CLUSTAL format seed alignment for MF_03050

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MOCOS_EMENI           ------------------------------------------------------------
MOCOS_ASPFU           ------------------------------------------------------------
C0NNC6_AJECG          ------------------------------------------------------------
J3K5A2_COCIM          ------------------------------------------------------------
I1RC08_GIBZE          ------------------------------------------------------------
C7YKM0_NECH7          ------------------------------------------------------------
F9FQI9_FUSOF          ------------------------------------------------------------
MOCOS_NEUCR           ------------------------------------------------------------
D5G5P1_TUBMM          ------------------------------------------------------------
U9SZA5_RHIID          ------------------------------------------------------------
MOCOS_DICDI           -------------------MLIFIISIIITIASIIFLFETVFNKNSNTINNNNNSNNNN-
F1A5V2_DICPU          -------------------MLIFIVSIIITFLTVFVFKKFLNNNNSNNQQDNDNSVNNKL
D3BH81_POLPP          -------------------MKKFSFYFIVFLTFVNHLEVFL--KSNITLNSNFNTKNDN-
MOCOS_CAEBR           ------------------------------------------------------------
MOCOS_CAEEL           ------------------------------------------------------------
MOCOS_HUMAN           ------------------------------------------------------------
H2QEG1_PANTR          ------------------------------------------------------------
G3R2H1_GORGO          ------------------------------------------------------------
G1R2Q1_NOMLE          ------------------------------------------------------------
F7F1W1_CALJA          ------------------------------------------------------------
I3MGJ4_ICTTR          ------------------------------------------------------------
MOCOS_BOVIN           ------------------------------------------------------------
F1PDQ7_CANLF          ------------------------------------------------------------
G3T425_LOXAF          ------------------------------------------------------------
H0WXY3_OTOGA          ------------------------------------------------------------
G1SDV9_RABIT          ------------------------------------------------------------
MOCOS_MOUSE           ------------------------------------------------------------
F7BDB2_ORNAN          ------------------------------------------------------------
F6R8F7_MONDO          ------------------------------------------------------------
MOCOS_DANRE           ------------------------------------------------------------
G3NFC5_GASAC          ------------------------------------------------------------
C3ZGY8_BRAFL          ------------------------------------------------------------
W4XCH4_STRPU          ------------------------------------------------------------
E0VP85_PEDHC          ------------------------------------------------------------
E9GUD0_DAPPU          ------------------------------------------------------------
MOCO1_AEDAE           ------------------------------------------------------------
MOCO3_AEDAE           ------------------------------------------------------------
MOCOS_ANOGA           ------------------------------------------------------------
W5JIU0_ANODA          ------------------------------------------------------------
MOCO2_AEDAE           ------------------------------------------------------------
MOCOS_DROME           ------------------------------------------------------------
MOCOS_DROPS           ------------------------------------------------------------
A0A158NCR0_ATTCE      ------------------------------------------------------------
F4WEC2_ACREC          ------------------------------------------------------------
A0A158ND12_ATTCE      ------------------------------------------------------------
MOCOS_BOMMO           ------------------------------------------------------------
MOCOS_ARATH           ------------------------------------------------------------
MOCOS_SOLLC           ------------------------------------------------------------
MOCOS_ORYSJ           ------------------------------------------------------------
I1Q4H9_ORYGL          ------------------------------------------------------------
I1GW21_BRADI          ------------------------------------------------------------
A9RRC7_PHYPA          --------------------------------------------------------MALV
H3G8M7_PHYRM          ------------------------------------------------------------
A0A0D1C4I7_USTMA      --MMWTPTLLSSKIATIPSKAL---GAALLCFALPYVASVLLQYSVAHRIACSVVIFLVV
R9NYF0_PSEHS          ---MVTEPACSSEIGPKADTG---------------------------------------
