CLUSTAL format seed alignment for MF_03040

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G1MFP5_AILME          -------MSAAPLVGYSSS---GSEDEDE------------------AEAEARAQARPGA
F6XDF2_CANLF          ------<MSAAPLVGYSSS---GSEDEAGA------------G--AGAGAGAGAQAQPGA
USB1_BOVIN            -------MSAAPLVGYSSS---GSEDE----------------------AEAGARVRPGA
F7E331_HORSE          -------MSAAPLVGYSSS---GSEDE----------------------AETEACARPGV
A0A2I2YWK7_GORGO      -------MSAAPLVGYSSS---GSEDE----------------------SEDGMRTRPGD
G1QSX4_NOMLE          -------MSAAPLVGYSSS---GSEDE----------------------SEDGMRTRPGD
USB1_HUMAN            -------MSAAPLVGYSSS---GSEDE----------------------SEDGMRTRPGD
F6TF64_CALJA          -------MSAAPLVGYSSS---GSEDE----------------------SEDGMRTRPGD
I3M9Y2_ICTTR          -------MSAGPLVGYSSS---GSEDEDEA------------E--AEIEAATQGRTWPGA
H0VQR9_CAVPO          -------MSTAPLVGYSSS---DSEDE-------------------AKTAVARGRTRPWS
USB1_MOUSE            -------MSSAPLVGYSSS---GSEDE--------------------AEAVAAGRSKPGT
USB1_RAT              -------MNAAPLVGYSSS---GSEDE--------------------AEAVAAGRSKPGS
G1T0I8_RABIT          -------MSAASLVGYSSS---GSEDE----------------------AEAATTTSPGA
F6TSW3_MONDO          -------MCAALLVGYSSSSSSGSEDE----------------------DEPGRRAEAEH
H2ZRU7_LATCH          --------MSGLLVSYSSSSEEGEAEPRGR------------DETEEKRDQRGKRERESY
USB1_XENLA            ----------MALVSYSSS----EEDE-------------------------GETSEPPG
B1WBH1_XENTR          ----------MALVSYSSS----EDDE-------------------------GETTEPPG
G3NG05_GASAC          -----------MLVGYSSS----SSED-----DSEAATDRHKRGSPKCQEQDGGNNVSPA
I3JYI2_ORENI          -----------MLVGYSSS----SEDDGEAGGEAEGDKNQSETTCRKCQEEDDG---LPT
H2T2E5_TAKRU          -----------MLVGYSSS----SEEE----------NDPVVQDGKRPAEEDDG---CSA
H2MAR0_ORYLA          -----------MLVSYSSS----SEEEEE---SQASTKSQICSPKKEKIRSQSAEVLPPS
USB1_DANRE            -----------MIVNYSSS----SSEE-------ESGSSSSPSGKRQKLDTETSEALDHG
USB1_DROME            ----------MALVDYGGSSSSASEDED-----------------------CTENIQTPA
Q295J3_DROPS          ----------MALVNYEGSGSSSSEDD----------------------------PPNLI
W5JWR4_ANODA          ------------------------------------------------------------
Q7QK92_ANOGA          ------------------------------------------------------------
Q16WV0_AEDAE          -----MLINVFSSIDGSHARLLDT------------------------NPMHNIQQYSSS
F6WVC9_CIOIN          ------MNSLEMLGEYSSS----SDEE-------------------------------SI
H2Y8C0_CIOSA          MLKLFSMTSLDKLREYASS----SEED-------------------------------SS
B9ICF1_POPTR          ---------MEILRASYGDASSDSDSDSS------------------------------S
A5BG02_VITVI          ---------MDALRASYANSCSDSESDSD------------------------------T
I1J6I2_SOYBN          ---------MEALKASYGDGSSDSDSESA------------------------------H
Q9LU57_ARATH          ---------MEALRASYGDSSSDSDTDDL------------------------------S
I1IC44_BRADI          ---------MDALMANYA---SGSDDD--------------------------------E
I1IC41_BRADI          ---------MDALMANYA---SGSDDD--------------------------------E
I1P2N1_ORYGL          ---------MDALVANYA---SDSDSDGD------------------------------A
A9T750_PHYPA          ---------MDALQFYESSSDSDVDEETER------------------------RGFCVK
D6RP66_COPC7          ---------MKRQIGLLADYSSSEEEEHDE------------------------Q----K
F8Q1E3_SERL3          ---------MIRKAPGLVSYESSDDE----------------------------------
C0NG58_AJECG          ----------MSLVQYSDSESEQDDNSPRRDTHPTV--------TKLSKRPRKLQHTDRN
Q4WCA6_ASPFU          ----------MALVQYSGTESDTEESE--------------------EKPPRPAKKSRHN
A7ELI2_SCLS1          ----------MALVDYTSSDEDDVDDDFDQKHQHN------------EEDEKNITTKTSN
Q0UUC1_PHANO          ----------MSLVPYPDSDSDEDVGGH-------------------GIAAQSPGRAPKS
D5GJ68_TUBMM          -----MAPLTSSLVEYSDSDSDGSPPAK-------------------MAKTTYLTPANKS
I1RLU0_GIBZE          ----------MALVDYSS-SGSESE-----------------------PDTQPVKRRKAV
C7YJB6_NECH7          ----------MVLVDYSS-SDSADEDSG--------------------PDSRRIKRRKCA
USB1_NEUCR            --------MKRPLVDYDSGSGSESECGSSSDGPKSS--------STNIPPQLKKRRNGDI
A0A158NKN2_ATTCE      ------MTGLHLIQTYSSD----SDED-------------------------------EH
E9HMQ4_DAPPU          ---------MDMIAAAYGCESDEEDSDP------------------------WASSRVSA
E0VD50_PEDHC          ---------MSALNQLSIYCSSDSDED---------------------------------
G4VJ07_SCHMA          --------MNTHLVEYSSS-----------------------------------------
F4P6D0_BATDJ          --------MPKDTHRHQSP--------------------------------------STG
D0MXX8_PHYIT          ---------MESIVAAYGS-----------------------------------------
Q6C5L7_YARLI          ------------------------------------------------------------
USB1_DICDI            ---------MEFLKHYEDDEDQDDENN--------------------------TKDENVN
C4LTL3_ENTHI          ---------------------------------------------------------MTD
B6JYX6_SCHJY          ---------MAALVNYSSS-------------------------------------DSDT
USB1_SCHPO            ----------MSLVCYESS----------------------------------------S
B7G7S5_PHATC          ---------MDLLACYDSDSCASNSHNDCDCDCG-----------------ENRMGQQPL
H2AZ76_KAZAF          ---------MNLLRDDYGSETSDSDTVN------------------------------SE
USB1_YEAST            --------MEFISADYSSSDGSDTESE--------------------------------S
I2GVP3_TETBL          ---------MNVLQELYASDYSSDEDSE-----------------------------SVK
Q6FJQ8_CANGA          ---------MNILAEYSSESEFESEENLKS------------QNSEEVIPPIENWEKSGE
C5DY58_ZYGRC          ---------MDHIREDYSS-----------------------------------------
                                                                                  

