CLUSTAL format seed alignment for MF_03047

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F6SEM6_CIOIN          ------------------------------------------------------------
H2Z7M8_CIOSA          ------------------------------------------------------------
AT7L3_DANRE           ------------------------------------------------------------
I3IWP4_ORENI          ------------------------------------------------------------
E2RRH9_CANLF          ------------------------------------------------------------
AT7L3_HUMAN           ------------------------------------------------------------
E1BAT0_BOVIN          ------------------------------------------------------------
G1MJ46_AILME          ------------------------------------------------------------
F7EPC2_CALJA          ------------------------------------------------------------
G3R5U9_GORGO          ------------------------------------------------------------
G7NIX3_MACMU          ------------------------------------------------------------
H0XM39_OTOGA          ------------------------------------------------------------
AT7L3_MOUSE           ------------------------------------------------------------
D4A5H7_RAT            ------------------------------------------------------------
F7DF88_MONDO          ------------------------------------------------------------
C3YL49_BRAFL          ------------------------------------------------------------
SGF11_AEDAE           ------------------MGENEPIHIEYADE----------------------------
SGF11_ANOGA           ------------------MSENDGIHIEYVDE----------------------------
E0VA87_PEDHC          -----MMVQQKNKDWSPERKKKKPEDVDFFHEDMEVDVGNSLIVGGEDMMVDDMYIRQVM
SGF11_DROME           --------MSAANMPTTTGAQGSGNQVPTT------------------------------
SGF11_DROPS           --------MPTSAAPVPAVAA----QSPTT------------------------------
SG111_DROWI           -----MSRTIVVKNPRTSGKDEDKAQIPSQDE----------------------------
A0A088A357_APIME      ----------------MSVTEE--------------------------------------
H9J5M1_BOMMO          ------------------------------------------------------------
E9GYN8_DAPPU          MVDPASGSQQQQQPPTLSITVVPLNVLDDPLENVQELDG---------------------
A7RRY5_NEMVE          ------MSERRKSGTPATIRNFDTENLPRD------------------------------
C1BVH8_LEPSM          ------------------------------------------------------------
SGF11_ASHGO           ------------------------------------------------------------
C5DIC9_LACTC          ------------------------------------------------------------
SGF11_YEAST           ------------------------------------------------------------
SGF11_VANPO           ------------------------------------------------------------
SGF11_CANGA           ------------------------------------------------------------
SGF11_KLULA           ------------------------------------------------------------
SGF11_DEBHA           ------------------------------------------------------------
SGF11_PICST           ------------------------------------------------------------
G3AR01_SPAPN          ------------------------------------------------------------
SGF11_CANAL           ------------------------------------------------------------
SGF11_LODEL           ------------------------------------------------------------
SGF11_SCHPO           ------------------------------------------------------------
                                                                                  

F6SEM6_CIOIN          -----------------------------MADLQMYADHFLNEILNEAVLGVAYEAHRSL
H2Z7M8_CIOSA          -----------------------------MADLQMYADHFLNEMLNEAVLGVAYEAHRSM
AT7L3_DANRE           ------------MKMEDMSLSGLDNT-----KLEALAHDVYSDLVEDACLGLCFEVHRAV
I3IWP4_ORENI          ------------MKMEDMPLSGPDNT-----RLEALAHDIYSELVEDACLGLCFEVHRAV
E2RRH9_CANLF          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
AT7L3_HUMAN           ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
E1BAT0_BOVIN          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
