CLUSTAL format seed alignment for MF_03049

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UBA4_YEAST        ------------------------------------MNDYHLEDTTSELEALRLENAQLR
UBA4_ASHGO        --------------------------------MTGESLDGSLHALTIELDALRRENANLK
UBA4_CANAL        ------------------------------------MSEPSKEELLARIAQLELENEQLK
UBA4_SCHPO        ----------------------------------------------------------MN
UBA4_YARLI        ----------------------------------------------------------MD
UBA4_EMENI        ----------------------------------MEDLETRCASLRTEIAAAEAQLTKLK
UBA4_ASPFU        ----------------------------------MENLEQTCASLRAQIAATEAQLAGLK
C0NQD0_AJECG      ----------------------------------MEDLLKSREFLQQQIATTEAQLSQLN
Q0U1Y0_PHANO      -------------------------------------MVNAIDALRKQIASCESTLEDLR
UBA4_SCLS1        ----------------------------------MDCAEEKAKSLRRQIADTEAELAQLK
C7Z6K1_NECH7      --------------------------------------MDKIDQLRKEIAKREAELADLR
Q7SEE2_NEUCR      -------------------------------------------------MQNGGASSDQN
D5GLT0_TUBMM      ---------------------------------METSLEAENKVLKKRISELEAQLAGHS
MOCS3_HUMAN       -----------------------------------MASREEVLALQAEVAQREEELNSLK
H2P2A9_PONAB      -----------------------------------MASREEVLALRAEVAQREEELNSLK
G1SC20_NOMLE      -----------------------------------MASQEEVLALQAEVAQREEELNSLK
I3N396_ICTTR      -----------------------------------MAAREQVLALQAEVARREEELSSLK
H0XRE9_OTOGA      -----------------------------------MAAREKVLALQAEVAQREEELSFLK
MOCS3_PIG         -----------------------------------MAAREEVLALQAEVARREEELSSLK
H0VUB6_CAVPO      -----------------------------------MATREEVLALRAAVAQREEELNSLK
MOCS3_BOVIN       -----------------------------------MAAREEVLALQAEVAQREEELSSLK
MOCS3_MOUSE       -----------------------------------MAAPEDVAALQAEITRREEELASLK
D4A8L5_RAT        -----------------------------------MAAPEDVAALQDEIARREEELASLK
MOCS3_DANRE       -------------------------------------MDDTIVSLKSQLLEREREVATLK
H3AHF7_LATCH      --------------------------------------MEALAKIKARLARKEKEVEELT
B7QFH8_IXOSC      ----------------------------------------------------------MQ
MOCS3_ANOGA       ---------------MGEMNG----------EGQIEVLENDIRTLRKQLQEKVQQLKTLK
W5JI26_ANODA      --------------MTGELPSSPAVTATEDSEMEIELLENDIRRLRKQLQEKVQQLKALK
MOCS3_AEDAE       ----------------MEVDG----------ETQIEELECDIRTLRKQLKAKVQQLKTLK
MOCS3_DROME       ---------------MMESEVD----------SERTMLKREIAELRAALNQKEQCLRELD
M9PCK7_DROME      ---------------MMESEVD----------SERTMLKREIAELRAALNQKEQCLRELD
MOC31_DROPS       ---------------MIDSEALE---------SERVKLKRDIADLRANLNRKEQCLRELE
MOC32_DROPS       ---------------MIDSEALE---------SERVKLKRDIADLRANLNRKEQCLRELE
MOCS3_CAEBR       -------------------------------------------------MESKDWVAGIS
MOCS3_CAEEL       -------------------------------------------------MNDDQWVAGIS
F6HES6_VITVI      -------------------------MESNGEDA--SRILREIETLKAAKADIEHRISVLE
B9GJ37_POPTR      ---------------------MENKMESKGGEA--ARILSEIETLKATRSDLDNRISALE
MOCS3_ARATH       -------------------------MMSNGGDS--SEIVRELEELKLKKAEIEHRISTLE
C5Z503_SORBI      ----------------------MGGGGGGGGRR--EAIERELKKLRAEREDLDGRIRLLE
C5Y081_SORBI      ----------------------MGSG---GGRG--EAIERELKKLRAEREDLDGRIRLLE
MOCS3_ORYSJ       ---------------------MEGGGDDDGGRSRAEAIMRELERLRAEREELDGRIRLLE
A9TQW1_PHYPA      -------------------------MNREGGEN---------------ACPAPPWIAGLS
F4NU54_BATDJ      ------------------------------------------------MADHSPATAKYT
UBA4_DICDI        ----------------------------------------------------------ME
F0Z915_DICPU      ---------------------------------------------------------MSA
D3BLV1_POLPP      ----------------------------------------------------------MS
G4V7Z6_SCHMA      ---------------MNVSRRNKLGAAKTWEFSYLLWFFDLLEKLYRCFMLTFDKKLGMG
E9ADE6_LEIMA      -----------------------------------------------MNAEATQDTLPHA
A4I2V9_LEIIN      -----------------------------------------------MNAGAMEDILPHA
A4HFU1_LEIBR      -----------------------------------------------MDASSSDNALPHG
Q386S6_TRYB2      MNVLEDLEAQVATARLRLHELEERLHEERNRVNSCGADVLTSSGPSSIDNSGGSTAGETP
V5B0X0_TRYCR      MNETTELEAEVEATRRKLRELERRLSERRR-------TLLLQATSENGHMKDKYPSDVLA
B7FVV0_PHATC      --------------------------------------------MQSEFFSCSQSSEQFL
A0E677_PARTE      -------------------------------------MKEYIVYLQGLLKQNNIQFEQEE
Q6BG38_PARTE      -------------------------------------MKEYIEYLQNLLKQNKIEFEQEE
I7M6E7_TETTS      --------------------MSQVEEQKAVLVQKIEKLEDRIKYLEALLEKNQIPFSKIN
E3KQR1_PUCGT      --------MTVTRNLSCSNSTSHSGSSRPIEEIAKEIKQTNAKLLQLQLELSHALKSQKV
E3L838_PUCGT      --------MTVTRNLSCSNFTSHSGSSRPIEEIAMEIKQTNAKLLQLQLELSHALKSQKV
A8NT26_COPC7      ------------------------------------------------------------
Q5KJ01_CRYNJ      ------------------------------------------------MQVNQEASSSRR
                                                                              

UBA4_YEAST        EQLAKREDSSR-------------------------------------------------
UBA4_ASHGO        QQLKEKDGACG-------------------------------------------------
UBA4_CANAL        QQNGKKSQHEQFNKI---------------------------------------------
UBA4_SCHPO        PQEKIICSSNG-------------------------------------------------
UBA4_YARLI        RSD--SEKTDV-------------------------------------------------
UBA4_EMENI        RELHEAEGAALRAQ--------------------------SQKTASANAT-------TGQ
UBA4_ASPFU        RELEIAEQAAEVKA--------------------------QSTTRTITAE-------DGK
C0NQD0_AJECG      AALERTEQQIAAGR--------------------------PTTATTTTNKPETVNKGEVP
Q0U1Y0_PHANO      QQLAEAEHTQQQQEKVLRQKPALSHDPLDHDMNFGVPDDFRSEVFAVLEQEHVAREAEGT
UBA4_SCLS1        LQLLSLEEKDTNSKN-------------------------LEAKTSASEKD------DPV
C7Z6K1_NECH7      SQLAAAEFEERENK----------------------------------------------
Q7SEE2_NEUCR      GSISSVPRDTSR------------------------------------------------
D5GLT0_TUBMM      DRPLVTSQKSHPPP---------------------------------------------N
MOCS3_HUMAN       QKLASALLAEQ-----EPQPERLVPVSPLPP-----------------------------
H2P2A9_PONAB      QKLASALLAEQ-----EPQPERLVQVSPLPP-----------------------------
G1SC20_NOMLE      QKLASALLAEQ-----EPQPERLVPVSPLPP-----------------------------
I3N396_ICTTR      QRLAAALLAEQ-----EPEPERLVPVSPLPP-----------------------------
H0XRE9_OTOGA      QKLAAALLAEQ-----EPPLEHLDPLSPLPP-----------------------------
MOCS3_PIG         HRLAAALLAEQ-----ES--ERLLPVSPLPP-----------------------------
H0VUB6_CAVPO      QKLAAALLAEQ-----ELEPERRVPVSPLPP-----------------------------
MOCS3_BOVIN       QRLAAALSTGQ-----ES--ARSVPVSPLPP-----------------------------
MOCS3_MOUSE       RRLAAALTAEP-----EPERPLRVPPPPLAP-----------------------------
D4A8L5_RAT        QRLAAALAVEP-----EPERP--IPVMPLPS-----------------------------
MOCS3_DANRE       KKLDQIEKGNS---TLPELQEKVTSLSPLRL-----------------------------
H3AHF7_LATCH      ARLAQLEKGSSGNQTVSDLHTKVTRLPPLEA-----------------------------
B7QFH8_IXOSC      KSTGQA------------------------------------------------------