G1MFP5_AILME          GGCRRAQSPLPSQ------------------------RLPVPDSVLHMFL-DTKEEP---
F6XDF2_CANLF          GGCGRAQSPLPSQ------------------------RLPVPDSVLHMFL-DTEEEP---
USB1_BOVIN            EGRSRGQSPLPGQ------------------------RLPVPDSVLHMFP-STEEGP---
F7E331_HORSE          GGRHRGQSPLPSQ------------------------RLPVPDSVLHMFP-GTEEGP---
A0A2I2YWK7_GORGO      GSHRRGQSPLPRQ------------------------RFPVPDSVLNMFP-GTEEGP---
G1QSX4_NOMLE          GSHRRGRSPLPRQ------------------------RFPVPDSVLNMFP-GTEEGP---
USB1_HUMAN            GSHRRGQSPLPRQ------------------------RFPVPDSVLNMFP-GTEEGP---
F6TF64_CALJA          GSQRSGQSPLPRQ------------------------RFPVPDSVLNMFP-GTEEGP---
I3M9Y2_ICTTR          GGCRRGQSPDPSQ------------------------RFPVPDSVLNMFP-STEERP---
H0VQR9_CAVPO          GGHCRGQSSLSNE------------------------RFPVPDSVLNMFP-DDK--P---
USB1_MOUSE            GFHRCGQNPVPSE------------------------KLPVPDSVLSMFP-STEEGP---
USB1_RAT              GLHRCGQNPLPSQ------------------------RFPVPDSVLNMFP-STEEGP---
G1T0I8_RABIT          GGRPGG--PRPSE------------------------RFPVPESVLNMFP-GLEEGP---
F6TSW3_MONDO          EKDGDSRCPPPPP------------------------RLPIPTSVLNMFP-DSEDGV---
H2ZRU7_LATCH          QRPKRCKKDLQSRPPD-----------------AADARLPVPESVLKMFGEGEEEEG---
USB1_XENLA            RR-------LPPL--------------------------PPPTTVLRMFQDMEGDED---
B1WBH1_XENTR          RF-------LPPL--------------------------PPPTTVLRMFQDREDDEG---
G3NG05_GASAC          RKKPKIEEQVSKT------------------------RLPLPGCLLDMFP-EDVSSP---
I3JYI2_ORENI          RKKPKTEEEGPKS------------------------RLPLPGCVLAMFP-DEVDSQ---
H2T2E5_TAKRU          RKKPKTQGEVPKTSW------------------TVSCRLPLPGCLLTMFP-EELDPQ---
H2MAR0_ORYLA          IPQRRLERWRPQTG-----------------------RLPLPDCLQTMFP-DEEDRQ---
USB1_DANRE            SAQRKVCKSSHLTP-----------------------RLPLPESVKEMFR-DSEELW---
USB1_DROME            LITLKRPA-LPKAA-------------------------TLLGPKKPKP-EEFVEDV---
Q295J3_DROPS          LNTLKRSAALPTAV-------------------------TLLGPKKAKPVEEDGDEV---
W5JWR4_ANODA          MEKK----------------------------------LPAPALKLHSTTTPSE--E---
Q7QK92_ANOGA          MENEKLKKTTAIVP-----------------------ALPSPALCIPGTTDDTEPDE---
Q16WV0_AEDAE          ESDENDDPQNKHSA-----------------------RLPPSKELLRVPTTSDAPDS---
F6WVC9_CIOIN          SISKTNTASSQKS------------------------KLVVPDAICALYA-TEQTEH---
H2Y8C0_CIOSA          SGLKTISPENKRT------------------------KLPLPDVICSLSD-PTNTEY---
B9ICF1_POPTR          PPTTKSVPPVSNPK-------------------AEAIALPPPPLALLT-PPNPLGAL---
A5BG02_VITVI          PRPTNENHQASGP-------------------------LPPPPLALLS-PPNSLGEL---
I1J6I2_SOYBN          SIPTSAPSAVFTP-------------------------LPPPPISLLD-PPS----I---
Q9LU57_ARATH          PASPVTANSGEKD----------------------SISLPPPPLALLD-SIVSTGSL---
I1IC44_BRADI          PTASTLENQ------------------------EASALLPPPPLDLLQ-PPN---FV---
I1IC41_BRADI          PTASTLENQ------------------------EASALLPPPPLDLLQ-PPN---FV---
I1P2N1_ORYGL          PAATAGEAAPVPP--------------------EPSALLPPPPLDLLQ-PPN---FV---
A9T750_PHYPA          RFKPAAEDKTESSS-------------------ALPLSLPPPPPELFSSIPDAAGTK---
D6RP66_COPC7          IVATKPEPPAKRK------------------------KLPALSESISGPIHK--------
F8Q1E3_SERL3          --NTAKEPVPKKR------------------------KLPALTPSLVVPAPI--------
C0NG58_AJECG          NDRSSNGDGNSGN----------------------TTLPPLPSEFLDLYATNSRLSV---
Q4WCA6_ASPFU          S--SSVDDRVS-------------------------SLPPLPTAFRDLYASSTRVSV---
A7ELI2_SCLS1          SNNLKRKRSISCS----------------------SELPPLPSKFHDLYASTVRNST---
Q0UUC1_PHANO          PIQLKRKHSQSAQ----------------------DDLPPLPAAFHDLYTTNARIST---
D5GJ68_TUBMM          PTSTSKYSKASSS----------------------NSLPPLPSRFHDLYAVAPRVGQ---
I1RLU0_GIBZE          DG----SSRSVDGDSAAG----------------ASSMPPLPDTFHDLYASTVRQSV---
C7YJB6_NECH7          DGTAAHSSRTSDTTRTPSNPTADAGARLQLKDVEASSMPPLPDTFHDLYASTVRQSV---
USB1_NEUCR            GTRAPPSAPASTPIAPLGRSSGTHTIPPKPAPKSTSSLPPISDRFNDLYASNTRTAV---
A0A158NKN2_ATTCE      DETRKDDHKIVNK-------------------------LTLPASILSWKGVTSNEEV---
E9HMQ4_DAPPU          KRTIGRDEEFSSRP---------------------FKKVPNRLPAPKLITHEEPDEV---
E0VD50_PEDHC          --INCNESDVGER-------------------------LTLPNPFTKSKK---CTKD---
G4VJ07_SCHMA          -----DEEKTEK--------------------------LELPTTLQDLNSDSFRFFVR--
F4P6D0_BATDJ          STWPLGNKKKSNS--------------------------LNTDRLKPNAIQTTVSKAS--
D0MXX8_PHYIT          --SSESSHDAASS--------------------------SSDSEAGCAATGDDTQVGT--
Q6C5L7_YARLI          -MKVDKPGPRKKP------------------------LPPLPSSFYHLYTSKPASQLD--
USB1_DICDI            KINKRQHFEIENVI---------------------DEIPDLPLSFFENFKKIKHYSS---
C4LTL3_ENTHI          HEETSTQKAVSLTD------------------------TNDLFQLLNELESRFLPMRS--
B6JYX6_SCHJY          DVSSNEIENAPSRP-----------------------KLSLPEEFENKYR---SSPRL--
USB1_SCHPO            SGEDDDETISDNPR-----------------------MLKVPKLQESFHELYKKKPKT--
B7G7S5_PHATC          DAILAVSAESPPES---------------------HSTVIPSQTLGCVTIIASGPDDT--
H2AZ76_KAZAF          SSGSDPSLKVKRRK-----------------------VQGKQAHLPPVPDSIGAKYHI--
USB1_YEAST            SNKSEVQIEYTEKT------------------------CIQKADSTDLPAIPDSIILK--
I2GVP3_TETBL          HIEIEEEKEKEKD------------------------HNTSTTKKETIPSSITSKYHF--
Q6FJQ8_CANGA          VSNLEEWQRTHRDDIDTV-----------------IKLPPIPSSVYDKYQIPPNTDKYIE
C5DY58_ZYGRC          ---SDSESDIETV-------------------------PELPDAILDKYHLTPSVNM---
                                                                                  

