVTTPQAVSISDVKKEISFCNAMKLPIIGIIENMSGYVCPHCSECTNIFSSEG
F0ZGG2_DICPU      ---DGAILVTTPQGVSISDVRKEISFCNAIKLPIIGIIENMSGYVCPHCSECTNIFSSEG
CFD1_SCHPO        VPIDGAVIVTTPQGIATLDVQKEIDFCKKASIKILGIVENMSGYICPHCADCTNIFSSGG
E3K0E7_PUCGT      LPSLSSVLVTTPQAVSLLDVSKEYDFTKKTGLRVLGLIENMSGFICPHCQQIQNIFGSGG
CFD1_USTMA        ----AAVMVTTPQAVSLADNLRSLDFCRKTSLPVLGLIENMSGYICPHCNDCTNVWGKGG
CFD1_CRYNJ        --TPTSILISTPQTTALNDTLKSLSFTRKLSLPVMGLVENMAGYVCPCCGEISDTFGKGG
                       .::::***  :  *  :.  :     :  :*::***.*: ** *    . :   .

CFD1_CANGA        GE---------------SLAKQFDVPYLGNIPIDPKFVDLIE------------------
CFD1_YEAST        GK---------------RLSEQFSVPYLGNVPIDPKFVEMIE------------------
CFD1_KLULA        GF---------------KLASEYNVPYLGNIPIDPTFVELIE------------------
CFD1_ASHGO        GE---------------SLALESGVPFLGTVPIDPAFVEMIE------------------
CFD1_CANAL        GK---------------ALSEQLNLTYLGNVPIDPQFVELVE------------------
CFD1_DEBHA        GK---------------ELSEKLDLQFLGNIPIDPSFVEMVE------------------
CFD1_YARLI        GE---------------NLAKQYECKFLGTVPIDPKFVLMVE------------------
CFD1_ASPCL        GK---------------VMADELGIKFLGSVPVDVKFGELVEGKVV----DDSDSDEEEG
CFD1_ASPFU        GK---------------VMAEELGIRFLGTVPVDVKFGELVEGKMV----VDSDSDEEDG
CFD1_ASPTN        GR---------------AMAQEMGIKFLGVVPVDVKFGELVEGGKI----QDGSDSEDEG
CFD1_ASPOR        GQ---------------VMAQETGVKFLGAVPVDIQFGELVEGKVV----DESDDESEDG
CFD1_EMENI        GE---------------VMAREMGVRFLGKVPVDVQFGALVEGKSQ----EESDDEDEDR
CFD1_COCIM        GQ---------------IMAQETGVRFLGAVPIDVGFGEMVEGWKK----DSTGQDQGNK
CFD1_CHAGB        GE---------------VMAKDFNVRFLGRIPIDPQFLVLIETGKSPRYPEGTSVNGQDI
CFD1_NEUCR        GE---------------VMANDFGVRFLGRVPIDPQFLVLIETGKRPTYPAGTTVDGKDI
CFD1_GIBZE        GK---------------SMAEEFNVPFLGSVPMDAQFIALLEEGQRPTYPSGTTVGGKDI
CFD1_PHANO        GE---------------VMARDFNVPFLGSVPIDPAFVQLVEEGTRPLYPEGTIMAGTDV
NUBP2_AEDAE       GV---------------ALAELAKVPHLGTLPIDPRVGALAGSGKA--------------
NUBP2_CULQU       GV---------------ALAELAQVPHLGTLPIDPRVGALAGTGKA--------------
NUBP2_ANOGA       GH---------------SLAELAKVPHLGTLPIDPRVGELAGTGKA--------------
NUBP2_DROME       GV---------------SLATYAQVPHLGTLPIDPRVGILAGTTTS--------------
NUBP2_DROPS       GV---------------ELAHLVQIPHLGTLPIDPRVGVLAGSTAS--------------
A4I1X9_LEIIN      GK---------------KLAEMYEVAFLGAIPIDPNLSLAEDMGRV--------------
Q4Q9E8_LEIMA      GR---------------KLAEMYEVAFLGAIPIDPNLSLAEDMGRV--------------
A4HEP9_LEIBR      GR---------------RLAELYEVPFLGAIPIDPNLSLAEDMGRA--------------
Q57WQ0_TRYB2      GK---------------KLAEMYEVEFLGAIPIDPTLSLAEDKGQC--------------
V5DR48_TRYCR      GR---------------KLAELYEVEFLGAIPIDPMLSLAEDKGQC--------------
NUBP2_HUMAN       GE---------------ELAQLAGVPFLGSVPLDPALMRTLEEGHD--------------
NUBP2_BOVIN       GE---------------ELARHAGVPFLGSVPLDPELTRSLEDGRD--------------
NUBP2_MOUSE       GE---------------ELARLAGVPFLGSVPLDSQLTRSLEEGRD--------------
NUBP2_RAT         GE---------------ELARLAGVPFLGSVPLDPQLTRSLEEGRD--------------
NUBP2_XENLA       GE---------------ELARLSGVPFLGCVPLDPLLSQSLEQGKD--------------
NUBP2_XENTR       GE---------------ELARLSGVPFLGCVPLDPLLSQSLEQGKD--------------
NUBP2_CHICK       GE---------------ELAKHAGVPFLGSVPLDPQLSQSLEEGRD--------------