MOCS3_ANOGA       KHFQKNCIT---------------------------------------------------
W5JI26_ANODA      KHFQKNCIT---------------------------------------------------
MOCS3_AEDAE       KHFQKNCIN---------------------------------------------------
MOCS3_DROME       SLFSFATRP-E-----QEVVGNDLESPDVAV-----------------------------
M9PCK7_DROME      SLFSFATRP-E-----QEVVGNDLESPDVAV-----------------------------
MOC31_DROPS       AAIAAGEDSDE-----AEESSNDMPTP---------------------------------
MOC32_DROPS       AAIAAGEDSDE-----AEESSNDMPTP---------------------------------
MOCS3_CAEBR       ------------------------------------------------------------
MOCS3_CAEEL       ------------------------------------------------------------
F6HES6_VITVI      ARLRDIPLPNDAISGVSCSSMSIADSAAGH------------------------------
B9GJ37_POPTR      AQLRHLNFEKN---NVSCPSIS---TGFGH------------------------------
MOCS3_ARATH       AKLQDTAAVEL-YDAVSNGDSYLTAPELEH------------------------------
C5Z503_SORBI      SQLEATPAGVSGAAAGIGVEDGACGGSVACQSRVSNGFK---------------------
C5Y081_SORBI      SELKAVPAGVSGAAAGKGVGDGACGGSVACQSRVGNGFA---------------------
MOCS3_ORYSJ       SQLRLGAAPLPPSAAAEVEPTGSPSSSSS-------------------------------
A9TQW1_PHYPA      HSL---------------------------------------------------------
F4NU54_BATDJ      TSH---------------------------------------------------------
UBA4_DICDI        KYIKE-------------------------------------------------------
F0Z915_DICPU      VYIKD-------------------------------------------------------
D3BLV1_POLPP      DLYKL-------------------------------------------------------
G4V7Z6_SCHMA      LFQEK-------------------------------------------------------
E9ADE6_LEIMA      AFVSSV------------------------------------------------------
A4I2V9_LEIIN      AFVSSV------------------------------------------------------
A4HFU1_LEIBR      AFVSAA------------------------------------------------------
Q386S6_TRYB2      SFVSSS------------------------------------------------------
V5B0X0_TRYCR      PFVCTA------------------------------------------------------
B7FVV0_PHATC      PTLDVL------------------------------------------------------
A0E677_PARTE      DFAQSKLNQINNEFGYEH------------------------------------------
Q6BG38_PARTE      DFIQHKVSQINNEFGYEH------------------------------------------
I7M6E7_TETTS      QEQQSNQVEVESKLEQQQEKDQKGPLHTNLD-----------------------------
E3KQR1_PUCGT      DSLKQD------------------------------------------------------
E3L838_PUCGT      DSLKQD------------------------------------------------------
A8NT26_COPC7      ---MEP------------------------------------------------------
Q5KJ01_CRYNJ      TAVEGL------------------------------------------------------
                                                                              

UBA4_YEAST        -----DYPLSLEEYQRYGRQMIVEETGGVAGQVKLKNTKVLVVGAGGLGCPALPYLAGA-
UBA4_ASHGO        -----ELPMSLEEFQRYGRQMIVGETGGLSGQVKLRSARVLIVGAGGLGCPALQYLAGA-
UBA4_CANAL        -----DDNFSLDEYKRYGRQMIVPQFGSLESQIKLKNSKVLVVGAGGLGSPALLYLSSA-
UBA4_SCHPO        ------LELSLDEYSRYGRQMLLSEIG-LPGQLSLKRSSVLVIGAGGLGCPAMQYLVAA-
UBA4_YARLI        ------LPMFKQEYGRYGRQMLVPEFG-ISGQLDLRSKRILVVGAGGLGSPAIQYLAGA-
UBA4_EMENI        RTKSK-WPLHGEEYRRYGRQMIVPQFG-LQGQLKLRDAKVLIVGAGGLGCPAALYLAGA-
UBA4_ASPFU        TNETREWPLLSEEYKRYGRQMIVPQLG-LQGQLKLRAARVLIVGAGGLGCPAALYLAGA-
C0NQD0_AJECG      SEQNRRYPLEQDEYRRYGRQMIVDQIG-LDGQLKLRESSVLIVGAGGLGCPAAMYLAGA-
Q0U1Y0_PHANO      SHMTR-WPLDKHEYKRYGRQLIMPEIG-LQGQLCLKKARVLVVGVGGLGCPAAAYLVGA-
UBA4_SCLS1        THIENKWPMSLEEYKRYGRQMIVPDIG-IKGQLRLKSASILLVGAGGLGCPAAAYIAGA-
C7Z6K1_NECH7      --QAWKWPLDTHEYERYSRQMIVPKFG-LEGQLRLRKAKVLLVGAGGLGCPAAVYLAGS-
Q7SEE2_NEUCR      -------PLTEDELDRYSRQMIVPGMG-KEAQLRLINAKVLIIGAGGLGCPAAQYIAGA-
D5GLT0_TUBMM      IVSKGEVKLSLEEYKRYGRQMILPEIG-IEGQMSLKQSRVLIVGAGGLGCPAAAYLAGA-
MOCS3_HUMAN       -----KAALSRDEILRYSRQLV-LPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAA-
H2P2A9_PONAB      -----KAALSRDEILRYSRQLV-LPELGVHGQLRLGTASVLIVGCGGLGCPLAQYLAAA-
G1SC20_NOMLE      -----KAALSRDEILRYSRQLV-LPELGVHGQLRLGTASVLIVGCGGLGCPLAQYLAAA-
I3N396_ICTTR      -----KAVLSREEILRYSRQLV-LPELGVHGQLRLAAASVLIVGCGGLGCPLAQYLAAA-
H0XRE9_OTOGA      -----KAALSRDEILRYSRQLV-LPELGVHGQLRLATASVLIVGCGGLGCPLAQYLAAA-
MOCS3_PIG         -----KAALSQDEILRYSRQLV-LPELGVQGQLRLATASVLIVGCGGLGCPLAQYLAAA-
H0VUB6_CAVPO      -----KAALSRDEILRYSRQLV-LPELGVHGQLRLAAASVLIVGCGGLGCPLAQYLAAA-
MOCS3_BOVIN       -----RAALSREEIRRYSRQLV-LPELGMQGQLRLAAAAVLVVGCGGLGCPLAQYLAAA-
MOCS3_MOUSE       -----RAALSRDEILRYSRQLL-LPELGVRGQLRLAAAAVLVVGCGGLGCPLAQYLAAA-
D4A8L5_RAT        -----RAALSRDEILRYSRQLL-LPELGVRGQLRLAAASVLVVGCGGLGCPLAQYLAAA-
MOCS3_DANRE       -----NTSLNNDDIMRYSRQLL-LPELGVKGQIAISNISVLVVGCGGLGCPLAQYLAAA-
H3AHF7_LATCH      -----KTSLTNEDILRYSRQLI-VMELGVKGSVFLSPVSLATNGNGGVGSPLPWFIIMII
B7QFH8_IXOSC      ------GGLTKEDVARYSRQMI-LPGFGVAGQKALKAASVLIVGAGGLGCPCAAYLAAA-
MOCS3_ANOGA       -------KLNNDEIARYSRQII-LSEIGVQGQLKLKKASVLVVGAGGLGCPAALYLAGA-
W5JI26_ANODA      -------KLNNDEIARYSRQII-LSEIGVQGQLKLKKAAVLVVGAGGLGCPSALYLAGS-
MOCS3_AEDAE       -------KLNNNEIARYSRQII-LSEIGVQGQLKLKRSSVLVVGAGGLGCPSALYLAGA-
MOCS3_DROME       -----HTKLTNDDIARYSRQLI-LPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAA-
M9PCK7_DROME      -----HTKLTNDDIARYSRQLI-LPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAA-
MOC31_DROPS       -----QTKLTNDDIARYSRQLI-LQDFGVQGQLKLKNSSVLIVGMGGLGCPAAQYLVAA-
MOC32_DROPS       -----QTKLTNDDIARYSRQLI-LQDFGVQGQLKLKNSSVLIVGMGGLGCPAAQYLVAA-
MOCS3_CAEBR       ----------KSDAGRYSRQLL-VDDFGVSGQKNLKNTAVLIVGAGGLGCPVATYLGAA-
MOCS3_CAEEL       ----------KKDAGRYSRQLL-VDDFGVSGQKNLKNLNVLIVGAGGLGCPVATYLGAA-
F6HES6_VITVI      -------GLSPDMIYRYSRHLL-LPSFGVQGQSSLLKSSILVVGAGGLGAPALLYLAAC-
B9GJ37_POPTR      -------GLSPDMIYRYSRQLL-LPSFGVQGQSNLLKSSILVVGAGGLGSPALLYLAAC-
MOCS3_ARATH       -------GLSPDQIYRYSRQLL-LPSFAVEGQSNLLKSSVLVIGAGGLGSPALLYLAAC-
C5Z503_SORBI      ----LDGGLPADMVYRYSRHLL-LPDFGVEGQRKLSQSSILVVGAGGLGSPVALYLAAC-
C5Y081_SORBI      ----PDGGLPADMIYRYSRHLL-LPDFGVEGQRKLSQSSILVVGAGGLGSPVALYLAAC-
MOCS3_ORYSJ       --------AAADMISRYRRHLL-LPQFGLEGQRKLSQSSILVVGAGGLGSPVAMYLAAC-
A9TQW1_PHYPA      ---------TAAQIQRYSRQLL-LPSFGVKAQENLCKGSVLIVGAGGLGSPVALYLAAC-
F4NU54_BATDJ      -------GLSNQQIKRYSRQLL-LRDIGVQGQEKLCNSSVLIIGAGGIGSPAILYLAAA-
UBA4_DICDI        ------HTLKPNEIERYGRQLI-TPDIGVSGQMSLCNSSVLIIGAGGLGCPVALYLSSA-
F0Z915_DICPU      ------HSLNSNEIERYSRQLI-TPDIGVQGQMKLCASRVLVVGAGGLGCPVALYLATA-
D3BLV1_POLPP      ------HGLNNSQVGRYGRQLI-TPGVGVAGQEALLAAKVLVVGAGGLGCPIAMYLAGA-
G4V7Z6_SCHMA      ------CDLTPSEISRYSRQLI-LPQFGVSGQLKLRSGRVLIVGCGGLGCPAAVYLAAA-
E9ADE6_LEIMA      ------PTLTKEDVERFGRQML-VEEIGAAHMGQIRQAHVVCVGAGGLGSTILLYLAAS-
A4I2V9_LEIIN      ------PTLTKEDVERFGRQML-VEEIGAAHMEQIRHAHVVCVGAGGLGSTILLYLAAS-
A4HFU1_LEIBR      ------PTLTKDNVERFGRQML-VEEIGAAHMEQIRHAHVVCVGAGGLGSTILLYLAAA-
Q386S6_TRYB2      ------GSLTKSDVERFSRQIV-LEDIGAKGMDRIRRGRVLLVGAGGLGSTAALYLVAA-
V5B0X0_TRYCR      ------ASLTKADVERFSRQMM-VDGIGARGMERIRRGRVLLVGAGGLGSTIALFLAAS-