G1MFP5_AILME          EDDREKHGGRVRT---FPHERGNWATHVYVPYETR---------EEFLGLLDVLLPHAQT
F6XDF2_CANLF          VDDPEKHGGRVRT---FPHERGNWATHVYVPYETR---------EEFLDLLDVLLPHAQT
USB1_BOVIN            VDDSAKHGGRVRT---FPHERGNWATHVYIPYEAR---------EEFLDLLDALLCHAQT
F7E331_HORSE          EDDSAKHGGRVRT---FPHERGNWATHVYVPYEAG---------EDFLELLDVLLPHAQT
A0A2I2YWK7_GORGO      EDDSTKHGGRVRT---FPHERGNWATHVYVPYEAK---------EEFLDLLDVLLPHAQT
G1QSX4_NOMLE          EDDSTKHGGRVRT---FPHERGNWATHVYVPYEAK---------EEFLDLLDVLLPHAQT
USB1_HUMAN            EDDSTKHGGRVRT---FPHERGNWATHVYVPYEAK---------EEFLDLLDVLLPHAQT
F6TF64_CALJA          EDDSAKHGGRVRT---FPHERGNWATHVYIPYEAK---------EEFLDLLDVLLPHAQT
I3M9Y2_ICTTR          EDDSAKHGGRVRT---FPHERGNWATHVYLPYEAR---------EEFLELLDLLLPHAQT
H0VQR9_CAVPO          EDDSAKHGGRVRT---FPHERGNWATHVYVPYEAK---------EEFPDLLDVLLPHAQT
USB1_MOUSE            EDDSAKHGGRIRT---FPHERGNWATHIYIPYEAK---------EDFRDLLDALLPRAQM
USB1_RAT              EDDSARHGGRIRT---FPHERGNWATHIYIPYEAN---------EEFQDLLDVLLPRAQM
G1T0I8_RABIT          QDDSAKHGGRVRS---FPHERGNWATHVYIPYAAR---------EEFLDLLDVLLRRAQA
F6TSW3_MONDO          VDDIEKHGGRIRT---FPHERGIWATHVWVPYEAR---------EDFFDLLSLLMTQARR
H2ZRU7_LATCH          HEDRARHSGRMRT---FPHERGNWATHVYVPYQTD---------EDFHELLDLLVSHLRH
USB1_XENLA            LDENTKHEGRIRS---FKHERGNWATYVYIPFQPQ---------EEFLDLLDELVSVAAE
B1WBH1_XENTR          LDDRTKHGGRIRS---FTHERGNWATYVYIPFQPQ---------DEFLDLVDELLSVAAE
G3NG05_GASAC          TEDSSLHGGRVRS---FKHERGSWATYVYLPYHPE---------EEFGELLEELLSLAGA
I3JYI2_ORENI          TEDSSLHGGRIRS---FKHERGNWASYIYFPYHPE---------EEFGELLDGILSAAGA
H2T2E5_TAKRU          TEDRSLHGGRIRS---FKHERGNWATYVYFPYQPE---------EEFVELLDQMVSVAKA
H2MAR0_ORYLA          TEDSSLHGGRIRS---FKHERGNWATYVYFAYHPE---------EEFEELLEELLSASTS
USB1_DANRE            TDKSEEHGGRLRS---FQHERGNWATYVFFPYDPE---------EAFLEVLNKMMAAAEA
USB1_DROME            VDDPAEHGGRMRS---FKHERGNWATYVYVPATAC---------VDQLEEFQTEAIARLE
Q295J3_DROPS          VDDPALHGGRIRS---FKHERGNWATYVYVPALAC---------AEQLEEFQEEAIACLA
W5JWR4_ANODA          ERKPEDHEGRQRS---FPHERGIWASYVYIDYEGQ---------EGLERMQQEWNQELRA
Q7QK92_ANOGA          QQGLSKHQGRTRS---FPHERGIWASYVFIDYGDS---------DGWLEMQNECKTLLND
Q16WV0_AEDAE          ERDPSKHQGRVRS---FAHERGIWASYVFIDYNEI---------DAFDDLQKQLIEK-SM
F6WVC9_CIOIN          N-DPTKHQGRVRS---FQHVKGNWATFLYIPYP-----------NPHCNELRSYVEDLLQ
H2Y8C0_CIOSA          NNDPSKHQCRIRS---FDHVKGNWATFLYIPYP-----------EEFSEELKINVFDLFQ
B9ICF1_POPTR          DSMLNGQSSRIRS---FPHVQGNYALHVYIPVNIP--PALKKEVVQFLNRISLVVPGLHV
A5BG02_VITVI          NYSQTAQSGRVRS---FPHVEGNYALHVFIPVYIP--SSPKKELVQYLKKVMSLVPGLHV
I1J6I2_SOYBN          LDLQIGQTTRLRS---FPHVDGNYALHVYIPIYIS--SPSKKELVAFLKKISSREPRLNV
Q9LU57_ARATH          DFFSTEPGVRVRN---FPHVDGNYALHVYVPVCIP--PLPKKEIVCFLKKVASVVPHLHL
I1IC44_BRADI          DYSKMAQGSRIRS---FPHVEGNYALHVYIPVVIP--FDARKQLTIVMRRAASLVPDLYA
I1IC41_BRADI          DYSKMAQGSRIRS---FPHVEGNYALHVYIPVVIP--FDARKQLTIVMRRAASLVPDLYA
I1P2N1_ORYGL          DCSTMAQGSRVRS---FPHVEGNYALHVYIPVVIP--SDAKKHLALVMRRAASFVPDLYA
A9T750_PHYPA          KRTRSDHGGRVRA---FPHVEGNYALHVYIPVVLS--ASIRTKIALYLQKAVSLFPSLKS
D6RP66_COPC7          -DDPALHQGRIRT---TPHVEGQFAAHVYVSLSLKGNPTLYKLLKEVLRDAKELVPTLHE
F8Q1E3_SERL3          -DNPVLHQGRIRT---VPHVDGQYAAYIYVPLILEPTNPLNLLIEDALNYTKQVVPSSYE
C0NG58_AJECG          QDDPSLHHGRKRM---MPHVAGNWPTHIYLEWFPA---------PTELAILEEAIARCDQ
Q4WCA6_ASPFU          RDDPSLHGGRKRV---IPHVEGNWPTHIYLEWYPS---------KAELTVLDGILSQVEV
A7ELI2_SCLS1          SDDPSLHGGRKRV---IPHIEGNWPTHIYIEWYPS---------TIEFRLLSSLISKVVS
Q0UUC1_PHANO          SDNPELHGGRKRA---MPHVEGNWPSHVYLEWNPS---------QAESDNLHGLIQHVKD
D5GJ68_TUBMM          QDDPSLHGGRKRS---IPHIQGNWPTHIFIEWHLS---------RSEFDVLNGAYHTAST
I1RLU0_GIBZE          VDDPSLHQGRKRH---IPHVVGNWPSHVYTEWHPS---------TEQHGLLTTLIADIEE
C7YJB6_NECH7          VDDPSLHQGRKRQ---VPHVVGNWPSHLYVEWHPS---------TTQHALLTELLADIEK
USB1_NEUCR            SDDPSLHQGRQRQ---VPHIPGNWPSHVYIDWDPS---------SGDRELLSSLVDKLQT
A0A158NKN2_ATTCE      IDDPLDHDGRIRS---FKHERGNWTTLIYINYAPS---------DCLYTWMKSVLNKLPV
E9HMQ4_DAPPU          VDDPSQHGNRIRS---FPHERGNWASFIYLPWEGD---------SNFVNSVELITQCFQN
E0VD50_PEDHC          EKNVKNIDGKVRN---FPHEPGIWATFVYIPVKPC---------YELSDFVKKLINYFEQ
G4VJ07_SCHMA          EDDPSKHDFRSRT---FPHEPGSWATSVYIPCYHL--------HSRILEAIKDPVIQSNP
F4P6D0_BATDJ          IVDKPNAPVPVRT---VAHIEGNWATYIYIPIELQ---------EDLQAELKDWIKQATT
D0MXX8_PHYIT          KRKRSDEQQWKRA---FPHVDGNWPSHVRIDIPVT---------HELRELARHAIERAQE
Q6C5L7_YARLI          ASCETDKNGKVRA---LPHIEGQWPTHVYLEWKPD-------VAWRRLEMLNGAIAKVLE
USB1_DICDI            -EIIDETNKKTRL---FEHVEGNYPTFIYFKVPTK-------SRNDIKELIEQVKEIGNE
C4LTL3_ENTHI          REKKEVDIGRIQQ---RPHKIGEYPGSVYIEIPIE--------------IKNKIMEETNQ
B6JYX6_SCHJY          LDDPVFHQGRKRT---FAHVEGAWTTQSFIEVKLT---------RSLSSQLQQILKSEIA
USB1_SCHPO            FDSPEFHEGRIRG---QKHIEGLWFVQTYLEVDLS---------KKVKKGIREFLNSQSR
B7G7S5_PHATC          RLNESVTGLFTRT---VPHRVGNWAGHVFLDVTSTLR-----NPSDPDDQIGAFAERCRR
H2AZ76_KAZAF          EPNITKFEHEEMS---LQFKIGQWTSFIYLQWKPT---------AKQRILFNEIISDYNQ
USB1_YEAST            YHIPPNLQKYEHQ---DMNMSRFWRSFTYFEWRPT---------PAIHRQLQKIICKYKE
I2GVP3_TETBL          PPSLNYINHKNCD---NMRQRTVWSTFIYLEWRIAK-----SERIRLHSLINQVCKDKNL
Q6FJQ8_CANGA          RTDNGMSLGAIKGSDVFKRNIGKWSCFLYIEYRPS---------STEREMISKTLSQFNQ
C5DY58_ZYGRC          NRAATGFNSFVYLEWRPSKLQRIHLTRVLVNFQAQCS-------GSGIEVLKRLKLEPLH
                                                                                  