G1MJ46_AILME          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
F7EPC2_CALJA          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
G3R5U9_GORGO          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
G7NIX3_MACMU          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
H0XM39_OTOGA          ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
AT7L3_MOUSE           ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
D4A5H7_RAT            ------------MKMEEMSLSGLDNS-----KLEAIAQEIYADLVEDSCLGFCFEVHRAV
F7DF88_MONDO          ------------MKMEEMSLSGLDNS-----KLEAIAHEIYTDLVEDACLGLCFEVHRAV
C3YL49_BRAFL          --------------MSEYSFDGSEDQESEDCQLVNYAPDVLSELVDDVILGLCFDVHRSC
SGF11_AEDAE           -----------TELLTEFRQYMADPD-----TREKAANYLLDSLVDEMILGVVFEVHHAY
SGF11_ANOGA           -----------QELKREFRRFMSDPE-----TREKAANYLYESLVDETILGIAYEVHHAN
E0VA87_PEDHC          ALSLPSDEELVAEINKHFRNYLSNPE-----NLESATNTLLDDIIEDAILGVVFEVHMER
SGF11_DROME           ----------STTIVNHFRELIKEPK-----NLDEAANYLYQSLLDDAVVGIFNETHHLR
SGF11_DROPS           ----------RKAIANNFRELTKDPK-----KLDEAANQLYESLLEDAVTGIFIEVHHLR
SG111_DROWI           LPSGSSGAKTTNQIISEFRALIKDPI-----KLDEAVNYLYETLVDDAAVGIFIETRQLQ
A0A088A357_APIME      ---------RIQELNRRFLEFMSKSE-----NVESATKEIYDDLLDEVLMGFVFDVHRTT
H9J5M1_BOMMO          ---------------------MQNED-----NAVEATNFIYDQLFDDVTLGILFEFHHGV
E9GYN8_DAPPU          ---------DEDLTGGGRLLHPLSES-----AILEASQSFYEDIVDDVILGIVFEVHRGA
A7RRY5_NEMVE          -------------------QNVLDID-----PNASPEAGIVYEIIDDVILSLCFDVHRSI
C1BVH8_LEPSM          ------------MLLEGVDLKSLTASLLRKCDVEEIAESIFLELVDEISLGIGFEVHRSV
SGF11_ASHGO           --------------------MTLGRDAMTPLTILSVSETIYHNLLTSMVQDIVSRTTSR-
C5DIC9_LACTC          ---------------------------MAQLTIDTASQSIFENLLTTMIQDIVARTTTQ-
SGF11_YEAST           -------------------------MTEETITIDSISNGILNNLLTTLIQDIVARETTQ-
SGF11_VANPO           ----------------------------MTQSIDSMSISIYENLISTMIQDIVSREVVH-
SGF11_CANGA           -------------------------MTEQHETIQSVTDGIYNNLVTSMIHSIVSKETAR-
SGF11_KLULA           --------------------------MTASLTTDSVADSIYQNILTSIIQDIISRQTVK-
SGF11_DEBHA           -------------------------MTEKPVTYQSL------DMLDNILRQQTLASVSR-
SGF11_PICST           -------------------------MTEQPITLDLV------DIVDNIVRKQTLSSFAR-
G3AR01_SPAPN          -------------------------MTEGVTVQELAE-SIFDDLVLAIINQQTLTSYAN-
SGF11_CANAL           -------------------------MTSTPITYKTLADSIFNDLINNIIKQHTLTSLTNI
SGF11_LODEL           -------------------------------------------MINNIIRNQVVTHFAD-
SGF11_SCHPO           ---------------------------MQPASLAGISCTIFENLLKDYTHELTQTVHKNA
                                                                 :.               

F6SEM6_CIOIN          ------TKGTLFID-DSDEGDEKYKITIE-----------------KGLDIFG-------
H2Z7M8_CIOSA          ------TQGTLFIDEDCSDMEEKYKITVE-----------------KGLDIFG-------
AT7L3_DANRE           ------KQGYFFLDETDQESMKDFEIVDQ-----------------PGVDIFG-------
I3IWP4_ORENI          ------KQGYFFLDETDQESMKEFEIVDQ-----------------PGVDIFG-------
E2RRH9_CANLF          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
AT7L3_HUMAN           ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
E1BAT0_BOVIN          ------KCGYFFLDDTDPESMKDFEIVDQ-----------------PGLDIFG-------
G1MJ46_AILME          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
F7EPC2_CALJA          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
G3R5U9_GORGO          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
G7NIX3_MACMU          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
H0XM39_OTOGA          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
AT7L3_MOUSE           ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
D4A5H7_RAT            ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGLDIFG-------
F7DF88_MONDO          ------KCGYFFLDDTDPDSMKDFEIVDQ-----------------PGVDIFG-------
C3YL49_BRAFL          ------KMGTFFVDDVDPAELKEFEIVDQ-----------------VGLDIFG-------