B7FVV0_PHATC      ------SELSADHVERYSRQMITADGFGVGGQKKLLSSAVLVIGAGGIGSTAIPYLAAA-
A0E677_PARTE      -------------INRYKRQMI-LSEIGLTGQQKIHLAKVLIVGAGGIGAPAIYYLAGA-
Q6BG38_PARTE      -------------INRYKRQMI-LSEIGLTGQKQIHLAKVLIVGAGGIGAPAIYYLAGA-
I7M6E7_TETTS      -----DPLLTKDTIERYSRQML-LPEIKYKGQKLLQNSKVLIIGAGGIGAPAAYYISGM-
E3KQR1_PUCGT      -------SLPLDDYIRYGRQMI-VSQVGLTGQLKLKKASVLVIGAGGLGCPALLYLVRA-
E3L838_PUCGT      -------SLPLDDYIRYGRQMI-VSQVGLTGQLKLKKASVLVIGAGGLGCPALLYLVRA-
A8NT26_COPC7      -------SLPIEDYKRYGRQMI-LDGFGLPGQLKLSKASIAVVGAGGLGCAALPYLASA-
Q5KJ01_CRYNJ      -------PLDPDEYERYGRQMI-MPDFGLPGQVNLKNAKVAVVGAGGLGCPVLQYLAGA-
                                 *: *:::            :    :   * **:*..   ::    

UBA4_YEAST        GVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVTYPVRL---
UBA4_ASHGO        GIGHLGIVDNDVVEESNLHRQPLHDTSKVGLLKCDSAKEALSRLNPYCSIKTYPVRL---
UBA4_CANAL        GIGKIGIIDPDTVDTSNLHRQVIHNTEMVGEFKCISAQNYINKLNPHVVVEVYPTAL---
UBA4_SCHPO        GIGTLGIMDGDVVDKSNLHRQIIHSTSKQGMHKAISAKQFLEDLNPNVIINTYLEFA---
UBA4_YARLI        GIGHITIIDDDTVEESNLHRQTIHAGNVN-VPKSESAAEFVGKLNPCISVTPMVVRL---
UBA4_EMENI        GVGTIGLVDGDTVEASNLHRQVLHRSRNVGKLKVDSAIEYLRELNPHPTYIAHQAHL---
UBA4_ASPFU        GVGTLGLVDGDTVENSNLHRQVLHRSKNVGTFKVDSAIEYLRELNPHPTYVPYRAHL---
C0NQD0_AJECG      GVGTIGIIDGDTVEESNLHRQVLHRTRNVGKFKVDSAIRYLKELNPYPKYIPYRVNL---
Q0U1Y0_PHANO      GVGTLGLVDGDTVEESNLHRQILHSTARVGMSKVESAMVALSSLNPNVKLVPHVARL---
UBA4_SCLS1        GVGTIGIVDGDIVEESNLHRQILHSTDRVGVNKA--------------------------
C7Z6K1_NECH7      GIGVIGLVDGDEVEVSNLHRQIAHSTSRVGMSKVESAITYLRELNPTITYHAHKTHL---
Q7SEE2_NEUCR      GIGTIGIADGDTVERSNLHRQVGHSTSRIGQSKVSSLITHLRGLNPLPTYVAHTTHI---
D5GLT0_TUBMM      GVGTLGIIDHDTVENSNLHRQIIHSTSRVGMMKVVSAVTYLRDLNPHPNYVPHIEPL---
MOCS3_HUMAN       GVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQAL---
H2P2A9_PONAB      GVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQAL---
G1SC20_NOMLE      GVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQAL---
I3N396_ICTTR      GVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYAQAL---
H0XRE9_OTOGA      GVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYAQAL---
MOCS3_PIG         GVGRLGLVDYDVVEVSNLARQVLHGEALAGQAKVFSAAASLRRLNSAVECVPYAQAL---
H0VUB6_CAVPO      GVGRLGLVDYDVIELSNLARQVLHEEALAGQAKAFSAAASLRRLNSEVECVPYAQAL---
MOCS3_BOVIN       GVGRLGLVDYDVVEASNLARQVLHGEALAGQAKVFSAAAALRRLNSAVECVPYAQAL---
MOCS3_MOUSE       GVGRLGLVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYPRAL---
D4A8L5_RAT        GVGRLGLVDHDVVETSNLARQVLHGEAQAGHAKAWSAAAALRRLNSAVEYVPYARAL---
MOCS3_DANRE       GIGRLGLLDYDVVELSNLHRQVLHTELTQGQPKALSAAQAISRMNSTVQCVPYHLQL---
H3AHF7_LATCH      NTGRLGLLDYDEVEISNLHRQILHAEVRRGMSKSLSAATVLHQLNSSVEYIPYHLQL---
B7QFH8_IXOSC      GVGKIGLLDYDVVESSNLHRQILHSEAKLGMAKVDSLTVALRQLNSQPEYVRHNSVL---
MOCS3_ANOGA       GIGRIGVLDYDEVELTNLHRQLLHTEATVGLTKVTSVQSYLEQLNSQIEIETHHAQL---
W5JI26_ANODA      GIGRIGILDYDEVELTNLHRQLLHTEATVGLTKVASAQAALEQLNSQIEIVSHHTQL---
MOCS3_AEDAE       GIGRIGILDYDEVELTNLHRQLLHTECSVGLTKVESVRSYLEELNSQIEIVTHHIQL---
MOCS3_DROME       GCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHSRML---
M9PCK7_DROME      GCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHSRML---
MOC31_DROPS       GCGHLGLIDYDEVERSNLHRQILHSEHRCGMSKAESARIALLELNSHCQIRCHSRLI---
MOC32_DROPS       GCGHLGLIDYDEVERSNLHRQILHSEHRCGMSKAESARIALLELNSHCQIRCHSRLI---
MOCS3_CAEBR       GVGTLGIVDYDRISLDNLHRQVAYKEDQVGQSKSQGLADNVKLQNSGVTTVVHNVSL---
MOCS3_CAEEL       GIGTIGIVDYDHISLDNLHRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSL---
F6HES6_VITVI      GVGCIGTVDHDVVELNNLHRQIIHTEAYVGQPKVQSAAAACRSINSTIQIVEHKEAL---
B9GJ37_POPTR      GVGQLGVVDHDVVELNNMHRQVIHTEAYIGQPKVKSAAAACRLINSTIQIVEHQEAL---
MOCS3_ARATH       GVGQLGIIDHDVVELNNMHRQIIHTEAFIGHPKVKSAAAACRSINSTIKVDEYVEAL---
C5Z503_SORBI      GVGCLGIVDGDDVELNNLHRQIIHKEAYVGQSKVKSAADACREINSSIKVVEHHHTL---
C5Y081_SORBI      GVGCLGIVDGDDVELNNLHRQIIHKEAYVGQPKVKSAADACREINSSIKVVEHHHTL---
MOCS3_ORYSJ       GVGCLGIVDGDRVELDNLHRQIIHIEAYVGQPKVKSTAASCRA-----------------
A9TQW1_PHYPA      GVGCIGIMDPDRVELHNLHRQVIHNEASVGETKVSSASRTCLAINSSVKVVEYPFGL---
F4NU54_BATDJ      GVGNLGIVDYDFVEESNLQRQIIHSEASINTSKTDSAATAVRSISSLVQCTTYNTLI---
UBA4_DICDI        GIGTLGLVDYDTVEISNLHRQIGHRESSKGISKAVSLSKTISELNSLIKVNTYETTF---
F0Z915_DICPU      GVSVLGIVDYDTVEISNLHRQIGHQESSTGVPKAVSLANTIKSINSLVTVNTYETTF---
D3BLV1_POLPP      GVGTIGIVDYDTVEVGNLHRQIGHNELKEGHAKAVSLATACQQLNSSISVIPHTVTF---
G4V7Z6_SCHMA      GVGTIGLVDDDKVELNNLHRQVAHSESTINMLKVHSLADRCMELNSEVNIQAHEIHL---
E9ADE6_LEIMA      GVGRLTIVDFDDVELSNLHRQVIHTTAAIGQPKALSAKASCLRLFPAACIDAVVEAL---
A4I2V9_LEIIN      GVGRLTIVDFDDVELSNLHRQVIHTTAAIGQPKALSAKASCLRLFPAACVDAVVEAL---
A4HFU1_LEIBR      GVGRLTIIDFDDVELSNLQRQVIHTTAAVGQPKALSAKASCLRLFPGAHVDAVVEAL---
Q386S6_TRYB2      GVGELCIVDFDTVEHSNLHRQIIHNTMRVGMSKAESAVQSCLALNPRAKIRAITAPF---
V5B0X0_TRYCR      GVGELRIVDFDVVELSNLHRQVIHATDRIGWKKVDSAASACRALNPDTMVYPLDVAL---
B7FVV0_PHATC      GVGRIGIVDFDTVDISNLHRQVIHKTADIGMNKAVSACHAVRSLNPMCEVYSYETDL---
A0E677_PARTE      GVGTIGLVDGDSVDVSNLHRQIIHNNDRQGMNKCESAKKQINQFNPLVNVITYQHHL---
Q6BG38_PARTE      GVGTIGLVDGDSVDVSNLHRQIIHNNYRQGMNKCESAKLQINEFNPLVNVITYKHHL---
I7M6E7_TETTS      GVGTIGIIDHDNVEESNLHRQIIHNVERIGMNKALSAKLTIERFNHRVKVNTYQFQL---
E3KQR1_PUCGT      GVGNVSIVDHDTVELSNLHRQVLHTDSTVGLNKAESARINLLAGNPSVKITAYPMPFMMS
E3L838_PUCGT      GVGNVSIVDHDTVELSNLHRQVLHTDSTVGLNKAESARINLLAGNPSVKITAYPIPFMMS
A8NT26_COPC7      GVGRIGIFDHDIVEKSNLQRQILHNEDTLGAFKVDSAKQHTLL--PDINKTSRLNSAIQI
Q5KJ01_CRYNJ      GVGTIGIIDHDTVSMSNLHRQILHTTDRVGMNKAESACQALRALNNKINLIPHPVPI---
                  . . :   * * :.  *: **  :        *                           

UBA4_YEAST        ------------NSSNAFDIFKGYNYILDCTDSPLTRYLVSDVAVNLG-ITVVSASGLGT
UBA4_ASHGO        ------------SYANAFEIFPSWDLILDCTDSPMSRYLISDVAVNLG-KTVVSGSGLGT
UBA4_CANAL        ------------NNDNAFGIVSQYDLVLDCTDHPAVRYLINDVCVLLG-KTIVSGSGLKS
UBA4_SCHPO        ------------SASNLFSIIEQYDVVLDCTDNQYTRYLISDTCVLLG-RPLVSASALKL
UBA4_YARLI        ------------SPSNSFSVFEGHDLVLDCTDGPAVRYLINDTAVLSG-IPVVSASALKT
UBA4_EMENI        ------------TPREAPDIFKDYDLILDCTDNPATRYLISDTAVLLG-KPLVSASALRT
UBA4_ASPFU        ------------TPQEAPGIFKDYDIVLDCTDNPATRYLISDTAVLLG-KPLVSASALRT
C0NQD0_AJECG      ------------TPAHAPSIFSPYDLILDCTDNPATRYLISDTAVVLG-KPLVSASALRT
Q0U1Y0_PHANO      ------------TPETAISTFEKYDLVLDCTDTPASRYLISDTCVLLR-KRLISASALRI
UBA4_SCLS1        ------------------GIVKDYDIVLDCTDHPTSRYLISDICVLLQ-KPLVSASALRT
C7Z6K1_NECH7      ------------TPQNAQDIVSKYDLVLDCTDHPTSRYLISDICVLLS-KPLISASAFQT
Q7SEE2_NEUCR      ------------TPLNAADLISQYDLILDCTDNPATRYLISDVCVLLC-KPLVSAASVQT
D5GLT0_TUBMM      ------------TTENSLRIMAEYDLVLDCTDHPAIRYLINDVAVIMG-VPIVSASALRT
MOCS3_HUMAN       ------------TPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
H2P2A9_PONAB      ------------TPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
G1SC20_NOMLE      ------------TPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
I3N396_ICTTR      ------------TPATALDLVRQYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