G1MFP5_AILME          YVPR---------------------LVQMEAFHLSLSQSVVLRHH-WILPFVQALKDRVA
F6XDF2_CANLF          YVPR---------------------LVQMEAFHLSLSQSVVLRHH-WILPFVQALKDRMA
USB1_BOVIN            YVPR---------------------LVRMEAFHLSLSQSVVLRHH-WILPFVQALKDRVA
F7E331_HORSE          YVPR---------------------LVRMEAFHVSLSQSVVLRHH-WILPFVQALKDRVA
A0A2I2YWK7_GORGO      YVPR---------------------LVRMEAFHLSLSQSVVLRHH-WILPFVQALKARMT
G1QSX4_NOMLE          YVPR---------------------LVRMEAFHLSLSQSVVLRHH-WILPFVQALKARMT
USB1_HUMAN            YVPR---------------------LVRMKVFHLSLSQSVVLRHH-WILPFVQALKARMT
F6TF64_CALJA          YVPR---------------------LVRMEAFHLSLSQSVVLRHH-WILPFVQALKARVA
I3M9Y2_ICTTR          YVPR---------------------LVRMEAFHLSLSQSVVLRHH-WILPFVQALKDRMA
H0VQR9_CAVPO          YVPR---------------------LVRMEAFHLSLSQSVILRHH-WILPFVQALKDRVA
USB1_MOUSE            FVPR---------------------LVLMEEFHVSLSQSVVLRHH-WILPFVQVLKDRMA
USB1_RAT              FAPR---------------------LVQMEEFHLSLSQSVVLRHH-WILPFVQVLKDRMA
G1T0I8_RABIT          CVPR---------------------LVGMEGFHLSLSHSVVLRHH-WILPFVQALKDRLA
F6TSW3_MONDO          VLPR---------------------LVKMEDFHLSLSQSVVLRYH-WISPFVQSLKKHLA
H2ZRU7_LATCH          CAVR---------------------LTTVEEFHVSLSQTVALRYH-WIEPFVQSLKERLA
USB1_XENLA            NGVL---------------------LTKMSEFHISQSQTVVLRHH-WINPFVESLKDKLH
B1WBH1_XENTR          HGVF---------------------LTKMSEFHISQSQTVVLRHH-WINPFIESLKDKLH
G3NG05_GASAC          GGAV---------------------WTPQEELHLSLSQTVVLRHH-WIQPFNRSLRAGLV
I3JYI2_ORENI          RGVV---------------------LTAQDEFHLSLSQTVVLRHH-WIQPFTQSLKSSLT
H2T2E5_TAKRU          HGVA---------------------LSPQEEFHLSVSQTVVLRHH-WIQPFTRSLRAGLT
H2MAR0_ORYLA          HGVA---------------------LTAQEEFHLSLSQTVVLRHH-WIQPFMKSLRGGLT
USB1_DANRE            HDIP---------------------LTVSEEFHLSLSKTVVLRHH-WIQPFVQSIRTSLT
USB1_DROME            PHLE---------------------LQPNESLHLSLSRTVVLQYH-QIDEFSRSLQSALN
Q295J3_DROPS          PDVQ---------------------MQANEPLHLSLSRTVVLQYH-QIDEFSRSLQVALN
W5JWR4_ANODA          AGIK--------------------DFQPVGHLHLSLTKTFTIRHH-NIVPFVGSLQELLG
Q7QK92_ANOGA          ASTTV-------------------EFNPIDRMHLSLTKTFTIRHH-NINPFVANLREQLA
Q16WV0_AEDAE          KDLDL-------------------ELNRVDDLHLSLTKTFVLRHH-NIAAFVENVRSAIS
F6WVC9_CIOIN          FQGLD-------------------HWKIVDDFHLSVSRTSAIPHH-FIEPLVEGIQGCAQ
H2Y8C0_CIOSA          FSGID-------------------GWNVVDSFHMSISRTSAIPHH-YIEPLVDAIKDSVR
B9ICF1_POPTR          VDADVPLDI------LCKDDHKLEQVALGRDFHISLGRTVPIRVH-QIDSVVAMLRQKLQ
A5BG02_VITVI          VDVDIPLNI------LCKDDNKLEQVALGREFHISLGRTVPIRVH-QIDSIVTMLRQKLQ
I1J6I2_SOYBN          VDVDVPLNI------LCQNDEKLEQVTLGREFHISLGRTVPIRVH-QIDSVVSMLRQKLQ
Q9LU57_ARATH          VEADVPLSI------LCKDDQKFER-ALGREFHISLGRNVPLRVH-QINSVISMLRQKLQ
I1IC44_BRADI          VDADYALAE------LCKDEQKLEKVLLAREFHVSLGRTVAIQVH-QIDSIVAMLRQKFQ
I1IC41_BRADI          VDADYALAE------LCKDEQKLEKVLLAREFHVSLGRTVAIQVH-QIDSIVAMLRQKFQ
I1P2N1_ORYGL          IDADYALSE------LCKDEQKLEKVLLSREFHVSLGRTVAIQVH-QIESLVAMLRQKFR
A9T750_PHYPA          TEDD----D------LSANVGSNQGIKLATEFHISLGRTVPIRIH-QIDTMVHLLRRKFE
D6RP66_COPC7          LVAFDTG---------------------YSDLHVSLSRPVFLRAH-QREEFKRSVRNIAK
F8Q1E3_SERL3          IGIQDLREN------VSTH-HTPGTVLHHREFHISLSRPIFLRAH-QRDELKRAIKTIAM
C0NG58_AJECG          KL------------PSTIHGLLHTDLGAQVQLHISLSRPVMLLTE-DRQPFRDLLTDALR
Q4WCA6_ASPFU          KLGGD---------AGEIHSLLRSDLGVQLPLHISLSRPVVLRTE-QRQPFMDMFQTALQ
A7ELI2_SCLS1          LK------------RFEIQTFLTSDLGVPLPLHVSLSRAIGFSKD-VKDSFLNSFEQAIK
Q0UUC1_PHANO          AIDAQNKERPKKTPVPKIIPSLQSELGAPLPLHVSLSRTLQIKTE-DRDVFLDALRSRLR
D5GJ68_TUBMM          ITATA---------GVRLESHLKSDLGSEQPLHLSLSRPNILTTA-QREGFLELLKDRLD
I1RLU0_GIBZE          HVSSNTKLF----------NFLTSDLGSPLPLHISLSRPLSLTTS-AKDEFLDKITESFN
C7YJB6_NECH7          QASGEIELL----------NFLTSDLGSPLPLHISLSRPLSLSTG-NKDEFLDRITQTFT
USB1_NEUCR            RVAAAAQRYPDLEGVKISTALRDPELPVDKPLHISLSAPLTLTSK-NKDAFLDDVTRALR
A0A158NKN2_ATTCE      EGNI------------------------ISNLHISLSRTLVLKFH-WIESFVEGIKLACH
E9HMQ4_DAPPU          YGIE---------------------LQICDDFHISLTKTFILRHH-WIEGFVNSVKKQLN
E0VD50_PEDHC          FNLK-----------------------LVDDYHISLSRTVILKHH-WIQGFMELLKNFLK
G4VJ07_SCHMA          VMAD---------------------CYTVDSPHISLSKTWPIYFH-WIENLVGNLRSAVK
F4P6D0_BATDJ          QFPSWHSHIQLD-------------SNDSLGLHVSLCQTAYLKVF-QIDRFMALLEQQIG
D0MXX8_PHYIT          IVGDAVAML-------AFEELGLTSTGATDYLHLSLSRPFVLTYD-QINGFVDSLRAALK
Q6C5L7_YARLI          TYQVVYHSL------------AKSDVGVRLPLHVSLSDTLMPTTE-SKQQVTDSICEAVT
USB1_DICDI            INIK---------------------QDTETCFHISISRTFPIREH-HIETFTQELKKTLK
C4LTL3_ENTHI          FSQD---------------------FKPIQSLHISLTKEFSLREH-QIPLFVQEVRKKIK
B6JYX6_SCHJY          IEERDDGTPK----SNDWVPLFFSELGLAKPLHLTLSSMDCLDYE-SKESFRVQWKQTLS
USB1_SCHPO            FQSLL-----------------CSEHNVPRRLHLSISENYRINYS-TKNQLVHKWEQYTN
B7G7S5_PHATC          VLQEFGQSG------------VLVAPHPTASFHVSLARPFYVHIA-CIDSFVRQLRIRLE
H2AZ76_KAZAF          LFNDKFKTKILD--RFEFKPTYRSDLGSPHPLHVSLSRNLTFNKQERRDEFITTLAGQIK
USB1_YEAST            TFMKQEYTNPYQ--LVDFDPLFISHLGAPKPLHVSLTRSLLFETEEQRHVFIQEMRNGLR
I2GVP3_TETBL          PYSFTP--------------AFFSDLGAPLPLHVSLTRNIEFHSIEQRDLLKASLEKHMH
Q6FJQ8_CANGA          SWQKKFPGT------DIFEPLHYTTLGVPVPLHISLTKNIPFDSETQRDRFYNILVPKVA
C5DY58_ZYGRC          VSALG----------------------SPEPLHVSLTRSLEFSDAMQRDRFQQSLSTRLA
                                                      *::               .         