SGF11_AEDAE           ------KTGSGAAIEGQPEDCKPYTIVDL-----------------PDMDVFG-------
SGF11_ANOGA           ------KTGSGAAVEGEPEDSKPYTIVDQ-----------------PDTDVFG-------
E0VA87_PEDHC          ------KTKLHEIIVGESDDEK-YKIIDA-----------------LDLDIFG-------
SGF11_DROME           ------KSGNLAALDG-VPEDSTYRMCEM-----------------PNLDIFG-------
SGF11_DROPS           ------KIGNLSALDG-VAEESAHRICDV-----------------PNLDIFG-------
SG111_DROWI           ------KTGSLTALEG-TVEE-TNDMCDL-----------------PDCDIFG-------
A0A088A357_APIME      ------KTGSSDVEEGIPDDES-YAIVDS-----------------PGLDVFG-------
H9J5M1_BOMMO          ------KTGLTDLIEGEKEEEEPYKIVNT-----------------SECDVFG-------
E9GYN8_DAPPU          ------KLGLTALLEDGVTGDTQCDFDGDETTRSSTGGGGEAMDFDAASEMLS-------
A7RRY5_NEMVE          ------KLGTFNIEDVDDEVIKQYEVVDS-----------------EGLDVFG-------
C1BVH8_LEPSM          ------KIGLFPLLDSDNSEPCSPSEAKKMGLCT------------NTMDVFG-------
SGF11_ASHGO           -------QQ--LQDARYPGLA-PLHHDQR-----------------GALDVYG-------
C5DIC9_LACTC          -------AQ--TLRARYGGIPKPYFHDKS-----------------GTLDING-------
SGF11_YEAST           -------QQ--LLKTRYPDLR-SYYFDPN-----------------GSLDING-------
SGF11_VANPO           -------QK--QMQSRYPQLK-QYSIDPN-----------------GNIDING-------
SGF11_CANGA           -------EK--LLRSRYGSYK-QYHYDPN-----------------SQLDIHG-------
SGF11_KLULA           -------RK--LLKLQFPDAK-PYYADPS-----------------GTLDIHG-------
SGF11_DEBHA           --YRSLKS---TLGENEKKSVFIDDIMS------------------SSKDIYG-------
SGF11_PICST           --HVSVQSQ--TLGNHDTNVPVISNFAVG-----------------SNKDIFN-------
G3AR01_SPAPN          --HTSIKSQ--TARN-EEQVQQITNLEEG-----------------SKLDVYG-------
SGF11_CANAL           KDHSSLLNSSNSNTNSNTNGTIASNGGNG-----------------TTSDENNEIENSTI
SGF11_LODEL           --HACMAQA--TVSIPELDKLATNLQLAD-----------------TNKDIFG-------
SGF11_SCHPO           ---------KLSLQKCPACNKHCRQYCTK-----------------PGYDIYG-------
                                                                       :  .       

F6SEM6_CIOIN          ---QPISGS------KKTVECQCPNCNRNMAASRFAPHLEKCMGMGRNSSRIASQRIANS
H2Z7M8_CIOSA          ---QPINGS------KKPFECQCPNCNRNMAASRFAPHLEKCMGMGRNSSRIASQRIANS
AT7L3_DANRE           ---QVYNQW------KNK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIASS
I3IWP4_ORENI          ---QVYNQW------KNK-ECECPNCKRLIAASRFAPHLEKCLGMGRNSSRIANRRLASS
E2RRH9_CANLF          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
AT7L3_HUMAN           ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
E1BAT0_BOVIN          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
G1MJ46_AILME          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
F7EPC2_CALJA          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
G3R5U9_GORGO          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
G7NIX3_MACMU          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
H0XM39_OTOGA          ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
AT7L3_MOUSE           ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
D4A5H7_RAT            ---QVFNQW------KSK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANS
F7DF88_MONDO          ---QVYNQW------KNK-ECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIASS
C3YL49_BRAFL          ---QPVSSK------KQY-ECECPNCGRTISANRFAPHLEKCMGMGRNSSRIASKRLQ--
SGF11_AEDAE           ---SSNSKK------AID--CSCPNCNRIVAASRFAPHLEKCMGMGRNSSRIASRRIANT
SGF11_ANOGA           ---SSNTKK------AID--CHCPNCNRIVAASRFAPHLEKCMGMGRNSSRIASRRIANT
E0VA87_PEDHC          ---QAPGKK------NYE--CICPSCNRSLAASRFAPHLEKCMGMGRNSSRLASRRIQTT
SGF11_DROME           ---ISTAKK------PMD--CTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATK
SGF11_DROPS           ---VSTAKK------AID--CTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATK
SG111_DROWI           ---MSTAEK------TAK--CCCPNCERMVAAVRFAPHLQTCLGLGRSSSRAALRRLTVS
A0A088A357_APIME      ---QHPVKK------SQE--CNCPNCDRGVAACRFATHLEKCMGMGRNSSRIASRRIANN