H0XRE9_OTOGA      ------------TPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
MOCS3_PIG         ------------TPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
H0VUB6_CAVPO      ------------TPDTALDLVRRYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
MOCS3_BOVIN       ------------TPATALDLVRRYDVVADCSDNAPTRYLVSDACVLAG-RPLVSASALRF
MOCS3_MOUSE       ------------AEDWALDLVRGYDVVADCCDNVPTRYLVNDACVLAG-RPLVSASALRF
D4A8L5_RAT        ------------SEAWALDLVRGYDVVADCSDNVPTRYLVNDACVLAG-RPLVSASALRF
MOCS3_DANRE       ------------SRENAIQLIQQYDIVADCSDNVPTRYLVNDACVLTS-RPLVSASALRM
H3AHF7_LATCH      ------------NRENALDLIQLYDIIADCSDNVPTRYLVNDACVLSG-KPLVSASALRM
B7QFH8_IXOSC      ------------DSSNALQILRGYQVVVDASDNVATRYLVSDACVCLG-IPLVSGSALRW
MOCS3_ANOGA       ------------TSENALALLEPYDVVVDATDNVATRYLLNDACVLLR-KPLVSGSALQL
W5JI26_ANODA      ------------TSENALNLLAPYDVVVDATDNVATRYLLNDACVMLG-KPLVSGSALQL
MOCS3_AEDAE       ------------TSDNALQTLESYDIVVDATDNVATRYLLNDACVLLK-KPLVSGSALQL
MOCS3_DROME       ------------YPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLS-KPLVSGSALKM
M9PCK7_DROME      ------------YPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLS-KPLVSGSALKM
MOC31_DROPS       ------------NSMNAMHIIRPYDVVLDCSDNVATRYLLNDACVMLR-KPLVSGSALKM
MOC32_DROPS       ------------NSMNAMHIIRPYDVVLDCSDNVATRYLLNDACVMLR-KPLVSGSALKM
MOCS3_CAEBR       ------------DSSNAMEIFKNYDIVCDCTDNVATRYLINDVCVLLN-IPLVSGSALRW
MOCS3_CAEEL       ------------DSSNAMQLFKNYEIVCDCTDNVATRYLINDVCVLLN-IPLVSGSALRW
F6HES6_VITVI      ------------CTSNALEILSKYDLVIDATDNVPSRYMISDCCVVLG-KPLVSGAALGL
B9GJ37_POPTR      ------------RTSNALEILSQYDIIVDATDNAPSRYMISDCCVVLG-KPLVSGAALGL
MOCS3_ARATH       ------------RTSNALEILSQYDIIVDATDNPPSRYMISDCCVLLG-KPLVSGAALGM
C5Z503_SORBI      ------------KPCNALEVVRKYDIVVDATDNLPTRYMISDCCVLLS-KPLVSGAALGL
C5Y081_SORBI      ------------KPCNALEIVRKYDIVVDATDNLPTRYMISDCCVLLN-KPLVSGAALGL
MOCS3_ORYSJ       -----------------------YDIVVDATNNLPSRYMISDCCVLMN-KPLISGSAVGL
A9TQW1_PHYPA      ------------DARNALDIMAQYDVVVDASDNVATRYLVSDACVVAN-KPLVSGAALGM
F4NU54_BATDJ      ------------DQSNVLEIVSGYDVVVDGSDNVATRYLLNDACVLLG-KPLVSGSALRM
UBA4_DICDI        ------------TSETAMEIIKNYDIVVDASDNVATRYLVNDACVLTG-KPLVSGSALKW
F0Z915_DICPU      ------------TSETAMDIIKNYDIVVDASDNVATRYLINDACVLSK-KPLVSGSALKW
D3BLV1_POLPP      ------------TSDTALDLIARYDIVVDASDNVATRYLINDASVLAN-KILVSGSALKW
G4V7Z6_SCHMA      ------------DHMNAVGIIKTYDVVVDCSDNLATRYLINEACAVTGPKPLVSGSALRL
E9ADE6_LEIMA      ------------SPANAERLFATCDVVVDGTDNVAARYLINDAAMRCG-KPLVSGSAMGW
A4I2V9_LEIIN      ------------SPENAERLFATCDVVVDGTDNVAARYLINDAAMRCG-KPLVSGSAMGW
A4HFU1_LEIBR      ------------TPSNAERLLATCDVVVDGTDNVAARYLINDAAMRCG-KPLVSGSAIGW
Q386S6_TRYB2      ------------TPANAEELVRGCDVVVDGSDNVATRYLINDAAARYR-RPLVSGSALRW
V5B0X0_TRYCR      ------------DPFNAEDLVRDCDVVVDGTDNVAARYLINDAAVRHE-KPVVSGSAMRW
B7FVV0_PHATC      ------------NHGNALPLVQNFDCVVDCSDNPKTRYLVNDACVLAE-KPLISASAIGT
A0E677_PARTE      ------------SSENAIDIFKNYDLILDATDNPATRYLINDTAIYLN-KPLVSGSSVGW
Q6BG38_PARTE      ------------SSANAIEIFQNYDVILDATDNPATRYLINDTAIYLN-KPLVSGSSVGW
I7M6E7_TETTS      ------------TPENAQDIFSQYDIILDASDNPKTRYLVSDASVLAK-KPLVSGSAIGW
E3KQR1_PUCGT      RMSNPSKEKVDDSTPNLLPDISQFSLVLDCTDNPASRYLISDACAAYG-IPLVSGAAIRT
E3L838_PUCGT      RMSNPSKEKVDDSTPNLLPDISQFSLVLDCTDNPASRYLISDACAAYG-IPLVSGAAIRT
A8NT26_COPC7      DTTTESI-----TSQNAPSLLAPYDIILDCTDNVPTRYLLSDTAVALN-KPLVSGAAQKF
Q5KJ01_CRYNJ      ------------TPATALDILRPYSMILDCTDRPLTRYLLSDAAVRLD-VPLVSGAAISS
                                          . : *  :    **::.: .       ::*.:.   

UBA4_YEAST        EGQLTILNFNNI-------------------GPCYRCFYPTPPPPNAVTSCQEGGVIGPC
UBA4_ASHGO        EGQLSIYNFENK-------------------GPCYRCFYPIPPRPGSVVSCQSGGVLGPC
UBA4_CANAL        DGQLTVLNFANS-------------------GPCYRCFYPQPPSPDSVTSCSDGGVIGPA
UBA4_SCHPO        EGQLCIYNYCN--------------------GPCYRCMFPNPTPV--VASCAKSGILGPV
UBA4_YARLI        EGQLSIYNYNG--------------------GPCYRCLFPIPPPADAVQTCGDGGIMGPV
UBA4_EMENI        EGQLMVLNNPPQ---------PPGDKTGG---PCYRCVFPKPPPANSVTSCADGGILGPV
UBA4_ASPFU        EGQLMVLNYPPR---------PVGDKSGG---PCYRCVFPKPPPANSVVSCADGGILGPV
C0NQD0_AJECG      EGQLMVLNYPPQKPVDQLSALPTETTTGG---PCYRCVFPKPPPAASVTSCADGGILGPV
Q0U1Y0_PHANO      DGQLMVLNNPPS---------APGDPSGG---PCYRCVFPKPPPPESVVSCGEGGILGPV
UBA4_SCLS1        DGQLIVLNNPAL---------PPGDLSGG---SCYRCVFPKPPPPEAVTSCGDGGIIGPV
C7Z6K1_NECH7      SGQLIVLNNP------------PG---QG---PCYRCVFPTPPPPESVVGCGEGGIIGPV
Q7SEE2_NEUCR      SGQIIVLNCPPT---------PQGQLDGGPYPPCYRCCFKKPPPANAQLSCGEAGILGPV
D5GLT0_TUBMM      DGQLVVLNNPPG---------------VG---PCYRCIWPRPPPAESVVGCGEGGILGPV
MOCS3_HUMAN       EGQITVYHYDGG--------------------PCYRCIFPQPPPAETVTNCADGGVLGVV
H2P2A9_PONAB      EGQITVYHYDGG--------------------PCYRCIFPQPPPAETVTNCADGGVLGVV
G1SC20_NOMLE      EGQITVYHYDGG--------------------PCYRCIFPQPPPAETVTNCADGGVLGVV
I3N396_ICTTR      EGQITVYHYDGG--------------------PCYRCVFPQPPPAETVTNCADGGVLGVV
H0XRE9_OTOGA      EGQITVYHYDGG--------------------PCYRCVFPQPPPAETVTNCADGGVLGVV
MOCS3_PIG         EGQITVYHYGGG--------------------PCYRCVFPQPPPAETVTNCADGGVLGVV
H0VUB6_CAVPO      EGQITVYHYDDG--------------------PCYRCIFPQPPPAETVTNCADGGVLGVV
MOCS3_BOVIN       EGQLTVYHYGGG--------------------PCYRCVFPRPPPAETVTSCADGGVLGAV
MOCS3_MOUSE       EGQMTVYHHDGG--------------------PCYRCVFPRPPPPETVTNCADGGVLGAV
D4A8L5_RAT        EGQMTVYHYDDG--------------------PCYRCVFPRPPPAETVTNCADGGVLGVV
MOCS3_DANRE       EGQLTVYNYRGG--------------------PCYRCLYPIPPPPETVTNCSDGGVLGVV
H3AHF7_LATCH      EGQLTVYNYNGG--------------------PCYRCLYPKPPPPETVTNCADGGVLGIV
B7QFH8_IXOSC      EGQLCVYNFNGG--------------------PCYRCLFPQPPPRATVDNCSDGGVLGMV
MOCS3_ANOGA       EGQLTVYNYRGG--------------------PCYRCLFPTPPPPESVTNCGDGGVLGAI
W5JI26_ANODA      EGQLTVYNHRGG--------------------PCYRCLYPTPPPPAAVTNCGDGGVLGAI
MOCS3_AEDAE       EGQLTVYNFNGG--------------------PCYRCLFPNPPPPETVTNCGDGGVLGAI
MOCS3_DROME       DGQLTVYNYANG--------------------PCYRCIFPVPPPPEAVTNCGDGGVLGAV
M9PCK7_DROME      DGQLTVYNYANG--------------------PCYRCIFPVPPPPEAVTNCGDGGVLGAV
MOC31_DROPS       DGQLTVYGYGQG--------------------PCYRCIYPVPPPPEAVTNCGDGGVLGAV
MOC32_DROPS       DGQLTVYGYGQG--------------------PCYRCIYPVPPPPEAVTNCGDGGVLGAV
MOCS3_CAEBR       DGQLSVYHYGPDC-------------------PCYRCLFPSPPDPSSVTNCNEGGVLGPI
MOCS3_CAEEL       DGQLSVYHYGSDC-------------------PCYRCLFPSPPDPNSVTNCNEGGVLGPI
F6HES6_VITVI      EGQLTVYNYKGG--------------------PCYRCLFPTPPPTTACQRCSDSGVLGVV
B9GJ37_POPTR      EGQLTVYNHNRG--------------------PCYRCLFPTPPPTTACQRCADSGVLGVV
MOCS3_ARATH       EGQLTVYNHNGG--------------------PCYRCLFPTPPPTSACQRCSDSGVLGVV
C5Z503_SORBI      EGQLTVYHHNGS--------------------PCYRCLFPSPPPVAACQRCSDSGVLGVV
C5Y081_SORBI      EGQLTVYHHNGS--------------------PCYRCLFPSPPPVAACQRCSDSGVLGVV
MOCS3_ORYSJ       EGQLTVYHHNGS--------------------PCYRCLYPNPPSSPTSQSCSDNGILGIL
A9TQW1_PHYPA      EGQLTVYNYLKG--------------------PCYRCLFPTPSPQAACQRCSDAGVLGVV
F4NU54_BATDJ      DGQLTVYNHQGG--------------------PCYRCIFPVPPPPETVSNCNDGGVLGVV