G1MFP5_AILME          -----------SFQRFFFTAN-RVKIYTNQ-EKTRTFVGL--EV-------------TSG
F6XDF2_CANLF          -----------SFQRFFFTAN-RVKIYTNQ-EKTRTFIGL--EV-------------TSG
USB1_BOVIN            -----------SFHRFCFTTD-QVKIYTNQ-EKTRTFVGL--EV-------------TSG
F7E331_HORSE          -----------SFQRFCFTAN-QVKIYTNQ-EKTRTFVGL--EV-------------TSG
A0A2I2YWK7_GORGO      -----------SFQRFFFTAN-QVKIYTNQ-EKTRTFIGL--EV-------------TSG
G1QSX4_NOMLE          -----------SFQRFFFTAN-QVKIYTNQ-EKTRTFIGL--EV-------------TSG
USB1_HUMAN            -----------SFHRFFFTAN-QVKIYTNQ-EKTRTFIGL--EV-------------TSG
F6TF64_CALJA          -----------SFQRFFFTAN-QVKIYTNQ-EKTRTFIGL--EV-------------TSG
I3M9Y2_ICTTR          -----------SFQRFFFTAN-RVKIYTNQ-EKTRTFVGL--EV-------------TSG
H0VQR9_CAVPO          -----------SFERFLFTTD-RVKIYTNQ-EKTRTFVGL--EV-------------TSG
USB1_MOUSE            -----------SFQRFFFTAN-RVKIYTNQ-EKTRTFIGL--EV-------------SSG
USB1_RAT              -----------SFQRFFFTAN-RVKIYTNQ-EKTRTFIGL--EV-------------SSG
G1T0I8_RABIT          -----------AFQRFFFTAN-RVKIYTNQ-EKTRTFVGL--EV-------------TSG
F6TSW3_MONDO          -----------SFHRFLFTAN-QVKVYTNQ-EKTRTFIGL--EV-------------TAG
H2ZRU7_LATCH          -----------PFPRFYCTVE-RVKVYTNQ-EKTRTFLGL--EV-------------STG
USB1_XENLA            -----------CMYRFLCIAE-RIKVYTNQ-EKTRTFLGL--EV-------------SVG
B1WBH1_XENTR          -----------CMYRFLCIAD-RIKVYTNQ-EKTRTFLGL--EV-------------SVG
G3NG05_GASAC          -----------HCKRFVCLAG-RLRIYCND-ERTRTFLGM--EV-------------CTG
I3JYI2_ORENI          -----------GCKRFVCSAG-RLRVYSNA-EKTRTFLGM--EV-------------STG
H2T2E5_TAKRU          -----------LRKRFCCSAE-RLKVYCNA-DRTRTFLGM--EV-------------CTG
H2MAR0_ORYLA          -----------HSKRFVCSAG-RLRVYCNA-ERTRKFVKLF-GI-------------KTF
USB1_DANRE            -----------HFQKFYCVAY-KLKVYSNA-EKTRTFLGM--EV-------------STG
USB1_DROME            -----------SSAGFAATLQ-GLRIYTNE-ERTRTFIAAP-LD-------------AAF
Q295J3_DROPS          -----------SSTGFASTLQ-GLKIYTNE-ERTRTFLAVQ-LD-------------GAF
W5JWR4_ANODA          -----------VHRRFRLELD-GVGVYVNE-ERTRTFIGVR-IA-------------EVS
Q7QK92_ANOGA          -----------GLRRFRLEFS-GVQVYVNE-ERTRTFLGVR-VA-------------EES
Q16WV0_AEDAE          -----------GTKRFRISLS-DLAVYTNE-ENTRTFLAVK-VA-------------DQS
F6WVC9_CIOIN          -----------KLSPVILNFSCDLKFYVND-EKTRSFCGFEVTS-------------PFI
H2Y8C0_CIOSA          -----------TFNTLDLMFSSKLKFYVND-EKTRSFCGFQISC-------------PLL
B9ICF1_POPTR          -----------FQK-GYWIDFNKWEVFVND-DKTRTFLSL-EVV-------------TGG
A5BG02_VITVI          -----------FQR-RYWIDFNKWEVFVND-DQTRSFLSV-EVI-------------AGG
I1J6I2_SOYBN          -----------IQH-QYWIDFNKWEVFVND-DHTRSFLSA-EVV-------------QGG
Q9LU57_ARATH          -----------LQK-RYLIDFNKWEVFVND-DHTRSFLSL-EIT-------------TSG
I1IC44_BRADI          -----------SQQ-RYWMDFTKWEHFVND-DSTRSFLSL-EVT-------------RTG
I1IC41_BRADI          -----------SQQSRYWMDFTKWEHFVND-DSTRSFLSL-EVT-------------RTG
I1P2N1_ORYGL          -----------SQQ-RYWMDFNKWEHFVND-DCTRSFLSL-EVT-------------STG
A9T750_PHYPA          -----------GQK-RFLVEFGTWEVFVND-DRTRSFLSL-EVV-------------ATG
D6RP66_COPC7          -----------EQS-PFAISFAAFSELTND-EKTRTFLVL-EV--------------GAG
F8Q1E3_SERL3          -----------NHS-PFEASFAMFTELTND-ERTRTFLTA-EV--------------GAG
C0NG58_AJECG          E---------SDIRPFHVK-PVGLDWVSNF-EETRWFLVLRVTK--------------PT
Q4WCA6_ASPFU          E---------SVVPAFSVS-PCSLDWVSNY-ERTRWFLVLRVTK--------------PT
A7ELI2_SCLS1          S---------SGIRPFEIG-FSGLAWVPNY-EKTRWFLVLRLNI--------------PK
Q0UUC1_PHANO          R---------ASVAPFQFQ-FRGLKWVPNF-QRNRWFLVLSIEK--------------PA
D5GJ68_TUBMM          K---------TRIKPFSVE-FTGFEFVSNN-DRTRWFFVLRATK--------------GD
I1RLU0_GIBZE          S---------SGIAPFAVK-PQSLAWFRSP-DSDRTFLILRVAS-----GPD----TKPL
C7YJB6_NECH7          S---------SGIAPFIVR-PRGLAWYRSP-DSDRTFLILRVASNVSKAGSDSEEAVRTP
USB1_NEUCR            S---------SGVSPFVVDFSGGVNWYRSE-ESTRSFLVLRVREVQNTGMTTAD---SSP
A0A158NKN2_ATTCE      -----------SFNKFIIQLT-DVRVYCNE-ERTRTFLGIYCQD---------------E
E9HMQ4_DAPPU          ----------GISRPFQLLGTNVLSVYTNE-ERNRTFLAINIED---------------P
E0VD50_PEDHC          -----------DIPSFKIHVK-GLKVYTNE-EKTRTFLSLMVDE---------------N
G4VJ07_SCHMA          -----------SFGKFWIALD-GVEVLVNE-ENTRSFFTLVASE--------------ES
F4P6D0_BATDJ          ------------LQSRFTVSFNGVSSYVND-EQTRSFVGMDIGH---------------G
D0MXX8_PHYIT          ------------WQQRFSVTLRRALVLAND-EKTRSFLALRVGE---------------G
Q6C5L7_YARLI          G---------WKGPIKINVSKTKLQVVLNR-QKTRAFVVLALTD----------------
USB1_DICDI            -----------NQRSIDIQLSKECCVFIND-NQSRIFLSIPINQ--------------SF
C4LTL3_ENTHI          ------------RLPTFTITFGQLELLLNP-EQNTEFLSIQVTS----------------
B6JYX6_SCHJY          S---------AHFQPFSIQLG-KVLYLVNE-QQTRGFLAWRIHF---------------D
USB1_SCHPO            N---------LNYRTLKFRLG-KMCLLFND-EKTRMFLAFECKFS---------------
B7G7S5_PHATC          SRIADAFRGENNHTALIPIVSSKPVVLVNE-EKTRSFFAWSVVS----------------
H2AZ76_KAZAF          A---------AQINPFQLQLQSRPQLFQSQFDATTLFLVLPLDP-------------HTI
USB1_YEAST            N---------NEITPFKLQICSYPKLYISE-RANTLYLGLPVSE-------------CPN
I2GVP3_TETBL          -----------SIEPFTLEFLPLFELYRAH-YRSGLFIGFPVSF-------------DCK
Q6FJQ8_CANGA          -----------QLRQHLVQFEDTLRFYGSP-QTTSVFLGYNVAQ-------------SVK
C5DY58_ZYGRC          A---------SQLSPIDIAFEPRFQVLDSR-FKDRVFLTLPVLS-------------SQR
                                                          :                       

G1MFP5_AILME          HAQFLDLVSEVDRVMEEFDLTTFYQ-----------------------------------
F6XDF2_CANLF          HNQFLDLVSEVDRVMEEFDLTTFYQ-----------------------------------
USB1_BOVIN            HAHFLDLVAEVDRVMEEFDLSTFYQ-----------------------------------
F7E331_HORSE          HAQFLDLVSEVDRVMEEFDLPTFYQ-----------------------------------
A0A2I2YWK7_GORGO      HAQFLDLVSEVDRVMEEFNLTTFYQ-----------------------------------
G1QSX4_NOMLE          HAQFLDLVSEVDRVMEEFDLTTFYQ-----------------------------------
USB1_HUMAN            HAQFLDLVSEVDRVMEEFNLTTFYQ-----------------------------------
F6TF64_CALJA          HAQFLDLVSEVDRVMEEFDLTTFYQ-----------------------------------