H9J5M1_BOMMO          ---FSMMKK------TPDSNCSCPNCERPVSATRFAPHLEKCMGMGRNSSRIASRRIASN
E9GYN8_DAPPU          ---LAAVNS------KKPAECVCPNCQRNMAASRFAPHLEKCMGMGRNSSRLASRRIATS
A7RRY5_NEMVE          ---QVPLKK------PVD--CICPNCQRNMAASRFAPHLEKCMGMGRNSSRIASRRLATG
C1BVH8_LEPSM          ---SVVTTAVGVPTLKKQPECVCPNCSRNLAASRFAPHLEKCMGMGRNSSRIASRRIASS
SGF11_ASHGO           ----RPKPQ------EASVYFRCPNCSRDLSANRFAAHLERCMSRGARRG----------
C5DIC9_LACTC          ----MPKQQ------ESSIYFHCDNCSRDVSVNRFAAHVERCLTRG-RRG----------
SGF11_YEAST           ----LQKQQ------ESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR-----------
SGF11_VANPO           ----NTKQQ------DSSQYFHCKNCGRDVSANRFAAHLQRCLNSRQRR-----------
SGF11_CANGA           ----NPKQQ------DSSQYFYCENCGREVSGNRFAAHLQRCLTRGSRR-----------
SGF11_KLULA           ----KAKQA------DSAVYIECNVCGREVSGNRFAAHLVRCLSRGRR------------
SGF11_DEBHA           QDKQKLKVS------ETSKYFQCENCGRSIAGGRFAQHMTKCLERRRK------------
SGF11_PICST           QDKTKLKTS------EASRYFSCENCGRKIAGGRYAQHVNKCLERRRR------------
G3AR01_SPAPN          QDKIKLKSA------ETSRYFSCENCGRKIAGGRFASHVNKCLERRRK------------
SGF11_CANAL           QDKSKLKQL------ETSRYFRCLNCGRNIAGGRFASHISKCLERKRK------------
SGF11_LODEL           QDRSKLKGI------EASRYFSCDNCGRKIAGGRFAQHINKCLDRKRK------------
SGF11_SCHPO           ---NSVQTP------SNVPYYSCLMCKREIAASRYAAHLEKCKGRSLSNATSYSTLFEDD
                                            *  * * ::  * * *:  *                  

F6SEM6_CIOIN          GKFSSTINDS----VGADEELDDDNDVDWFACEANQ------PTKKSKKRKAERGNGSPR
H2Z7M8_CIOSA          GKLSSTMSE-----VGADEDVDDSNDVDWFLCDSNQ------PSKKSKKRKAERNNGSPR
AT7L3_DANRE           NNTSKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSE-------KNPNS
I3IWP4_ORENI          NNMSKS--------ESDQEDNDDLNDNDWSYGAEKK-----TKKRKSD-------KSQNS
E2RRH9_CANLF          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSD-------KNPNS
AT7L3_HUMAN           NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSD-------KNPNS
E1BAT0_BOVIN          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSD-------KNPNS
G1MJ46_AILME          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSDKLWYLPFQNPNS
F7EPC2_CALJA          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSDKLWYLPFQNPNS
G3R5U9_GORGO          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSDKLWYLPFQNPNS
G7NIX3_MACMU          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSDKLWYLPFQNPNS
H0XM39_OTOGA          NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSDKLWYLPFQNPNS
AT7L3_MOUSE           NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSD-------KNPNS
D4A5H7_RAT            NNMNKS--------ESDQEDNDDINDNDWSYGSEKK-----AKKRKSD-------KNPNS
F7DF88_MONDO          NNMNKS--------ESDQEDNDDINDNDWFYGSEKK-----AKKRKSDKVLSFFFQNPNS
C3YL49_BRAFL          -NTGKC--------ESEGDDDD---DNDWTYGEKK-------KKKKSD-------KKANS
SGF11_AEDAE           RD----------GGNYFGADEDDEDDADWS------------GEKRKK---------KIA
SGF11_ANOGA           RDV--------GTGNYFGGDEDDEDDADWS------------GEKRKK---------KIS
E0VA87_PEDHC          AN-----------KETTGALSDDEDDADWTVGNEK------KGKSKKKEKVTIKKIGKLV
SGF11_DROME           EGATSA----HLHSSGNTGGTDDEDDVDWSS-----------DKRRKK---------SNQ
SGF11_DROPS           EGTSASSNSSYVHSGANAGGTDDEDDVDWSS-----------DKRKKK---------STQ
SG111_DROWI           SRSSST------STGGGQANEKSTDDEDWSL-----------DSRPGK---------STK
A0A088A357_APIME      SKD---------LSNFSGVISDDDDDVDWSLNND--------KRKRRKDRNGIKRTKQQK
H9J5M1_BOMMO          SRE---------PTSYAGLLSDDDDDADWAGGSMQ------NERRKRRIKN---NNNRKP
E9GYN8_DAPPU          ASRQADLVSDDDCDDDDWTASGASERQDHRIMSGEGGGGGGNKNKRRHHLHKKDKNSPRR
A7RRY5_NEMVE          KMMDEDEEDVYFDDDWTWNTDRKPGKKNKRERPGN-------SPRRAKAPRRNGETGTPR
C1BVH8_LEPSM          SNNSNN-------SSSQNNSNSNSNSKDSHNSHSE--------------------QGSGG
SGF11_ASHGO           ------------------------------------------------------------
C5DIC9_LACTC          ------------------------------------------------------------
SGF11_YEAST           ------------------------------------------------------------