UBA4_DICDI        EGQITCYNYNN--------------------GPCYRCIFPTPPPVETVTKCSDGGVLGPI
F0Z915_DICPU      EGQVTVYNYEN--------------------GPCYRCIFPTPPPVDTVTKCSDGGVLGPI
D3BLV1_POLPP      DGQVTVYHYNN--------------------GPCYRCLFPVPPPAETVTRCSDGGVLGPI
G4V7Z6_SCHMA      EGQMTVYLTKRILSSEEVLS--SSNPPAEYRAPCFRCLYPVPPPASSVQGCSEAGVFGVV
E9ADE6_LEIMA      EGQLSVYGYR--------------------GGPCYRCLFPQPPPQETVGSCNDSGVMGPL
A4I2V9_LEIIN      EGQLSVYGYR--------------------GGPCYRCLFPQPPPQETVGSCNDSGVMGPL
A4HFU1_LEIBR      DGQLSVYGYR--------------------GGPCYRCLFPQPPPPEAVGSCNDSGVMGPL
Q386S6_TRYB2      EGQLSVYCGGL-------------------SCPCYRCLFPTPPPASAVGSCNDTGVVGPV
V5B0X0_TRYCR      DGQLSVYGYD--------------------GGPCLRCLFPVPPPREAVGSCNDTGVMGPV
B7FVV0_PHATC      EGQVTVYNFQ--------------------GAPCYRCLYPTPNAAGGCRTCVDAGVLGPV
A0E677_PARTE      EGQITVYGMQ---------------------GPCYRCLFPQCPK--TVQNCNEAGVFGVM
Q6BG38_PARTE      EGQITVYGMQ---------------------GPCYRCLFPQCPK--TVQNCNEAGVFGVM
I7M6E7_TETTS      EGQLTVFNYKN--------------------GPCYRCLYPECPKAGSVKSCGEAGVVGMI
E3KQR1_PUCGT      EGQLAVWNLPPPSDS------------SHDRGPCYRCIFPETDQ-IRVERCADEGVLGPA
E3L838_PUCGT      EGQLAVWNLPHPSDS------------SHDRGPCYRCIFPETDQ-IRVERCADEGVLGPA
A8NT26_COPC7      DGQLSVFNLGPNS-------------------PCYRCVFPVPPKPANAGSCEELGILGPV
Q5KJ01_CRYNJ      AGQWAVYGGKTKSG---------------KRRACYRCIWPSILP-GSVGTCEEQGVWGVV
                   **                             .* ** :           * . *: *  

UBA4_YEAST        IGLVGTMMAVETLKL----ILGIYTN-------------------ENFSPFLMLYSGFPQ
UBA4_ASHGO        IGVLGIMMAVEALKI----LFGIYTL-------------------ENFKPFLMQYSGFPY
UBA4_CANAL        IGLVGVAMAVETIKI----ITGYYTK-------------------DNFVPFLASYSAYPQ
UBA4_SCHPO        VGTMGTMQALETVKLILH-INGIKK--------------------DQFDPYMLLFHAFKV
UBA4_YARLI        VGMMGMSQAMEAIKL----LTGVYS--------------------ESFTPFLMLYSAYNF
UBA4_EMENI        VGTMGVLQASEAIKV----LTSA-------GESVEAT-----------PPSLLIFSAYSS
UBA4_ASPFU        VGTMGVLQALEAIKV----ITSP-------AVNPSAS-----------PPSLLIFSAYST
C0NQD0_AJECG      VGVMGVLQALEAIRV----LTQT-------TSATSTTM----------SPTLHLFSAFSS
Q0U1Y0_PHANO      VGVMGVLQALEAIKV----LTQQ-------PSRGATID----------PPTLLIFSAYSQ
UBA4_SCLS1        VGVMGVLQALEAIKL----IASG-------KLAAVGENDNTSPTPKMNPTTMLLFSTNGS
C7Z6K1_NECH7      VGVMGVLQALEVIKL----ITRG-------DLEIQ----EREP----KTPMLLLFSALAD
Q7SEE2_NEUCR      VGLMGVAQAGEAIKI----LASALHIPTTTTTTTSPPAQGVPRAAPVVEPTLLLYSYSLT
D5GLT0_TUBMM      VGLMGVMQAIEAIKI----ITKN-------PVRDIGR------------TEMTLFAAYGA
MOCS3_HUMAN       TGVLGCLQALEVLKIAAG--LGP-----------------------SYSGSLLLFDALRG
H2P2A9_PONAB      TGVLGCLQALEVLKIAAG--LGP-----------------------SYSGSLLLFDALRG
G1SC20_NOMLE      TGVLGCLQALEVLKIAAG--LGP-----------------------SYSGSLLLFDALRG
I3N396_ICTTR      TGVLGCLQALEVLKIAAG--LGP-----------------------SYSGSLLLFDALGG
H0XRE9_OTOGA      TGVLGCLQALEVLKIAAG--LGP-----------------------SYSGRMLLFDALRG
MOCS3_PIG         TGVLGCLQALEVLKIAAG--LGP-----------------------SYSGSLLLFDALRG
H0VUB6_CAVPO      TGVVGCLQALEVLKIAAG--LGP-----------------------SYSGSLLLFDALRG
MOCS3_BOVIN       TGVLGCLQALEVLKTAAG--LGP-----------------------SYSGRLLLFDALRG
MOCS3_MOUSE       PGVLGCAQALEVLKIAAG--LGS-----------------------SYSGSMLLFDGLGG
D4A8L5_RAT        PGVLGCVQALEVLKIAAG--LGT-----------------------TYSGSMLLFDGLGG
MOCS3_DANRE       PGIMGCLQALEVLKIASG--QEC-----------------------SFAQQLLMFDGEQT
H3AHF7_LATCH      PGIMGSLQALEVLKIASGIGLQT-----------------------SYSQQMLMFDAVES
B7QFH8_IXOSC      PGIIGSLQALEVVKILTG--CGD-----------------------VCSGRLLLLDGSAG
MOCS3_ANOGA       TGVIGALQALETIKIILS--NEG-----------------------VLAGRLLLFDGQQS
W5JI26_ANODA      TGVIGALQALETIKIVLA--NDG-----------------------VLSGRLLLFDGQQS
MOCS3_AEDAE       TGVIGALQALETIKIILG--NSG-----------------------VLSGRLLLFDGHQS
MOCS3_DROME       TGTIGAMQALEAIKVIVG--MGD-----------------------VLAGRLLIFDGGSG
M9PCK7_DROME      TGTIGAMQALEAIKVIVG--MGD-----------------------VLAGRLLIFDGGSG
MOC31_DROPS       TGIIGAMQALEAIKLIIG--LGD-----------------------VMSGRLLIFDGSSF
MOC32_DROPS       TGIIGAMQALEAIKVIIG--LGD-----------------------VMSGRLLIFDGSSF
MOCS3_CAEBR       VGTIGSMQALEVMKIAAK--LST-----------------------TLAGKLLLFDGREG
MOCS3_CAEEL       VGVIGSMQALEVMKIAAK--VRT-----------------------TLAGQLLLFDGREG
F6HES6_VITVI      PGIIGCLQALEAIKIASA--VGE-----------------------PLSGRMLLFDALSA
B9GJ37_POPTR      PGIIGCLQALEAIKIASA--VGE-----------------------PLSERMLLFDALSA
MOCS3_ARATH       PGVIGCLQALETIKLASL--VGE-----------------------PLSERMLLFDALSA
C5Z503_SORBI      PGVIGCLQALEAIKIATG--VGE-----------------------PLCGRMLLFDALSA
C5Y081_SORBI      PGVIGCLQALEAIKVATG--VGE-----------------------PLCGRMLLFDALSA
MOCS3_ORYSJ       PGVIGCLQALEAIKVATA--VGK-----------------------PLCGRMLHFDALSS
A9TQW1_PHYPA      PGIVGTFQALEVIKVLTK--VGE-----------------------PLSARMLILDALSS
F4NU54_BATDJ      PGIIGCMQALEVIKLISG--IQT-----------------------SYSQKMLLLDAVSG
UBA4_DICDI        VGVIGSLQALEVIKILTN-NKEG-----------------------VLSGRLLIYDGMSA
F0Z915_DICPU      VGVIGSLQALETIKIITN-NKEG-----------------------VLSGRLLIYDGMSA
D3BLV1_POLPP      VGVIGSLQALEVIKIITN-NSDG-----------------------VLSGRLMLYDGLAG
G4V7Z6_SCHMA      PGIIGTMQAAEVIKILTG-VGD------------------------VHTGRLFLLDVERN
E9ADE6_LEIMA      PGMIGCLQALEVLKVATG--VGE-----------------------TLNGRLFLFNGLRF
A4I2V9_LEIIN      PGMIGCLQALEVLKVATG--VGE-----------------------TLNGRLFLFNGLRF
A4HFU1_LEIBR      PGMIGCLQALEVLKVATG--VGE-----------------------TLSGRLFLFNGLQF
Q386S6_TRYB2      PGCIGCLQATEALKLLAG--AGD-----------------------VLEGRLLLLDALRM
V5B0X0_TRYCR      PGFIGCLQAMEVLKVLAK--AGD-----------------------VLSGRMLIFDGLCF
B7FVV0_PHATC      PGLVGILQATETLKVLTG--SGT-----------------------TMKGHLLMYNAMDC
A0E677_PARTE      PGLIGLIEALQAVKIII---GQQ-----------------------TLSQKMILIDGIRD
Q6BG38_PARTE      PGLIGLIEALQAIKIII---GQQ-----------------------TLSQKMILIDGLRD
I7M6E7_TETTS      PGIIGLLEAVECMKILIEAPQAK-----------------------VLSQRMIIFDGYEG
E3KQR1_PUCGT      VGVVGVLMAWEAIRLLIGIHDLTP-------------------------------KLLLV
E3L838_PUCGT      VGVVGVLMAWEAIRLLIGIHDLTP-------------------------------KLLLV
A8NT26_COPC7      VGTIGNLQAVETIKVLTGLADPSAP------------------------PTMLLYNALSS
Q5KJ01_CRYNJ      TGMVGVGMAGEAIKLIVGKEDPDP--------------------------LLHLHHLGSN
                   * :*   * : ::                                              

UBA4_YEAST        Q-----SLRTFKMRGRQEKCLCCG-KNR--TITKEAIEKGEINYELFCG--------ARN
UBA4_ASHGO        Q-----TLRMFKMRNRKQGCLCCG-DNP--TITKSTIESGHIKYEAFCG--------AIN
UBA4_CANAL        Q-----QLRVFKMRKRQKDCAVCG-ENP--QISQRMIEDGTINYKTFCG--------RAT
UBA4_SCHPO        P-----QWKHIRIRPRQQSCKACG-PNK--MLSREFMESSPKEYTTICDY--V----PTL
UBA4_YARLI        P-----PWKSVKVRKRQKTCAACG-DVP--RISRQLIETGQVDYSEFCG--------SPS
UBA4_EMENI        P-----QFRTIKLRSRRPNCAVCS-AEA--TVTLESVRSGSMDYVFFCG---T----VDP
UBA4_ASPFU        P-----LFRTIRLRARRANCAVCS-ADA--SVTLETLKNGSTDYVFFCG---V----AGL
C0NQD0_AJECG      P-----PFRSIRLRQRRQDCAACS-PTAR-TITLDSLRSGSMDYVQFCGG--V----VGA
Q0U1Y0_PHANO      P-----MFRSIRLRSRKPKCAACS-SQS--TISAEALQSGSLDYVQFCG---S----VNP