I3M9Y2_ICTTR          HAECLDLVSEVDRVMEEFDLTTFYP-----------------------------------
H0VQR9_CAVPO          HAQFLDLVSEVDRVMEEFDLTTFYQ-----------------------------------
USB1_MOUSE            HAQFLDLVSEVDRAMKEFDLTTFYQ-----------------------------------
USB1_RAT              HAQFLDMVSEVDRVMKEFDLTTFYQ-----------------------------------
G1T0I8_RABIT          HAQLLDLVSEVDRVMEEFDLTTFYQ-----------------------------------
F6TSW3_MONDO          HAQFLDLVSEVDKVMEEFDLSTFYK-----------------------------------
H2ZRU7_LATCH          HDQLLELVSEVDKTMEEFDLKTFYK-----------------------------------
USB1_XENLA            MEHLLEVVSEVDRSLQEFNLQTFYQ-----------------------------------
B1WBH1_XENTR          SEHLLEVVSEVDQSLKEFNLQTFYE-----------------------------------
G3NG05_GASAC          HAPLLDLVQAVDRTMKEFRLETFYK-----------------------------------
I3JYI2_ORENI          HAQLLDLIRTVDRTMTEFRLETFYK-----------------------------------
H2T2E5_TAKRU          HAQLLDLVQIVDRTMSEFLLETFYK-----------------------------------
H2MAR0_ORYLA          CSRLLYLLWSFDAHC----LNVVYE-----------------------------------
USB1_DANRE            TPHLLELSKIVDETMKEFNLSTFYE-----------------------------------
USB1_DROME            VEKMTAILQPIDQVMLDYRLQQFYD-----------------------------------
Q295J3_DROPS          TEKVLSILQPIDKVMHDYRLPKFYA-----------------------------------
W5JWR4_ANODA          YPPLDRLVTELDECLLEYKLPRYYE-----------------------------------
Q7QK92_ANOGA          YGALNALVTSLDECLREYKLPLYYT-----------------------------------
Q16WV0_AEDAE          CGPLSFLVEKLDTSMREYKLPTFYK-----------------------------------
F6WVC9_CIOIN          LAKLQTLVDHINKPLKDYKCDSYYE-----------------------------------
H2Y8C0_CIOSA          ITKLQYYVDRINQPLKDYGCDGYYS-----------------------------------
B9ICF1_POPTR          LAEITKQIQSVNDVYKLHNLPEFYK-----------------------------------
A5BG02_VITVI          LAEITRQIQAVNEVYRLHNLPEFYE-----------------------------------
I1J6I2_SOYBN          LVEITKQIEVVNAIYRLHNLPEFYK-----------------------------------
Q9LU57_ARATH          LSEISKQIDAVNEVYKLHNLPEFYK-----------------------------------
I1IC44_BRADI          LSEITKQVHMVDEVYRLHGLPEFYK-----------------------------------
I1IC41_BRADI          LSEITKQVHMVDEVYRLHGLPEFYK-----------------------------------
I1P2N1_ORYGL          LPEISKQITMVDDVYRLHGLPEFYK-----------------------------------
A9T750_PHYPA          YAEIKKQVSLVDHVYTLHGLPTFYP-----------------------------------
D6RP66_COPC7          HHNLRTLASSLTSVMKSFRQKEYYE-----------------------------------
F8Q1E3_SERL3          HQELRSMSQALTPVLKAIRQKEFYV-----------------------------------
C0NG58_AJECG          NNELNRLLAISNKSLAAFQQPPLY--HDEALVNTQTKK-----HDTEKSTGPRSTSSLAV
Q4WCA6_ASPFU          NDNLNRLLSLSNRSLAHFGQPSLYAGNPASPVHRLGRH-----ENIKPHTQP--------
A7ELI2_SCLS1          SNALNKLLHVSNKVVEEFGQPPLYADSRASEYGTKIAHPSRDVKNFKAKTQQKE-NFVDM
Q0UUC1_PHANO          NNELNRLLDACNKATRHCGHPGLYVGGHGDGPMESSNE------NTGNKRRKGQDTEEES
D5GJ68_TUBMM          DAQLPRLLQLANHTFEAFEQPPLYTENGDK------------------------------
I1RLU0_GIBZE          NPELTSLLLRSNSVAAQFGLPSLYARSPDE------------------------------
C7YJB6_NECH7          NPELTALLAKSNTVATQFGQPTLYQRNTNDVDTR--------------------------
USB1_NEUCR            NPRLTTLLQRCNKTAKEYGQPPLYDS----------------------------------
A0A158NKN2_ATTCE      DKMLKCLTEIFDNLLAEYQLPSFYK-----------------------------------
E9HMQ4_DAPPU          SGMLNVLTQKMDSCMIEYQLPTFYK-----------------------------------
E0VD50_PEDHC          VEMLKTIVNQVDLCLKEYNLGKFYE-----------------------------------
G4VJ07_SCHMA          RIVLISLLNSVDPCVTAFRGPKYYE-----------------------------------
F4P6D0_BATDJ          HEELLELVQCVDLALTAFHQPPFYK-----------------------------------
D0MXX8_PHYIT          EQQFTQVLRCVDQCLSRVEQPTYYK-----------------------------------
Q6C5L7_YARLI          NEPIVRLIAAVNAAVEPHGLPALAA-----------------------------------
USB1_DICDI            KSNILKLIERIDSCLSLFKFPKYYD-----------------------------------
C4LTL3_ENTHI          -PEILSLIDLLDTVMMSFNLEKYYE-----------------------------------
B6JYX6_SCHJY          EHHLKPLCQKINDLNISFGMQPLRP-----------------------------------
USB1_SCHPO            DENYKDLISHASDCMKEFTNRNLRE-----------------------------------
B7G7S5_PHATC          NHILRELVKVVDEVMDLYRLSHYYD-----------------------------------
H2AZ76_KAZAF          KKQITNLHEVIKRTMIQYALPRNFLE----------------------------------
USB1_YEAST            KAQISPFKTIIAEALQKSGISNYQDLIVS-------------------------------
I2GVP3_TETBL          VKQIEPLINQIGHAMKDVNILDYSKYLIN-------------------------------
Q6FJQ8_CANGA          DNIIKDITDNIESALIDSGLSESDK----------------------------------M
C5DY58_ZYGRC          SHWFKFVYQVIWQSLREVWPNLNDKE------------------------------IDEM
                                                                                  

G1MFP5_AILME          ---DPSFHVSLAWCVGDARLQLEGRCLRELQN--IVDEFEDP------------------
F6XDF2_CANLF          ---APSFHISLAWCVDDAHLQLEGQCLQELQN--IVDEFEDS------------------
USB1_BOVIN            ---DPSFHISLAWCVGDARLQMEGPCLQELQG--IVDEFEDS------------------
F7E331_HORSE          ---DPSFHISLAWCVGDARLQLEGQCLRELQA--IVDEFEDS------------------
A0A2I2YWK7_GORGO      ---DPSFHLSLAWCVGDARLQLEGQCLQELQA--IVDGSEDA------------------
G1QSX4_NOMLE          ---DPSFHLSLAWCVGDARLQLEGQCLQELQA--IVDGFEDA------------------
USB1_HUMAN            ---DPSFHLSLAWCVGDARLQLEGQCLQELQA--IVDGFEDA------------------
F6TF64_CALJA          ---DPSFHLSLAWCVGDARLQLEGQCLQELQA--IVDGFEDA------------------
I3M9Y2_ICTTR          ---DPSFHISLAWCVGDARPQLEGQCLQELQE--ILDEFEDS------------------
H0VQR9_CAVPO          ---DPSFHISLAWCVGDACLQLEGRCLQELQE--IVDEFEDS------------------
USB1_MOUSE            ---DPSFHISLAWCVGDASLQLEGQCLQELQE--IVDEFEDS------------------
USB1_RAT              ---DPSFHVSLAWCVGDARLQLEGQCQQELQE--IVDEFEDS------------------
G1T0I8_RABIT          ---DPSFHISLAWCVGDARVQLEGQCLRELQE--IVDEFEDA------------------
F6TSW3_MONDO          ---EPSFHISLAWCVGDGRSKLQAQAIQELQE--IVDGFEDS------------------
H2ZRU7_LATCH          ---NPSFHMSLAWCVGDSTQKLSGKCLQDLQEGKVSNELYHP------------------
USB1_XENLA            ---EPSFHVSLAWCVGDKYEKLKGSCLLELQK--VIDRFEDS------------------
B1WBH1_XENTR          ---EPSFHMSLAWCVGDKAGKLEGSCLVELQK--VIDRFEDS------------------