SGF11_VANPO           ------------------------------------------------------------
SGF11_CANGA           ------------------------------------------------------------
SGF11_KLULA           ------------------------------------------------------------
SGF11_DEBHA           ------------------------------------------------------------
SGF11_PICST           ------------------------------------------------------------
G3AR01_SPAPN          ------------------------------------------------------------
SGF11_CANAL           ------------------------------------------------------------
SGF11_LODEL           ------------------------------------------------------------
SGF11_SCHPO           NADEED------------------------------------------------------
                                                                                  

F6SEM6_CIOIN          TSKSILSKSRS-------------------------------TVTTQSCVAGQSKAFVDQ
H2Z7M8_CIOSA          TSKAILTKPRP-------------------------------TCLTRPSSAGHSKEFVDQ
AT7L3_DANRE           PRRSK-SLKHKNG-------------------ELSGSVNPDMYKYNYSSG--ISYETLGP
I3IWP4_ORENI          PRRSK-SLKHKNG-------------------EIGSGVGAESYKYNYNTG--ISYETLGP
E2RRH9_CANLF          PRRSK-SLKHKNGFSVCTSASNTLPLLFSSSGELS---NSDPFKYNNSTG--ISYETLGP
AT7L3_HUMAN           PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
E1BAT0_BOVIN          PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
G1MJ46_AILME          PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
F7EPC2_CALJA          PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
G3R5U9_GORGO          PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
G7NIX3_MACMU          PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
H0XM39_OTOGA          PRRSK-SLKHKNG-------------------ELS---NSDPFKYNNSTG--ISYETLGP
AT7L3_MOUSE           PRRSK-SLKHKNG-------------------ELS---NSDPFKYSNSTG--ISYETLGP
D4A5H7_RAT            PRRSK-SLKHKNG-------------------ELS---NSDPFKYSNSTG--ISYETLGP
F7DF88_MONDO          PRRSK-SLKHKNG-------------------ELSS--NSDPFKYSNSSG--INYETLGP
C3YL49_BRAFL          PRQSKPSKSSKNG-------------------DIP---SVGSVGSEKSSGGYVNYEAMSI
SGF11_AEDAE           PVRTNGSKK---------------------------------------NGKTS-------
SGF11_ANOGA           QVRTNGSKK---------------------------------------NGKTS-------
E0VA87_PEDHC          KVNKNVNNKQC-------------------------------ILKSINNGSNLFEILLIQ
SGF11_DROME           NSRNNGSKK---------------------------------------NNGKTF------
SGF11_DROPS           NSRNNGSKK---------------------------------------NNGKTF------
SG111_DROWI           NSRNKGSKK---------------------------------------NQKNKLK-----
A0A088A357_APIME      NSQRNGETINE-------------------------------HVHSSNENSPSNYENMSL
H9J5M1_BOMMO          NKMHNGNSRNG-------------------------------HLNNDANDGSTTYETMTA
E9GYN8_DAPPU          KKWKNGSNGDNNHSNSNSSSGHPSI-----ASSASAVPGAEDGLHTGSTGGGNTMETMGL
A7RRY5_NEMVE          PGTPSSVNSGE-------------------------------MPAARIGPTQAAFESLGI
C1BVH8_LEPSM          NASSASCLDEDD------------------------------------------------
SGF11_ASHGO           ------------------------------------------------------------
C5DIC9_LACTC          ------------------------------------------------------------
SGF11_YEAST           ------------------------------------------------------------
SGF11_VANPO           ------------------------------------------------------------
SGF11_CANGA           ------------------------------------------------------------
SGF11_KLULA           ------------------------------------------------------------
SGF11_DEBHA           ------------------------------------------------------------
SGF11_PICST           ------------------------------------------------------------
G3AR01_SPAPN          ------------------------------------------------------------
SGF11_CANAL           ------------------------------------------------------------
SGF11_LODEL           ------------------------------------------------------------