UBA4_SCLS1        T-----PFRNVRLKGRRSNCFACG-EEA--QLALEQMSSGSMDYVLFCG---M----THP
C7Z6K1_NECH7      T-----PFRSVRMRGRRKTCFACG-DEN--ALTLNELRT-SMDYVQFCG---V----MKP
Q7SEE2_NEUCR      SFLSPFTFRALKMAPRKKNCFACG-EGSKQRLTLEGVKNGEPNYDFFCGLGGG----GPE
D5GLT0_TUBMM      S-----PFRSLKMRGRKEGCVSCGSPERAEKITRESIEDGRMDYVAFCG---G----RVG
MOCS3_HUMAN       H------FRSIRLRSRRLDCAACGE-----RPTVTDL----LDYEAFCGSSAT--DKCRS
H2P2A9_PONAB      H------FRSIRLRSRRLDCAACGE-----RPTVTDL----LDYEAFCGSSAT--DKCRS
G1SC20_NOMLE      H------FRCIRLRSRRLDCAACGE-----RPTVTDL----LDYEAFCGSSAT--DKCRS
I3N396_ICTTR      H------FRCIRLRRRRPDCAACGE-----RPTVTDL----QDYEAFCGSSAT--DKCRS
H0XRE9_OTOGA      H------FRCIQLRIRRPDCAACGE-----RPTVTDL----QDYEAFCGSSAT--DKCRS
MOCS3_PIG         L------FRRIQLRRRRPDCAACGE-----RPTVTEL----QDYEGFCGSSAT--DKCRS
H0VUB6_CAVPO      H------FRSIQLRKRRSDCAACGE-----RPTVADL----QDYEAFCGSSAT--DKCRS
MOCS3_BOVIN       D------FRCIRLRRRRPDCAACGE-----RPTVTDL----QDYESFCGSSAT--DKCRS
MOCS3_MOUSE       H------FRRIRLRRRRPDCVVCGQ-----QPTVTRL----QDYEAFCGSSAT--DKCRA
D4A8L5_RAT        H------FRRIRLRRRRPDCVVCGQ-----QPTVTCL----KNYEAFCGSSAT--DKCRS
MOCS3_DANRE       R------FRSIRLRSRQKECVVCGE-----KPTITEL----QDYEHFCGSAAT--DKCRR
H3AHF7_LATCH      R------FRTIKLRPKQADCAVCGE-----NPTVKEL----LDYEAFCGSAAT--DKCRT
B7QFH8_IXOSC      V------VRRVALRGRSANCEACRN-----PSSAPLQ----MDYAAWCGSGPT--DKACS
MOCS3_ANOGA       A------FRNLKLRPKKPTCAVCSE-----APTLTKL----IDYEQFCGMRAT--DKDAA
W5JI26_ANODA      A------FRNLKLRPRKPGCAVCSE-----NPTLTQL----IDYEQFCGMKAT--DKDSA
MOCS3_AEDAE       T------FRNLKLRPKKADCAVCSD-----NPSLTKL----IDYEQFCSMKAT--DKDSH
MOCS3_DROME       V------FRNIRIRSKRPNCHMCSA-----QPLITEL----INYEMFCGMHAT--DKNNP
M9PCK7_DROME      V------FRNIRIRSKRPNCHMCSA-----QPLITEL----INYEMFCGMHAT--DKNNP
MOC31_DROPS       M------FRNIRIRTKRPNCHVCSA-----QPLITEL----IDYEMFCGMHAT--DKDNP
MOC32_DROPS       M------FRNIRIRTKRPNCHVCSA-----QPLITEL----IDYEMFCGMHAT--DKDNP
MOCS3_CAEBR       K------SRTIRLRKRDPKCAVCGD-----EPSITAP----IDYMLFCGAGAH--DKIEN
MOCS3_CAEEL       K------SRTIRLRKRDPKCEVCGD-----NPTITAP----IDYVLFCGAGAH--DKIEN
F6HES6_VITVI      R------IRIVKIRGRLSQCEVCGE-----NATFTQQKFQDFDYEKFTRSPLS--TTPLK
B9GJ37_POPTR      R------IRIVKIRGRSLQCEVCGE-----NSAFTQQQFKDFDYEKFTQSPLS--AAPLM
MOCS3_ARATH       R------MRIVKIRGRSSQCTVCGD-----NSSFNKQTFKDFDYEDFTQFPLF--AGP--
C5Z503_SORBI      R------VRIVKIRGSSPDCTHCGK-----NSVFTEQDFQKFDYENFTQSPMS-DKAAPS
C5Y081_SORBI      R------IRIVKLRGSSPDCTHCGK-----NSLFTEQDFQKFDYENFTQSPMS-DKAAPS
MOCS3_ORYSJ       H------TRIVKISRSSPTCKVCGE-----NPVFTKEDFVNFDYESFTQSPMSKNSTTRS
A9TQW1_PHYPA      R------IHTVKLRGKNTQCVACGE-----LPQITHITLPNFDYEKFAASPMS-DGTPPR
F4NU54_BATDJ      S------FRTVKLRGKSSTCAVCGP-----NPTITKP----IDYVQFCGASPH--DKALN
UBA4_DICDI        V------FRTVRIRGKQSGCNVCGD-----KPTVTQL----IDYTQFCQSNYS--ESAGK
F0Z915_DICPU      V------FRTVRIRGRQPHCSVCGD-----NPTVTQL----IDYTEFCRSNYS--EAAGK
D3BLV1_POLPP      T------FKTVKIRSRQPGCVVCGD-----NPTLTEL----IDYPQFCSSPYS--DKSSK
G4V7Z6_SCHMA      L------TRSVKLREPRPDCPVCGNDAMK-NSVDRPL----TNYVLFCGTPSC--DKPRN
E9ADE6_LEIMA      S------SRVVKLRGRQPHCAACSAAALA-DVTPLPQLAAQARPEYVPYSCPITSASS--
A4I2V9_LEIIN      S------SRVVKLRGRQPHCVACSAAALA-DATPLPQLAAQARPEYVPYSCPITSVPS--
A4HFU1_LEIBR      T------SRVVKLRGRQPRCVACSATALA-DATPLADLAILARPEYVPKSCAAAYTSS--
Q386S6_TRYB2      Q------LRVVRLRGRQKDCPACGEAAKL-NVGKSLQQLAAERPEYVMPSCASGALRSAN
V5B0X0_TRYCR      H------MRVVNLRGRQKTCLVCGDAS---DKSRGLHELVAERPEYIAVPCVSGSALSAQ
B7FVV0_PHATC      S------FLKIVKPPKQTKCRVCGPDA-----TILSMEASNASLLHAQGPMQTIDRPS--
A0E677_PARTE      V------YKVVKLRGQQKDCIAC---------QKQIK-INEYDYASFAQTICS------T
Q6BG38_PARTE      V------YKVVKLRGQQKDCIAC---------QKQIK-INDYDYASFAQTICS------S
I7M6E7_TETTS      T------FKAFRIRGPQKNCISCGE-------NKTIKFVKDYDYDNFVGASCQ------A
E3KQR1_PUCGT      P-----SFRSIKLRKAKKDCLGC-SAPSK-TAFLERIRVQPSGSHGEASSEVDTLSNACS
E3L838_PUCGT      P-----SFRSIKLRKAKKDCLGC-SAPSK-TAFLERIRVQPSGSHGEAGSEVDTLSKACS
A8NT26_COPC7      P-----PFRTIKLRSRRESCPACGSKGDK-TKIAETDYVQFCG-----GSKPDWETLGLK
Q5KJ01_CRYNJ      P-----LIRTIRIKPPSAKCITCGPNATI-TDDLDVFGYESFC----AGGPETNDETGLV
                            .        *  *                                     

UBA4_YEAST        YNVCEPDERISVDAFQRIYKDDEF-------LAKHIFLDVRPSHHYEISHF--PEAVNIP
UBA4_ASHGO        YDVLSKDERLSASEFEANYWS-QK-------ERGFVCLDVRPRLHYEISHL--PGTYNMT
UBA4_CANAL        FDPIDDKFRVSPKDYDSVVQN----------KKKHILIDVRPREQFQITHL--PNAINVQ
UBA4_SCHPO        SKQLAPIRRISALDLKNLIET----------SPHITFLDVREPVQFGICRL--PLFKNIP
UBA4_YARLI        QVLLGEEHRITPEEYSKIVST----------KH--ILLDVRERPQFDITSF--PRSINIP
UBA4_EMENI        ADILSPEERISPSEYGNVDSAGAQRH----------IIDVREKVQFDICSL--ENSINIP
UBA4_ASPFU        EATLSPEERISPLEFKKRHPKEVPQDGGRI-NKEPTIIDVREKVQFDICSL--ENSINIP
C0NQD0_AJECG      QALLGAEERISAREYWRRYQERWGEEGE---GESPILIDVREAVQYGLGAL--KGSVNIP
Q0U1Y0_PHANO      VTALTPQERISPENYSKLRSGVNPFTGTVSSKDNHILIDTRERVQFELANI--DGSVNIP
UBA4_SCLS1        VKLLSDEERIEARDYDSIRKEK-----------EHLLIDVREKVQFDICNI--EGSYNIP
C7Z6K1_NECH7      VELLQPQERISAKEYQEVAKAEK---------EEHLLLDVREKEHFDLCNI--AGSVNIP
Q7SEE2_NEUCR      KGVLSEEERITPREFVERVQGKDGNGKG----KKYVVLDTREKEHFSFGSI--EGAVNLP
D5GLT0_TUBMM      VQVLHEGERVSVAEYQEVVDSGV----------DHLLLDVRDETQFGICQL--AGSLNIP
MOCS3_HUMAN       LQLLSPEERV-SVTDYKRLLDSG---------AFHLLLDVRPQVEVDICRL--PHALHIP
H2P2A9_PONAB      LQLLSPEERV-SVTDYKRLLDSG---------AFHLLLDVRPQVEVDICRL--PHALHIP
G1SC20_NOMLE      LQLLSPEERV-SVTDYKQLMDSG---------ASHLLLDVRPQVEVDICRL--PHALHIP
I3N396_ICTTR      LRVLSPEERV-SVTDYKRLLDSG---------APHLLLDVRPKVEVDICHL--PHALHIP
H0XRE9_OTOGA      LQLLSSEERV-SVTDYKRLLDSG---------APHLLLDVRPQVEVDICCL--PHALHIP
MOCS3_PIG         LQLLSPEERV-SVIDYKRLLDSG---------SPHLLLDVRPQVEVDICRL--PHALHIP
H0VUB6_CAVPO      LQLLSPEERI-SVTDYKRLLDSG---------APHVLLDVRPQVEVDICRL--PHALHIP
MOCS3_BOVIN       LRLLSPEERI-SIMDYKRLLDSR---------SPHLLLDVRPQVEVDICRL--PHALHIP
MOCS3_MOUSE       LKLLCPEERI-SVTDYKRLLDSG---------APHVLLDVRPQVEVDICRL--PHSLHIP
D4A8L5_RAT        LKLLSPEERI-SVTDYKRLLDSG---------VPHVLLDVRPQVEVDICRL--QHSLHIP
MOCS3_DANRE       LHLLSREQRV-SVQDYKGILDHS---------TPHLLLDVRPKVEVDICRL--SNSLHIP
H3AHF7_LATCH      LHLLTSEQRI-SVTEYKRILDNQ---------VPHVLVDVRSQMEVDICHLPHSDATDIP
B7QFH8_IXOSC      ISVLPQEQRI-SCKELKERLSDE---------SPPVVVDVRPEVQFEMCHI--PGSTNVP
MOCS3_ANOGA       LTLLEPCERI-SVRDYHDGWLAAG--------RDHLLVDVRNANQYEMCQL---PGAPVN
W5JI26_ANODA      LTLLAPEERI-SVREYHDEWLMAG--------RKHLLIDVRSASQYEMCQL---PGSPIN
MOCS3_AEDAE       LNLLAPHERI-TVQEYKS-LAESN--------VPHLLVDVRGANQFEICQL---PAS-IN
MOCS3_DROME       MLLLSTDERL-SVEDYQQKIQAQ----------PHLLIDVRPTAEFEICQL---PEA-VN
M9PCK7_DROME      MLLLSTDERL-SVEDYQQKIQAQ----------PHLLIDVRPTAEFEICQL---PEA-VN
MOC31_DROPS       LDLLEPDQRL-EVKEYHQKLQSQ----------PHLLLDVRPPAEFEICQL---PRS-IN
MOC32_DROPS       LDLLEPDQRL-EVKEYHQKLQSQ----------PHLLLDVRPPAEFEICQL---PRS-IN
MOCS3_CAEBR       LKLLEPSVRV-NVHEYQEIRSAA---------RKQFLLDTRPPVEFEIAHL---PEA-ID
MOCS3_CAEEL       LKLLELSDRV-NVTEYRNKRRE----------QKPVLLDTRPSLEFEIAHL---PEA-IN
F6HES6_VITVI      LNLLPADSRI-TSKEYNDRLVNG---------EAHVLVDVRPSHHFNIVSL--PKSLNIP