NUBP2_DANRE       GE---------------ELAKLTGSAFLGSVPLDPLLTESLEEGRD--------------
NUBP2_MONBE       GE---------------KLAQEIAAPFLGAIPIDPMLGQSLSRGED--------------
NUBP2_NEMVE       GE---------------ALAKECEVPFLGCIPLDPNLTMNIEDGKS--------------
NUBP2_TRIAD       GE---------------ALAQLTQVPFLGCLPLDPKLTMSIEDGKS--------------
NUBP2_DICDI       GK---------------LLAEQCNIKFLGKLPIDPNLSICSERGIN--------------
F0ZGG2_DICPU      GK---------------LLAEQCNIKFLGKLPIDPNLSICSERGIN--------------
CFD1_SCHPO        GL---------------TLSEKYKLPFLGSVPIDPKFGEMIENLTP-----------DSN
E3K0E7_PUCGT      GQSFCEKVSNSTQPDGDSHDQHPSLRFLGKIPIDVQFMKLMDQATN-------------P
CFD1_USTMA        GE---------------ALAKREGLRFLGRIPIDPGLVRVLDDAKDDAHVELQKQLHQTS
CFD1_CRYNJ        GE---------------AMAHKEGVGFLGRVPIDTVLVSLLDAVSKGEVLGEGAVEHTSD
                  *                         .** :*:*  .                       

CFD1_CANGA        -NQKKMEG----------------------------------TLVELYEKSSLYPIYLEI
CFD1_YEAST        -NQVSSKK----------------------------------TLVEMYRESSLCPIFEEI
CFD1_KLULA        -KQTGFKE----------------------------------SLVDLYKDSGLYVIFSKI
CFD1_ASHGO        -SQSSREE----------------------------------PLISLYKTSGLYPIFARI
CFD1_CANAL        -LQNEQEN---------------------------------KKLIELYDDCELKPILNGI
CFD1_DEBHA        -MQDNDQNDGK------------------------------KKLVDLYDDCELKGIMEGI
CFD1_YARLI        -NAKGGLQ-------------------------------------EIYGETDMAKIFAGI
CFD1_ASPCL        ATQAQQQE----------------------------EPVDDRPLVERYKDCWSHSRFEEF
CFD1_ASPFU        PTQAQQPE----------------------------EPVDNRPLVERYKDCWSYSRFEEF
CFD1_ASPTN        ETARQEPEP---------------------------EAVDDRPLVERYKDCWSYPRFEEF
CFD1_ASPOR        AQPEQKREQKQD------------------------EVVDERPLVERYKDCWSYSRFEGF
CFD1_EMENI        ERNKVEEEKGQ-------------------------DFVDERPLVERYKECWSYGQFEGF
CFD1_COCIM        ATKKGQDARL--------------------------DSYDDL-LVERYKKCWSFSVFEEF
CFD1_CHAGB        SSATQVAANGDE-------------------------TRDSRLLVYKYKSCSLAPIFGPI
CFD1_NEUCR        STPAGASTSEEE------------------------EVKDGSRLVHKYKDCSLAPIFSKI
CFD1_GIBZE        STKETETRTQEG------------------------------NLVDKYQDCSLSHVFKDI
CFD1_PHANO        SAAPNGKEAGST------------------------------------THGSRLLICE--
NUBP2_AEDAE       CVKELPD-----------------------------------CTTSKILQSIADNISAEK
NUBP2_CULQU       CVTELPD-----------------------------------CTTSLVLKSIAKSIGAE-
NUBP2_ANOGA       CVKELPD-----------------------------------CTTSEVLRELVRTLTTVG
NUBP2_DROME       VLDELPD-----------------------------------STTAEVLTHIVEKLKTML
NUBP2_DROPS       VLDELPD-----------------------------------SPTAQVLRGIVQHLVALT
A4I1X9_LEIIN      FVKESP------------------------------------SQTVEAVTAVIDAIVRQV
Q4Q9E8_LEIMA      FVKESP------------------------------------SQTVDAVTAVIDAIVQQV
A4HEP9_LEIBR      FVKEAP------------------------------------SQTVEAVKAVIDAILQQV
Q57WQ0_TRYB2      FVTTATDANSP-----------------------------TVRKTVAAVTGVIDAILKQV
V5DR48_TRYCR      FLTAENDEGN---------------------------------ETVTAVKKVIGAILKQV
NUBP2_HUMAN       FIQEFPG-----------------------------------SPAFAALTSIAQKILDAT
NUBP2_BOVIN       FIQDFPD-----------------------------------SPAFPALSSIAQKILSET
NUBP2_MOUSE       FIQEFPK-----------------------------------STAYSALTSIAQRVVHRM
NUBP2_RAT         FIQEFPK-----------------------------------STAYSALTSIAHKVLHQM