SGF11_SCHPO           ------------------------------------------------------------
                                                                                  

F6SEM6_CIOIN          NDNIDVVHDTRSDNINHTVTLWEKHINATLTGNDGGKS-PAMHAGNVIIKKKKSKHNPSK
H2Z7M8_CIOSA          NDNIEI-SEIRSGNINQTMDLWEQHINATLTDAKSDKTTPGLHPNSGIVKKKKSKHNSTK
AT7L3_DANRE           EELRSILTTQCGVVSEHTKKMCTRSQRCPQHTDEQRRAVRVFLLGPSASTLPDADTMLEN
I3IWP4_ORENI          DEVRSLLTTQCGVISEHTKKMCTRSQRCPQHTDEQRRAVRVFLLGPSAPTLPDADA-VDT
E2RRH9_CANLF          DELRNLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRAVRIYFLGPSA-VLPEVESSLDN
AT7L3_HUMAN           EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
E1BAT0_BOVIN          EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGSSA-VLPEVESSLDN
G1MJ46_AILME          DELRNLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRAVRIYFLGPSA-VLPEVESSLDN
F7EPC2_CALJA          EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
G3R5U9_GORGO          EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
G7NIX3_MACMU          EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
H0XM39_OTOGA          EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
AT7L3_MOUSE           EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
D4A5H7_RAT            EELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSA-VLPEVESSLDN
F7DF88_MONDO          EELRTLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRAVRVYFLGPSA-PLPEAEGSVEN
C3YL49_BRAFL          EERRTVLKQICGVISEHTKRMCTRSHRCPQHSDEQRRQVRLYLLGSAASSLLDDDVHVDI
SGF11_AEDAE           ------------------------------------------------------------
SGF11_ANOGA           ------------------------------------------------------------
E0VA87_PEDHC          IMDKVMIHQYQVYHMRICQKLIKKHFYHKYVESFLSIRKKYVLELQNVLNTRKNRKKQSG
SGF11_DROME           ------------------------------------------------------------
SGF11_DROPS           ------------------------------------------------------------
SG111_DROWI           ------------------------------------------------------------
A0A088A357_APIME      EDKRILLTQICGVISEHTKKLCTRSMRCPQHTEDQRKEMRANLESGNNIQPSQDNLHVDV
H9J5M1_BOMMO          NEKKNLLLHSCGVVSEHTKKFCTRSTRCPQHTEEQRRAVRISVLEPSTPESQMMGLTPDE
E9GYN8_DAPPU          TERRTLLTTMCGVISEHTGRMCTRSLRCPQHTDSQRKNVRQVILEHHTETENHLLPTIGG
A7RRY5_NEMVE          AEKKALMSQTCGVISEHTGRMCTRSQRCPQHTDEQRRLVRLRMLGPQETESALSRVRPDG
C1BVH8_LEPSM          AEDEDWIEPGKSFNRKKRDKNSPRRNRAPKYGNSQVHPHSK-------------------
SGF11_ASHGO           ------------------------------------------------------------
C5DIC9_LACTC          ------------------------------------------------------------
SGF11_YEAST           ------------------------------------------------------------
SGF11_VANPO           ------------------------------------------------------------
SGF11_CANGA           ------------------------------------------------------------
SGF11_KLULA           ------------------------------------------------------------
SGF11_DEBHA           ------------------------------------------------------------
SGF11_PICST           ------------------------------------------------------------
G3AR01_SPAPN          ------------------------------------------------------------
SGF11_CANAL           ------------------------------------------------------------
SGF11_LODEL           ------------------------------------------------------------
SGF11_SCHPO           ------------------------------------------------------------
                                                                                  

F6SEM6_CIOIN          KSKR----------------------------RQI-------------------------
H2Z7M8_CIOSA          KSKK----------------------------RQINPLPIP-------------------
AT7L3_DANRE           EAYE---------------------------PPDGQLIMSRLHWDASSDISPSDSASS-K
I3IWP4_ORENI          DSFD---------------------------IPDPQPVMSRLQWE-DSDISPTDSASS-K
E2RRH9_CANLF          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