B9GJ37_POPTR      LNLLPEDHRI-HSRELKERIVKG---------EAHVLVDVRPAHHFKIVSL--PNAMNIP
MOCS3_ARATH       LNLLPAESRI-SSKEFKEILQKK---------EQHVLLDVRPSHHYKIVSL--PDSLNIP
C5Z503_SORBI      VNLLPESARI-TCRDYKKLVDNG---------EPHLLLDVRPAHHFQIASI--SPSLNIP
C5Y081_SORBI      VNLLPESARI-TCRDYKKLVDNS---------EPHLLLDVRPAHHFQIASI--SPSLNIP
MOCS3_ORYSJ       LNLLPENARV-SCRDYKKVLDSG---------RPHLLVDVRPSHHFQIASM--AHSINVP
A9TQW1_PHYPA      EQVVGEDQSI-TCTDYNKLVRGH---------KSHVLVDVREKHQYDIASL--PDSLNIP
F4NU54_BATDJ      LDVACPKDRI-SVKDYQNVMMAG---------KPHILLDVREKVQFDICSL--PQSHNVS
UBA4_DICDI        VDDRVDKTLIITVEQFNQSIKNNN--------NNHLLIDVRPKIQFDICSLP--NSNNIP
F0Z915_DICPU      VDDRVEHHNIITVQQYNEVIKSNK--------N-HLLIDVRPSNQFEICSLP--NSENIP
D3BLV1_POLPP      VDDRIEDELIMTCKQYKSILDTNK--------K-HILLDVRPKNQFEICSLP--NSTNIP
G4V7Z6_SCHMA      MNMRIDNHRI-TVQQLKGYIDSQL--------P-YLLIDVRPKTEFDICHLK--SSMHIP
E9ADE6_LEIMA      --PPGTSCSASEYAAHARGSAAA---------QRRVTLDVRVRLQYDMAHL--AHSVNVP
A4I2V9_LEIIN      --PPGTSCSASEYAAHARGSAAA---------QRRVTLDVRVRLQYDMAHL--AHSVNVP
A4HFU1_LEIBR      --PPGRSCSASEYAAHMPGAAAAATA------ERCITLDVRARVQYDMAHL--PHSVNVP
Q386S6_TRYB2      MLPAEANVAPSVYFSVLQKLLRGER-------MSWMTLDVRPKEQYDMAHL--PHSVSLP
V5B0X0_TRYCR      LLPTEARILPKDAFAYLQHIGHST--------TKCMILDVRSKEQYEMAHL--PTAVLLP
B7FVV0_PHATC      -LPSESNISCIEYSRVREDKVPH------------ILVDVRTKLQFEMCAL--EEAVHIP
A0E677_PARTE      SIPFRGGYKEIEWKDFLQIQK----N------DNVVLLDVRPSQQYNIIKL--DGFKNLP
Q6BG38_PARTE      SIPYRGGYKEIEWKDFLQIQR----S------EKVALLDVRPSSQYNIIKL--DGFTNLP
I7M6E7_TETTS      FTVKEHNFKNITWKEFVQEKEKGF-S------DQAEFIDVRPESQYDIVNI--PLFKNIP
E3KQR1_PUCGT      MGSQQPVIQTSTERITANDLLSNKYQLN-----QFRLLDVRPRTQFEICALP--NSINIP
E3L838_PUCGT      MGSQQPVIQTSTERITANDLLSNKHQLN-----QFRLLDVRPRTQFEICALP--NSINIP
A8NT26_COPC7      AGS--PEERLSVSRREMQDLQEIIQSNK-----PFDLIDVRPPTEFGICSLP--NSQNVS
Q5KJ01_CRYNJ      AGQ-------SGHRISVQELDELLQFDKS----KVTVIDTRPEVEFGICSVP--GSINMP
                                                       :*.*   .  :  .       : 

UBA4_YEAST        IKNLRDMNGD-------------------------------LKKLQEKLPSVEKDSNIVI
UBA4_ASHGO        VKELDEMEGS-------------------------------IEELQKHIPVITPDLDIVV
UBA4_CANAL        WDPTFRKADA-------------------------------IEQYLPD--DSTKDDEIYV
UBA4_SCHPO        LSEVDSLQNL-------------------------------SGKV-------------CV
UBA4_YARLI        WSELKHKEEL-------------------------------DVQVDGS--------PVYV
UBA4_EMENI        MSTILASAYSAPTLDADEPK-------------------RLPSWLPPEVAHE-SNKPIYV
UBA4_ASPFU        ISTILSSASSPTNVDANAQP-------------------SLPFWLPRELASADSTDPIYV
C0NQD0_AJECG      ISSILSSSSSSTSATQLNSGSLVETAPNGTSAVASTIALNLPSWYPSSLLDTDPTRPIHV
Q0U1Y0_PHANO      FATIAATARPTLDASSPGSGQ---------------DHHMSGDEHDWVAQLRQTEKPIFV
UBA4_SCLS1        FSSFQGSKGS------------------------------SDHPLSTLTENLNPKTPIYV
C7Z6K1_NECH7      ISRFMNARG--------------------------------ETIPEGWPTDLPPSAPIYI
Q7SEE2_NEUCR      FGKLLSKAAQLKRSGETPKVG-----------------DILPPEIQVRDGHGDKDIPIYV
D5GLT0_TUBMM      YAEFEALKYEDSE----------------------------AEEIKSKFRDQPKDRPVYV
MOCS3_HUMAN       LKHLE--RRDAESLKLLKEAIWEEKQG----------------------TQEGAAVPIYV
H2P2A9_PONAB      LKHLE--RRDAESLKLLKEAIWEEKQG----------------------TQEGAAVPIYV
G1SC20_NOMLE      LKHLE--RRDAESLKLLKEAIWEGKQG----------------------TQEGAAVPIYV
I3N396_ICTTR      LKHLE--RRDAESLKLLGEAIQEGKQR----------------------IQEGAALSIYV
H0XRE9_OTOGA      LKHLE--RRDAASLKLLGEAIGEGKRD----------------------TQPGAAFSIYV
MOCS3_PIG         LKHLE--RRDAESLKLLGEAIREGKQG----------------------TQEGASLPIYV
H0VUB6_CAVPO      LRHLE--RKDRESLKLLREAIQEGNGD----------------------TQEGTAVYVYV
MOCS3_BOVIN       LKSLE--RRDAESLKVLGEAIREGKQG----------------------AQEGASVPIYV
MOCS3_MOUSE       LSQLE--RRDADSLKLLGAALRKGKQE----------------------SQEGVALPVYV
D4A8L5_RAT        LSLLE--RRDADSLKLLGAALQEEKRN----------------------SQEGAALAVYV
MOCS3_DANRE       LASLE--DKKPEHITLLKEAISDLQEH----------------------LNNQSPVQVFV
H3AHF7_LATCH      LIKLE--EKNVDCIKLVLELVDEIKRS----------------------DKELASVPVYV
B7QFH8_IXOSC      LECLE--EGAIAVVEKLRESGSK---------------------------------EVLV
MOCS3_ANOGA       VPIED--ILSNRRTEELLAR------------------------------AQQAQLPVYV
W5JI26_ANODA      IPIDD--IIHDRRTEEIVEKLLATVAH----------------------EQTAAPPPLYL
MOCS3_AEDAE       VPIDD--ILKNRRTAEVTQL-------------------------------AATGGPVFV
MOCS3_DROME       VPLVE--ILDDSYLKRLGKQL------------------------------EDKELPIVL
M9PCK7_DROME      VPLVE--ILDDSYLKRLGKQL------------------------------EDKELPIVL
MOC31_DROPS       VPLSE--ILDDSYLKRFAKQL------------------------------EDKELPIVL
MOC32_DROPS       VPLSE--ILDDSYLKRFAKQL------------------------------EDKELPIVL
MOCS3_CAEBR       ITLNE--CRS-LQAEELSSRLGV----------------------------DSQTSDVYV
MOCS3_CAEEL       VTLKE--CRS-LSAEDISNRLGLQ---------------------------NTEHSDVFV
F6HES6_VITVI      LSSLE--TRMSEISSALKEEEE--QKG----------------------S-NHSGTSIYV
B9GJ37_POPTR      LSSLE--SRLAEISSALKEEEK--RKD----------------------SGFESGASLYV
MOCS3_ARATH       LANLE--TRLNELTSALKEKGNG-HAN----------------------TESCTNPSVFV
C5Z503_SORBI      LSMLE--EKLSTLETSLKETG--------------------------------EASTLVV
C5Y081_SORBI      LSMLE--EKLPTLETSLKETG--------------------------------EASTLIV
MOCS3_ORYSJ       LSLLE--EKLPLLRDSAREVSS----R----------------------RDGRQHCPVYV
A9TQW1_PHYPA      YAKLP--QQLDTIRAAAQKHKH----------------------------EGDEDMSVYV
F4NU54_BATDJ      FGQLE--RQLDSIIKLRHDVVM---------------------------ETKTEDVPIYV
UBA4_DICDI        IEEIDKKESIEIIEKLIKEKVENNNNNNNNNEN----------------RDASDELSVYL
F0Z915_DICPU      IEVIDKQESIDKIEKLINDKINSNEDS---------------------------ELSVYL
D3BLV1_POLPP      IDELSRESSIKTIEELAINENE--------------------------------ILPIYI
G4V7Z6_SCHMA      VSELFRDSVISEIRQLIDTQISKGATL---------------------------PFPVIL
E9ADE6_LEIMA      YQSLLQWKRTGTVVTQLADVLDKAMPPPSNTPDRM-----KDGSAAVSHGDEGSQVVVYV
A4I2V9_LEIIN      YQSLLQWKRAGTVVTQLADVLDKALPPQSDTPDCM-----KEGSAVVSHGDAGPQVVVYV
A4HFU1_LEIBR      YQSMQQWQRAGTVVTHLSEVLEKALPPQS----------------AAAHGGTVPEVMVYV
Q386S6_TRYB2      LKQLEMWKRDGVLQNEWEKFVNSVP------------------------CASRGPMDVYV
V5B0X0_TRYCR      LLQLKKWQLDGVLWNEWERFVSCHI------------------------GTTDDCVTVFV
B7FVV0_PHATC      LSSLSQQLDQ-------------------------------------IEKLSGGTKPVYC
A0E677_PARTE      YQQIDQFQVEE------NKDKE-----------------------------------VYI
Q6BG38_PARTE      YSQIDQLQVEE------YKDKE-----------------------------------IYI
I7M6E7_TETTS      YQDLQDLDENALSNLLGDKNKK-----------------------------------IFI
E3KQR1_PUCGT      ITEALENPESTIERLRKVTHNALKNED--------------------RTSALKNQCDWLV
E3L838_PUCGT      ITEALENPESTIERLRKFTHNALKNED--------------------RTSALKNQCDWLV
A8NT26_COPC7      LKQILAKPQ----------------------------------------DYLSPSKETIV
Q5KJ01_CRYNJ      LPSILSGPT-----------------------------------------DIQLTPDIVF
                                                                              

UBA4_YEAST        LCRYGNDSQLATRLLKDK----FGFS-----------------------------NVRDV
UBA4_ASHGO        LCRYGNDSRLATRILKDK----FKLR-----------------------------NVRDV