NUBP2_XENLA       LMQEFPN-----------------------------------SAAYPAISSITRQILDMA
NUBP2_XENTR       FVQEFPN-----------------------------------SAAYPAISSIARQILDMA
NUBP2_CHICK       FIQEFPK-----------------------------------SSAFPALTRIAQQILDGA
NUBP2_DANRE       FLQAFPE-----------------------------------SSTFTAISHIANTLLNSL
NUBP2_MONBE       FLASCQA-----------------------------------APSYEAVAALIDPLMAQL
NUBP2_NEMVE       FSDLLSN-----------------------------------SPAVESVNSIVTKISHAT
NUBP2_TRIAD       FTELYSE-----------------------------------SPTALAIREIIRPLITS-
NUBP2_DICDI       YFTEYPN-----------------------------------SSTLASLKSFVDNFNFKS
F0ZGG2_DICPU      YFKEYPN-----------------------------------SSTLSALKTFAEALNN--
CFD1_SCHPO        IVHLYSKTEMS-------------------------------KKFSFITNEFLNQLYGPR
E3K0E7_PUCGT      DQQPASDPSN---------------------------LMHPPASSPNANSLLIDRYFDTV
CFD1_USTMA        LNDNVLKAIDQPLTPHSQSAAAQLPNSGDTESLTPAGTMLSRTTIQRYKNSLTFPIFQEI
CFD1_CRYNJ        EAAEGQTNGSTE----------------------------HFPLLDKYLETTSSKVWKDI
                                                                              

CFD1_CANGA        MKKVQ---------EESSKPQE-------
CFD1_YEAST        MKKLRKQDTTTPVVDKHEQPQIESPK---
CFD1_KLULA        LDNVL---------NGEVKSGTDQ-----
CFD1_ASHGO        VQHVL---------DQGIPSRCQ------
CFD1_CANAL        VDKIL---------DKNLPSRI-------
CFD1_DEBHA        VDKVL---------EQQHPARF-------
CFD1_YARLI        CDKAFSEENEEEAKETAEEEKSRAATNGQ
CFD1_ASPCL        AKTLI----------SQIEGASPASG---
CFD1_ASPFU        AKTLI----------SQIESGSAAS----
CFD1_ASPTN        ARTLI----------ADIDGA--------
CFD1_ASPOR        ADTLL----------SEIEGGVAY-----
CFD1_EMENI        AKTLI----------GEIEG---------
CFD1_COCIM        AKKLI----------GLIEGSDQQ-----
CFD1_CHAGB        TADII----------ADVTR---------
CFD1_NEUCR        TADVI----------SAVQQ---------
CFD1_GIBZE        TDKVL----------VNVGG---------
CFD1_PHANO        -----------------------------
NUBP2_AEDAE       S----------------------------
NUBP2_CULQU       -----------------------------
NUBP2_ANOGA       Q----------------------------
NUBP2_DROME       VS---------------------------
NUBP2_DROPS       -----------------------------
A4I1X9_LEIIN      ERAKV------------------------
Q4Q9E8_LEIMA      ERAKA------------------------
A4HEP9_LEIBR      ERARA------------------------
Q57WQ0_TRYB2      EKSAQLQQRH-------------------
V5DR48_TRYCR      ERASFLE----------------------
NUBP2_HUMAN       PACLP------------------------
NUBP2_BOVIN       PAGLS------------------------
NUBP2_MOUSE       SALCS------------------------
NUBP2_RAT         PALCS------------------------
NUBP2_XENLA       SPQS-------------------------
NUBP2_XENTR       SPRS-------------------------
NUBP2_CHICK       LQRSS------------------------
NUBP2_DANRE       NA---------------------------
NUBP2_MONBE       GLVQATADTSTPSH---------------
NUBP2_NEMVE       SQNQT------------------------
NUBP2_TRIAD       -----------------------------
NUBP2_DICDI       STTTTATN---------------------
F0ZGG2_DICPU      -----------------------------
CFD1_SCHPO        KLDTITT>---------------------
E3K0E7_PUCGT      SSKVFAEICSLIVQSITGSSAI-------
CFD1_USTMA        TDQIRDLATKHKLHPQSSVLTTAL-----
CFD1_CRYNJ        TQKLVDKIEQHKSDIRARLESSSETLAIA