AT7L3_HUMAN           DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
E1BAT0_BOVIN          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
G1MJ46_AILME          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
F7EPC2_CALJA          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
G3R5U9_GORGO          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
G7NIX3_MACMU          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
H0XM39_OTOGA          DSFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
AT7L3_MOUSE           DGFD---------------------------MTDSQALISRLQWDGSSDLSPSDSGSS-K
D4A5H7_RAT            DGFD---------------------------MTDSQALLSRLQWDGSSDLSPSDSGSS-K
F7DF88_MONDO          DSFD---------------------------VAESQALMSRLQWDGSSDLSPSDSASS-K
C3YL49_BRAFL          DGYEDSPVVSATGHHHPTNLPKRDHLGRFMSAQQVAAMAAGLPWDTASNSSPGSSVSSMR
SGF11_AEDAE           ------------------------------------------------------------
SGF11_ANOGA           ------------------------------------------------------------
E0VA87_PEDHC          KCVY---------------------------QIQPSLLKMIIFR----------------
SGF11_DROME           ------------------------------------------------------------
SGF11_DROPS           ------------------------------------------------------------
SG111_DROWI           ------------------------------------------------------------
A0A088A357_APIME      DTYE---------------------------EGDGQNLREALARWDREESSHSSPADSTS
H9J5M1_BOMMO          ASSP---------------------------PDSSPSSSCSSSSRKRDRHRAPPKMKNKR
E9GYN8_DAPPU          DKDK---------------------------EMIDVDTWEEGDSLASLLTAQSHDVPTPG
A7RRY5_NEMVE          SSFE---------------------------PEDVIDVDGYEDGDGPSLRDTLSRLSWEE
C1BVH8_LEPSM          ------------------------------------------------------------
SGF11_ASHGO           ------------------------------------------------------------
C5DIC9_LACTC          ------------------------------------------------------------
SGF11_YEAST           ------------------------------------------------------------
SGF11_VANPO           ------------------------------------------------------------
SGF11_CANGA           ------------------------------------------------------------
SGF11_KLULA           ------------------------------------------------------------
SGF11_DEBHA           ------------------------------------------------------------
SGF11_PICST           ------------------------------------------------------------
G3AR01_SPAPN          ------------------------------------------------------------
SGF11_CANAL           ------------------------------------------------------------
SGF11_LODEL           ------------------------------------------------------------
SGF11_SCHPO           ------------------------------------------------------------
                                                                                  

F6SEM6_CIOIN          ------------------------------------------------------------
H2Z7M8_CIOSA          ------------------------------------------------------------
AT7L3_DANRE           AS---------TNNSESKRPKKKKPSTLSLTPAGERDKAQERDRIAGSGSSGSSSQNALG
I3IWP4_ORENI          ASKEGT--LTGTNHSDSRKPKKKKKPSLPLNSGG--------------GSN-------IS
E2RRH9_CANLF          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SSLG---------
AT7L3_HUMAN           TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
E1BAT0_BOVIN          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
G1MJ46_AILME          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SSLG---------
F7EPC2_CALJA          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SSLG---------
G3R5U9_GORGO          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
G7NIX3_MACMU          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
H0XM39_OTOGA          TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
AT7L3_MOUSE           TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
D4A5H7_RAT            TSENQG-WGLGTNSSESRKTKKKK-SHLSLVGTA-------------SGLG---------