G3NG05_GASAC          ---EPSFHVSLAWCVGDLTGQMGE-CLQGMQR--VVDDHEEG------------------
I3JYI2_ORENI          ---DPSFHVSLAWCVGDQTVQMEE-CMQELQS--LVDDHEDG------------------
H2T2E5_TAKRU          ---DPSFHVSLAWCVGDMTEPMRE-CLKELQS--VFDGCEEG------------------
H2MAR0_ORYLA          ---DPSFHVSLAWCVGDLTEELKE-ITQELQS--LVDGREDG------------------
USB1_DANRE            ---DPSFHISLAWCVGDQTERLKKACLLELQG--LIDAHEDG------------------
USB1_DROME            ---PASFHVSLLWCVGD-QETLLNEKLTELKE--LLDDQDK-------------------
Q295J3_DROPS          ---PPSFHVSLLWCVGD-HEDLLNKKLKELRV--LLEDQDT-------------------
W5JWR4_ANODA          ---DRSFHISLLWTLGDQSEIVTSRLPKLTEQFEEIYEDEYT------------------
Q7QK92_ANOGA          ---DRAFHVSILWCLGDREAEVRKELPALAAVFERVYEEEYC------------------
Q16WV0_AEDAE          ---DPSFHVSLLWCLGNRRQLLDDNMPTLQETFSALYEEEYC------------------
F6WVC9_CIOIN          ---NPSFHISISWTLGNIFEQNWKKQLEIFQT-HWSEVFIES------------------
H2Y8C0_CIOSA          ---NPSFHISIAWTLGNIFDQNWKMLLHKFQI-HWLEVFTNC------------------
B9ICF1_POPTR          ---DPRPHISLAWALGDVSDVLKREVVNEMKRSSAGGSI---------------------
A5BG02_VITVI          ---DPRPHISLVWALGNISDSLKRAVEEMRRHINVGGSV---------------------
I1J6I2_SOYBN          ---DPRPHISLAWALGDIAHSLKKIVDEEMK-CAVGKSL---------------------
Q9LU57_ARATH          ---DPRPHISLVWALGDIRTSLKGAVDVELRKLRAGGCV---------------------
I1IC44_BRADI          ---NPRPHISLVWALGDISSKLKQATKEIENFQNSVNSY---------------------
I1IC41_BRADI          ---NPRPHISLVWALGDISSKLKQATKEIENFQNSVNSY---------------------
I1P2N1_ORYGL          ---NPQPHISLAWALGDVSCKLKQAIKEIEKSQSSLGTS---------------------
A9T750_PHYPA          ---NPRPHISLAWALGDVKDALATVAQELNTMACFREEK---------------------
D6RP66_COPC7          ---SPRFHASIGWALLDIPSPLDHERKSAARTASPLDFPTIPRFPNTLL--PFLEEKYHK
F8Q1E3_SERL3          ---EPRFHASIAWALLASPSAPVFNDTSLEGVASSSKTTPLTSAENNLLREPQLDPQ-PE
C0NG58_AJECG          ADYSDYFHVSIAWSLAEPS-----------LEDKE---RVAS------------------
Q4WCA6_ASPFU          EELSHCFHVSLAWSLIEPT-----------TEQKE---RIDA------------------
A7ELI2_SCLS1          VDLSKAFHISIAWTLLPPGQ--------ELIEATE---RLTA------------------
Q0UUC1_PHANO          VDRSDRFHVSIAWNLEEPDP--------EWTALIK---NIDV------------------
D5GJ68_TUBMM          ---LDGFHVSLAWSLTEPDKDVKAEVFEALKTHAC---WDKI------------------
I1RLU0_GIBZE          -PVGGAFHVSIGWTFHLPGDELSLKTLQLFKQPK--------------------------
C7YJB6_NECH7          DAVGTAFHISIGWTFHLPGDELSLETLGLFKQSK--------------------------
USB1_NEUCR            QDMGYRFHVTIAWTHARPSESLKQLTDSIFDDCKTMYSENMS------------------
A0A158NKN2_ATTCE      ---DTSYHISFFWCLGDKQACLKEILSPLTSSLNKFLAENM-------------------
E9HMQ4_DAPPU          ---EACHHVSIAWCVCDKKEELEKIAAGLKLE----------------------------
E0VD50_PEDHC          ---DPLFHLSLLWCPDNKYEEINSILMNLPTKLKEFNFFEFV------------------
G4VJ07_SCHMA          ---NPKFHMSFLWCNGNVRKKYSTETLNNFSMDLQKAIFVES------------------
F4P6D0_BATDJ          ---NPRFHASIVWSPTTRASSFDNPIESIPDSLRDIPKKLHN------------------
D0MXX8_PHYIT          ---DPIPHVSIASSLGEELAQLTSDQFHV-------------------------------
Q6C5L7_YARLI          -----HPHVSIGWFLPRADPDPVSDAIVTSPETDRHLTALFG------------------
USB1_DICDI            ---NPEPHLSISWSLITNNNNETNDENINYIPLNKFKNKEII------------------
C4LTL3_ENTHI          ---ERKIHSSLMYRTEHLKEPYELSSFNKCLL----------------------------
B6JYX6_SCHJY          ---DFIPHISFCWRKTNPKECEAWSSAISLYEVPSKFDNLVSAIEDLLK-----------
USB1_SCHPO            ---DFLLHISFASSLTNEDEYQNWVSQDRESHFFKTMNEIINTKIQ--------------
B7G7S5_PHATC          ---PPTFHVSVASFPGDLSTIRERLEDTLRLDSGCDKTRPGI------------------
H2AZ76_KAZAF          ---ASRSHVTIAQLDNVPRRVMSKIDQISPSKS---------------------------
USB1_YEAST            ---RQNLHVSIAIASNPSKATLKRYQQLNETMGALLLLNNDF------------------
I2GVP3_TETBL          ---PSTAHVSLGQALNLSQSKLEEYMTAFTSSNKAFIVDPRK------------------
Q6FJQ8_CANGA          VTVPSFSHMSIAKLSNAPKDILDKVGYADSNQMAKQIQDYVEIS----------------
C5DY58_ZYGRC          LCPAESVHMSIAQTHGTRAKELAVWIQPLEPL----------------------------
                             * :.                                                 

G1MFP5_AILME          ----EMVLRAHAEQVRC--KSGNKFFSMPLK-----------------------------
F6XDF2_CANLF          ----EMVLRAHAEQVRC--KSGNKFFSMPLM-----------------------------
USB1_BOVIN            ----EMLLRAYAEQIRC--KSGNKFFSMPLK-----------------------------
F7E331_HORSE          ----EILLRVRAGQVRC--KSGNKFFSMPLK-----------------------------
A0A2I2YWK7_GORGO      ----EVLLRVHTEQVRC--KSGNKFFSMPLK-----------------------------
G1QSX4_NOMLE          ----EVLLRVHTEQ----------------------------------------------
USB1_HUMAN            ----EVLLRVHTEQVRC--KSGNKFFSMPLK-----------------------------
F6TF64_CALJA          ----EVLLRMHTEQVRC--KSGNKFFSMPLK-----------------------------
I3M9Y2_ICTTR          ----EMLLRVLTEQVRC--KSGNKFFSMPLK-----------------------------
H0VQR9_CAVPO          ----EMLLRVQAKQVRC--KSGNKFFSMPLK-----------------------------
USB1_MOUSE            ----EMLLRVLANQVRC--KSGNKFFSMPLK-----------------------------
USB1_RAT              ----EMLLRVLAEQVRC--KSGNKFFSMPLK-----------------------------
G1T0I8_RABIT          ----EVPLRVLTEQVRC--KSGNKFFSMPLK-----------------------------
F6TSW3_MONDO          ----ARLLCVGAEQVRC--KSGNKYFSFPLK-----------------------------
H2ZRU7_LATCH          ----LLLLRVHLTPTLTLQRTRNFYFSILKK-----------------------------
USB1_XENLA            ----DTLTRFNAEEIRC--KAGNKTFCIPLL-----------------------------
B1WBH1_XENTR          ----DILTRFNAEEIRC--KAGNKTFCIPLL-----------------------------
G3NG05_GASAC          ----PFLLRLDCVELRC--RTGNKTFRFPLEP----------------------------
I3JYI2_ORENI          ----PFVLRLDCSELRC--RTGNKTFRFPLE-----------------------------
H2T2E5_TAKRU          ----PFLLRLDCRELRC--RTGNRIFHFPLQ-----------------------------
H2MAR0_ORYLA          ----PFLLNLDCAELRC--RTGNKTFRFPLE-----------------------------
USB1_DANRE            ----PFHARLNCNELRC--KTGNKVFVFPLQ-----------------------------
USB1_DROME            -------LCLAVNEVHL--KCGNKDFTYSLK-----------------------------
Q295J3_DROPS          -------LPLAVNEIHC--KCGKKDFTYKLK-----------------------------
W5JWR4_ANODA          ----DLTQTIRKLWFKC----GNKLYPFQLA-----------------------------