UBA4_CANAL        VCRFGNDSQLAAKKLIG-----MGYP-----------------------------NVRDI
UBA4_SCHPO        ICRSGNTSQTAVRKLQEL----NPQA-----------------------------DIFDV
UBA4_YARLI        VCRYGNDSQNAVDKLQKL----GIPS-----------------------------K--DI
UBA4_EMENI        VCRQGNDSQTVVRKLKELGLDHGGER-----------------------------PVVDI
UBA4_ASPFU        VCRHGNDSQIAVRRLKELGLDRGGQR-----------------------------YVGDI
C0NQD0_AJECG      VCRLGNDSQVAVRKLKELGVDRGGER-----------------------------WVGDI
Q0U1Y0_PHANO      VCRQGNDSQLSVRKMKELGLDYGGKR-----------------------------FIGDI
UBA4_SCLS1        VCRLGNDSQIVTKKMKDLGLDQKGDR-----------------------------YIGDI
C7Z6K1_NECH7      VCRVGNDSQIAAKKLKDLGLGNNGER-----------------------------FIGDI
Q7SEE2_NEUCR      VCRRGLDSQEAVEKLKEMGLDNGGSR-----------------------------KIVDI
D5GLT0_TUBMM      ICRLGNDSQIVARQLKEAGVFPDDR-------------------------------VFDI
MOCS3_HUMAN       ICKLGNDSQKAVKILQSLSAAQELD----------------------------PLTVRDV
H2P2A9_PONAB      ICKLGNDSQKAVKILQSLSAAQELD----------------------------PLTVRDV
G1SC20_NOMLE      ICKLGNDSQKAVKILQSLSAAQELD----------------------------PLTVRDV
I3N396_ICTTR      ICKLGNDSQKAVKILQSLTAAQELD----------------------------SLMVQDV
H0XRE9_OTOGA      ICKLGNDSQKAVKILQSLTEAHELD----------------------------SLTVRDV
MOCS3_PIG         ICKLGNDSQKAVKILQSLP---DLD----------------------------SLLVQDV
H0VUB6_CAVPO      ICKLGNDSQKAVRILQSLTAAQELD----------------------------SLTVQDI
MOCS3_BOVIN       ICKLGNDSQKAVKILQSWA---DLD----------------------------SLTVKDV
MOCS3_MOUSE       ICKLGNDSQKAVKVLQSLTAVPELD----------------------------SLTVQDI
D4A8L5_RAT        ICKLGNDSQKAVRVLQSLTAVPELD----------------------------SLKVQDI
MOCS3_DANRE       VCKLGNDSQKAVQLLEKMSGA-EVE----------------------------AMTVKDI
H3AHF7_LATCH      ICKLGNDSQKAVKVLREMSGN-ELP----------------------------HLLVKDI
B7QFH8_IXOSC      VCRRGNDSQLAVQKLQKLLGDHGDV----------------------------TCTVRDI
MOCS3_ANOGA       VCRRGNDSQLAVRHLAPLF--RERN----------------------------LPAPRDL
W5JI26_ANODA      VCRRGNDSQLAVRHLEPLF--RARN----------------------------LPAPRDL
MOCS3_AEDAE       VCRRGNDSQLAVRHLSQLF--QEQG----------------------------LAPPRDI
MOCS3_DROME       VCRRGNDSQIAVQHLRNRF--PTH-------------------------------FVRDL
M9PCK7_DROME      VCRRGNDSQIAVQHLRNRF--PTH-------------------------------FVRDL
MOC31_DROPS       LCRRGNDSQIAVQHITNRF--PAH-------------------------------SIRDL
MOC32_DROPS       LCRRGNDSQIAVQHITNRF--PAH-------------------------------SIRDL
MOCS3_CAEBR       ICHRGNDSQRAVKLLKEKL--GSI-------------------------------HFRDI
MOCS3_CAEEL       ICHRGNDSQRAVLLLREKL--VDI-------------------------------KFRDI
F6HES6_VITVI      VCRRGNDSQRAVEYLHKIG----------------------------------FTSAKDI
B9GJ37_POPTR      ICRRGNDSQMAVQLLHKVG----------------------------------FTSARDI
MOCS3_ARATH       VCRRGNDSQRAVQYLRESG----------------------------------FDSAKDI
C5Z503_SORBI      LCRRGNDSQRAVKLLHEKG----------------------------------FASAKDI
C5Y081_SORBI      LCRRGNDSQRAVKLLHEKG----------------------------------FASATDI
MOCS3_ORYSJ       ICRRGNDSQVAVQILRENG----------------------------------FLYASDV
A9TQW1_PHYPA      ICRRGNDSQRAVQDLRSAG----------------------------------FNLVYDI
F4NU54_BATDJ      VCRLGNDSQLAVQKLKENG----------------------------------VTNVFDI
UBA4_DICDI        VCRRGNKSQDAVKILDEKLKEFR-----------------------------DKFKLLHI
F0Z915_DICPU      LCRRGNKSQDAIKILDEKLKISR-----------------------------DKVKIQHI
D3BLV1_POLPP      VCRRGNKSQDAATILGNKLNSTEKST--------------------------NSFIIKHI
G4V7Z6_SCHMA      LCYRGNKSAEAAPLLKSALLSLRCSNSDHDLNGKINHAIQEELNSFNTESNPSEFIVCDV
E9ADE6_LEIMA      LCRRGINSFKALTLIRAALAEAEARGDEAAVAQLG------------------RYVFRNV
A4I2V9_LEIIN      LCRRGLNSLKAVALIRAALAEAEARGDEAAVARLG------------------RYVFRNV
A4HFU1_LEIBR      LCRRGINSLKATALIRAALEEEQAKGDRATAARLG------------------QYVFQNV
Q386S6_TRYB2      ICRRGISSVKAMQVLLPLQEWCPKSCGTDVDGKAAIHQNPG-----------KRFRFINV
V5B0X0_TRYCR      VCRRGIKSTEAVKIFLSTEQRCETLDDGCTDATKPFTSR-------------RRYRFINM
B7FVV0_PHATC      ICRRGVDSVEATRILDAAKLSHPNI-----------------------------HSAKNV
A0E677_PARTE      MCRRGNNSRLA-CEFLKDK----------------------------------IPNVYNI
Q6BG38_PARTE      MCRRGNNSRLA-CEYLKDK----------------------------------TPNIYNI
I7M6E7_TETTS      MCRRGNMSRLAGNDLFKKG----------------------------------YKDVYNV
E3KQR1_PUCGT      VCRRGNDSLLAADALNSVISASTPHREQ--------------------DHTIKNEKFMDL
E3L838_PUCGT      VCRRGNDSLLAADALNSVISASTPHREQE-------------------DHTIKNEKFMDL
A8NT26_COPC7      VCRLGNDSQLAADALRQAGGEG---------------------------------KVRDV
Q5KJ01_CRYNJ      ICRRGNDSQIAAASLRKALDAK------------------------------EDVRVRDV
                  :*  *  *                                                  .:

UBA4_YEAST        RGGYFKY-IDDIDQTIPKY
UBA4_ASHGO        KGGYFAY-IDEINPSLPKY
UBA4_CANAL        IGGLDKW-SDDVDSKIPKY
UBA4_SCHPO        VAGLKGW-STEVDPNFPLY
UBA4_YARLI        KGGLYAW-AKNVDEKFPIY
UBA4_EMENI        KGGFRSW-REQVDPDWPDY
UBA4_ASPFU        QGGLRAW-REQIDPDWPEY
C0NQD0_AJECG      RGGLKAW-REEVEPEFPDY
Q0U1Y0_PHANO      RGGLEAW-RKSVDAEFPDY
UBA4_SCLS1        KGGLRSW-KEQVDGSWPEY
C7Z6K1_NECH7      QGGMRSW-KANVDPSVPFI
Q7SEE2_NEUCR      AGGMKAW-KEQVDPSFPYL
D5GLT0_TUBMM      KGGIVEWARSGVAGEFPEY
MOCS3_HUMAN       VGGLMAW-AAKIDGTFPQY
H2P2A9_PONAB      VGGLMAW-ATKIDGTFPQY
G1SC20_NOMLE      VGGLMAW-AAKIDGTFPQY
I3N396_ICTTR      VGGLMAW-AAKIDGSFPQY
H0XRE9_OTOGA      VGGLMAW-AAKIDRTFPQY
MOCS3_PIG         VGGLMAW-AAKVDGTFPQY
H0VUB6_CAVPO      AGGLMAW-AAKIDQTFPQY
MOCS3_BOVIN       VGGLMAW-AAKIDGTFPQY
MOCS3_MOUSE       VGGLMAW-AAKIDGTFPQY
D4A8L5_RAT        SGGLMAW-AAKIDGTFPQY
MOCS3_DANRE       GGGLMAW-AKKIDYCFPQY
H3AHF7_LATCH      QGGLMAW-AHKIDATFPQY
B7QFH8_IXOSC      QGGLESW-AQTVDPSFPTY
MOCS3_ANOGA       IGGLHAW-TKTIDPNFPIY
W5JI26_ANODA      IGGLHAW-TKTIDPAFPIY
MOCS3_AEDAE       VGGLHAW-THNIDPEFPIY
MOCS3_DROME       IGGLHAW-TNSVDPSFPIY
M9PCK7_DROME      IGGLHAW-TNSVDPSFPIY
MOC31_DROPS       VGGLHAW-TGSVDATFPIY
MOC32_DROPS       VGGLHAW-TGSVDATFPIY
MOCS3_CAEBR       IGGYEEW-ALKINDEFPLY
MOCS3_CAEEL       IGGYEQW-ALKINDMFPLY
F6HES6_VITVI      IGGLESW-AHDVDPNFPTY
B9GJ37_POPTR      IGGLEAW-ARDVDPNIPTY
MOCS3_ARATH       IGGLEAW-AANVNPNFPTY
C5Z503_SORBI      IGGLQAW-GQDVDPHFPVY
C5Y081_SORBI      IGGLQAW-GRDVDPDFPVY
MOCS3_ORYSJ       AGGFESW-AKEVDPSFLLY
A9TQW1_PHYPA      TGGLLSW-AQDVDSTFPAL
F4NU54_BATDJ      VGGLASW-TKEIDPIFPEY
UBA4_DICDI        KDGLLGW-NESIDDSFPIY
F0Z915_DICPU      KDGLLGW-NESIDSSFPYY
D3BLV1_POLPP      RDGLTGW-NEEIDPTFPLY
G4V7Z6_SCHMA      AGGLSAW-ALEIDPNFPTY
E9ADE6_LEIMA      SGGLNAY-HREVDSAFPYY
A4I2V9_LEIIN      SGGLNAY-HREVDSAFPYY
A4HFU1_LEIBR      SGGLNAY-HCEVDRGFPYY
Q386S6_TRYB2      DGGLNRY-HREVDRNFPFY
V5B0X0_TRYCR      EGGLNRY-HHDVDNKFPFY
B7FVV0_PHATC      AGGLVSW-RKEVDTSFPKY
A0E677_PARTE      VGGIDLY-AKGFDPKMPLL
Q6BG38_PARTE      IGGIDLY-AKLYDPKMPLL
I7M6E7_TETTS      VGGINEY-GRDFDQSVPFI
E3KQR1_PUCGT      VGGLETY-SLVLDPTFPLY
E3L838_PUCGT      VGGLETY-SLVLDPTFPLY
A8NT26_COPC7      IGGLRAW-SKI-NKNFPDY
Q5KJ01_CRYNJ      RGGLKAW-GREVDLNFPVY
                    *   :