F7DF88_MONDO          TSKNQARGGRGTNNSESRKTKKKK-PHLSLVGAA-------------PGLS---------
C3YL49_BRAFL          VVQQWETMGMTTTGPASNSSASASAPPPTKKKKS-------------KKKE---------
SGF11_AEDAE           ------------------------------------------------------------
SGF11_ANOGA           ------------------------------------------------------------
E0VA87_PEDHC          ------------------------------------------------------------
SGF11_DROME           ------------------------------------------------------------
SGF11_DROPS           ------------------------------------------------------------
SG111_DROWI           ------------------------------------------------------------
A0A088A357_APIME      TTSTSSISRKRETKSKGKGKGSKRDRGSPISQGD--------------------------
H9J5M1_BOMMO          ERNISPSQRE--------------------------------------------------
E9GYN8_DAPPU          TEASPAESTSTSASSTSSSARRRTEQQPSVTNNKTNSKKNNGKKFKGEA-----------
A7RRY5_NEMVE          ESNASTGDDHSPAAFGISAIVKKKRKKKAKHKRRPR------------------------
C1BVH8_LEPSM          ------------------------------------------------------------
SGF11_ASHGO           ------------------------------------------------------------
C5DIC9_LACTC          ------------------------------------------------------------
SGF11_YEAST           ------------------------------------------------------------
SGF11_VANPO           ------------------------------------------------------------
SGF11_CANGA           ------------------------------------------------------------
SGF11_KLULA           ------------------------------------------------------------
SGF11_DEBHA           ------------------------------------------------------------
SGF11_PICST           ------------------------------------------------------------
G3AR01_SPAPN          ------------------------------------------------------------
SGF11_CANAL           ------------------------------------------------------------
SGF11_LODEL           ------------------------------------------------------------
SGF11_SCHPO           ------------------------------------------------------------
                                                                                  

F6SEM6_CIOIN          -----------------------
H2Z7M8_CIOSA          -----------------------
AT7L3_DANRE           LSSRKKRPKLAVPPAPSIYDDLN
I3IWP4_ORENI          ISTKKKRPKLSAPPISSIYDDLN
E2RRH9_CANLF          -SNKKKKPKPPAPPTPSIYDDIN
AT7L3_HUMAN           -SNKKKKPKPPAPPTPSIYDDIN
E1BAT0_BOVIN          -SNKKKKPKPPAPPTPSIYDDIN
G1MJ46_AILME          -SNKKKKPKPPAPPTPSIYDDIN
F7EPC2_CALJA          -SNKKKKPKPPAPPTPSIYDDIN
G3R5U9_GORGO          -SNKKKKPKPPAPPTPSIYDDIN
G7NIX3_MACMU          -SNKKKKPKPPAPPTPSIYDDIN
H0XM39_OTOGA          -SNKKKKPKPPAPPTPSIYDDIN
AT7L3_MOUSE           -SNKKKKPKPPAPPTPSIYDDIN
D4A5H7_RAT            -SNKKKKPKPPAPPAPSIYEDIN
F7DF88_MONDO          -SNKKKKPKPPAPPTPSIYDDIN
C3YL49_BRAFL          -GHTHKKSK-SKNPVLQQYDLH-
SGF11_AEDAE           -----------------------
SGF11_ANOGA           -----------------------
E0VA87_PEDHC          -----------------------
SGF11_DROME           -----------------------
SGF11_DROPS           -----------------------
SG111_DROWI           -----------------------
A0A088A357_APIME      -----------------------
H9J5M1_BOMMO          -----------------------
E9GYN8_DAPPU          -----------------------
A7RRY5_NEMVE          -----------------------
C1BVH8_LEPSM          -----------------------
SGF11_ASHGO           -----------------------
C5DIC9_LACTC          -----------------------
SGF11_YEAST           -----------------------
SGF11_VANPO           -----------------------
SGF11_CANGA           -----------------------
SGF11_KLULA           -----------------------
SGF11_DEBHA           -----------------------
SGF11_PICST           -----------------------
G3AR01_SPAPN          -----------------------
SGF11_CANAL           -----------------------
SGF11_LODEL           -----------------------
SGF11_SCHPO           -----------------------