Q7QK92_ANOGA          ----DISQQVKTLWFKC----GNKSFHFNLI-----------------------------
Q16WV0_AEDAE          ----DMNINVKMLNFKC----GNKYYSFDLL-----------------------------
F6WVC9_CIOIN          ----PELFSFEANNLVC--KCGNRLFTFEISYKS--------------------------
H2Y8C0_CIOSA          ----PELFSFKANCLAC--KCGNRLFKFEFLKMDSKTVY---------------------
B9ICF1_POPTR          ---LKRVFSCKFSGIEC--RIGKKTYKISKFLDEK-------------------------
A5BG02_VITVI          ---QKRIFTCKFNGIEC--KIGNKTYKICKFSED--------------------------
I1J6I2_SOYBN          ---KKCIFSCKFKSIEC--KIGKKAYTICKISDGQ-------------------------
Q9LU57_ARATH          ---QNRIFTSKFCGIEC--KIGNKTHKICKLPDE--------------------------
I1IC44_BRADI          ---KNCNLRCKFSRVVC--KVGNKVYDICQAVD---------------------------
I1IC41_BRADI          ---KNCNLRCKFSRVVC--KVGNKVYDICQAVD---------------------------
I1P2N1_ORYGL          ---QKSNLRYKFSHVVC--KIGKKVYDICKLAD---------------------------
A9T750_PHYPA          ---SACFFTSLATKVEC--RIGQKLHPIWTTKDKKSMLELSETVN---------------
D6RP66_COPC7          ALTSGKVAVFHVDQVTV--KIGKEISWCSERYGSRYG--------------KSGHLLSSA
F8Q1E3_SERL3          ELEDKILPNVQFPRIPH--FPADMISSLNSVYGARLSSVNVGSFDIDEICVRIGKNVFRW
C0NG58_AJECG          -VELHKVKEIEILFSSVKLKIGNIIHNLELPTLVLDEGGFCGL-----------------
Q4WCA6_ASPFU          -VDIRRLRILSIHFDCVKVKIGNNISSIPLSTVQS----FSVI-----------------
A7ELI2_SCLS1          -NELIRVQEIQIQTKEIKAKIGNVTYAMSLAFATTRRSSKASEDEPTVCVSTTLKISSPR
Q0UUC1_PHANO          -SE--RIKQPQASIDVVKVRIGNVVHNIDLKAGRLGGTMGLNQNSN--------------
D5GJ68_TUBMM          -FGKSEVERLKLLIDAIKVKIGNIVHIVELGKKEKQGEAGNPKKRRASYDVHEKRNT---
I1RLU0_GIBZE          ---FDDIRKWEISVLGVKVKIGNVVNHIALK-AGRSGAPKSTSFLKS-------------
C7YJB6_NECH7          ---FAGIRGWEINVTGIKAKIGNVVNHIALKESGRGTAPPLGSVPFI-------------
USB1_NEUCR            -IRDKLCTGSSFRVETVKVKIGNHVTRFELPDKGLALPVKTT------------------
A0A158NKN2_ATTCE      -------EDAYVHVNDIQCKIGNKCYIFKLK-----------------------------
E9HMQ4_DAPPU          ------IEQTACNMAEVRCKIGNLVKRL--------------------------------
E0VD50_PEDHC          -------SYCCCHVLFVAIHLLRVYCRLSISN----------------------------
G4VJ07_SCHMA          -------KKIFHEVTDIVCKSGSKHFDINIL-----------------------------
F4P6D0_BATDJ          -------TLFLVRSVVC--KSGNKLKQFDL------------------------------
D0MXX8_PHYIT          -------------------AIGNKHYDIPLR-----------------------------
Q6C5L7_YARLI          ----------KVTFDCVKIKCGRLVQSVRCI-----------------------------
USB1_DICDI            --RDNLKLTDSFKVSRIFWNIGKTESFIDLQ-----------------------------
C4LTL3_ENTHI          ----------SFKPATIKIRLGEIVYTCVLGGYSM-------------------------
B6JYX6_SCHJY          ------SNNTNIPVKSVKLSTGGYLDTLELKEPY--------------------------
USB1_SCHPO            ----KDQFSESFIVDSLKLSIGHLIFTFPFCK----------------------------
B7G7S5_PHATC          -------LYHRVASVHCT-FGTTKAFQIPLD-----------------------------
H2AZ76_KAZAF          ----YAEVSSMITPSITHLHLDKNRESFQLPF----------------------------
USB1_YEAST            ------AYKLEFLVNSIYCDENRHSIRIPFN-----------------------------
I2GVP3_TETBL          ------DTYLSIPIKTVCMDQGRQKISFYMTPKSSSSKSPS-------------------
Q6FJQ8_CANGA          -----PNQQPVFYVSSIKMNKNRELLTIPFATP---------------------------
C5DY58_ZYGRC          ------QPLPTWNVTHLKLDKNRECIKIPLVT----------------------------
                                                                                  

G1MFP5_AILME          --------------------
F6XDF2_CANLF          --------------------
USB1_BOVIN            --------------------
F7E331_HORSE          --------------------
A0A2I2YWK7_GORGO      --------------------
G1QSX4_NOMLE          --------------------
USB1_HUMAN            --------------------
F6TF64_CALJA          --------------------
I3M9Y2_ICTTR          --------------------
H0VQR9_CAVPO          --------------------
USB1_MOUSE            --------------------
USB1_RAT              --------------------
G1T0I8_RABIT          --------------------
F6TSW3_MONDO          --------------------
H2ZRU7_LATCH          --------------------
USB1_XENLA            --------------------
B1WBH1_XENTR          --------------------
G3NG05_GASAC          --------------------
I3JYI2_ORENI          --------------------
H2T2E5_TAKRU          --------------------
H2MAR0_ORYLA          --------------------
USB1_DANRE            --------------------
USB1_DROME            --------------------
Q295J3_DROPS          --------------------
W5JWR4_ANODA          --------------------
Q7QK92_ANOGA          --------------------
Q16WV0_AEDAE          --------------------
F6WVC9_CIOIN          --------------------
H2Y8C0_CIOSA          --------------------
B9ICF1_POPTR          --------------------
A5BG02_VITVI          --------------------
I1J6I2_SOYBN          --------------------
Q9LU57_ARATH          --------------------
I1IC44_BRADI          --------------------
I1IC41_BRADI          --------------------
I1P2N1_ORYGL          --------------------
A9T750_PHYPA          --------------------
D6RP66_COPC7          NHGSTT--------------
F8Q1E3_SERL3          NLKGRS--------------
C0NG58_AJECG          --------------------
Q4WCA6_ASPFU          --------------------
A7ELI2_SCLS1          AERVLPAEKPHGFSTGPTIG
Q0UUC1_PHANO          --------------------
D5GJ68_TUBMM          --------------------
I1RLU0_GIBZE          --------------------
C7YJB6_NECH7          --------------------
USB1_NEUCR            --------------------
A0A158NKN2_ATTCE      --------------------
E9HMQ4_DAPPU          --------------------
E0VD50_PEDHC          --------------------
G4VJ07_SCHMA          --------------------
F4P6D0_BATDJ          --------------------
D0MXX8_PHYIT          --------------------
Q6C5L7_YARLI          --------------------
USB1_DICDI            --------------------
C4LTL3_ENTHI          --------------------
B6JYX6_SCHJY          --------------------
USB1_SCHPO            --------------------
B7G7S5_PHATC          --------------------
H2AZ76_KAZAF          --------------------
USB1_YEAST            --------------------
I2GVP3_TETBL          --------------------
Q6FJQ8_CANGA          --------------------
C5DY58_ZYGRC          --------------------