A0A081CFS5_PSEA2      MSVHSTSSASAASISTTMSSSTVAIGAATLCIALPYLSSLLGSLTAAQRIALAVLVYLAL
F4P4U4_BATDJ          ------------------------------------------------------------
                                                                                  

MOCOS_EMENI           ---------------------------------------------------------MNL
MOCOS_ASPFU           ------------------------------------------------------MVGVTS
C0NNC6_AJECG          ---------------------------------------------MTGQLLSPR--SNDH
J3K5A2_COCIM          ------MEGFVVLWGIFLLWLGKMSLSTLLRISGLRKERHDASFLKTSEKSSSKQKTVDA
I1RC08_GIBZE          ---------------------------------------------------------MTT
C7YKM0_NECH7          -----------------------------------------------------------M
F9FQI9_FUSOF          ---------------------------------------------------------MAV
MOCOS_NEUCR           ------------------------------------------------------------
D5G5P1_TUBMM          ------------------------------------------------------------
U9SZA5_RHIID          ----------------------------------------MALDSLECKPDLKNFNTEKT
MOCOS_DICDI           ----NNNNNNNNNNNNNKNNIKENNIDKNKEIKIKEKLILNNNDPKENDLKYKEEFNNFL
F1A5V2_DICPU          KKEIINTNKSIDNSNNNNNNNNNNVVDSSNSVDNKNNEKINN--PLENDNKYKEEFLKFK
D3BH81_POLPP          ----ETLLKEINNNNNNDN-------DSDRVISVQQNQ-----YSHQRISEFEKQQQSFL
MOCOS_CAEBR           ------------------------------------------------------------
MOCOS_CAEEL           ------------------------------------------------------------
MOCOS_HUMAN           ------------------------MAGAAAESGR---------ELWTFAGSRDPSAPRLA
H2QEG1_PANTR          ------------------------MAGAAAESGR---------ELWTFAGSRDPSAPRLA
G3R2H1_GORGO          ------------------------MAGAAAESGR---------ELWTFAGSRDPSAPRLA
G1R2Q1_NOMLE          ------------------------MAGAAAESGR---------ELRAFAGSRDPRAPRLA
F7F1W1_CALJA          ------------------------MAGAAAELGR---------ELRAFSRSWDPSAPPLA
I3MGJ4_ICTTR          ------------------------MASEATESGA---------ELLAFTRFRDSSAARLA
MOCOS_BOVIN           ------------------------MAGGAAHPGA---------ELLPFARFLDSSLQPLV
F1PDQ7_CANLF          ------------------------MAGGAAPPGP---------ELLAFARFRESSERPLP
G3T425_LOXAF          ------------------------MASGTAQPGS---------ELLDFARFRDSSSPRLT
H0WXY3_OTOGA          ------------------------MADGTAEPGA---------ELRDVTAFRDSS-APRP
G1SDV9_RABIT          ------------------------MAGVGAEPGA---------ELRVLA-------PGFA
MOCOS_MOUSE           ------------------------MACGAAERGP---------EPPAFQRHLEASTQRLA
F7BDB2_ORNAN          ------------------------MAGPPPAKDPTDPPESWAEPPLSFRAFRTSTVPTPA
F6R8F7_MONDO          ------------------------MASKP-GRRPKPPPEQQWEELLTFQHFQKTSLSRHS
MOCOS_DANRE           ------------------------MDTRSLQ------------DFQDLCTFDVFKSFGHY
G3NFC5_GASAC          ------------------------------M------------DFQTLCTFDTYKSLWSH
C3ZGY8_BRAFL          -----------------------------------------MADKWGNVEHLQREKANFL
W4XCH4_STRPU          --------------------------------------------MEPSAEVQSTEETPVK
E0VP85_PEDHC          -------------------------------------------------------MMERV
E9GUD0_DAPPU          -------------------------------------------------------MEKDV
MOCO1_AEDAE           --------------------------------------------------MEAMMNFTSQ
MOCO3_AEDAE           --------------------------------------------------MEAMMNFTSQ
MOCOS_ANOGA           ------------------------------------------------------MDFVEE
W5JIU0_ANODA          -----------------------------------------------------MEQTPSE
MOCO2_AEDAE           ------------------------------------------------------MEFEQE
MOCOS_DROME           -----------------------------------------------------MTSYRPE
MOCOS_DROPS           -----------------------------------------------------MSSYQSE
A0A158NCR0_ATTCE      ---------------------------------------------MMDIIIENIVKFTPV
F4WEC2_ACREC          ---------------------------------------------MMDAMIENIVKFTPV
A0A158ND12_ATTCE      -------------------------------------------------MMDTIVKFTSV
MOCOS_BOMMO           -----------------------------------------------------MTVLSQI
MOCOS_ARATH           -------------------------------------------------MEAFLKEFGDY
MOCOS_SOLLC           -------------------------------------------MNIESEKEQFLKEFGSY
MOCOS_ORYSJ           ---------------------------------------------MEVSKEEFLRQFGGD
I1Q4H9_ORYGL          ---------------------------------------------MEVSKEEFLRQFGGD
I1GW21_BRADI          ---------------------------------------------MDRSKEEFLEQFGAD
A9RRC7_PHYPA          PILNWSFTLSFFHASPVWKRLGSHAVASESESEARRGEAVEQASGVSDEKRVFLEIFGEV
H3G8M7_PHYRM          ---------------------------------------------MSASKTAFVAQSEGA
A0A0D1C4I7_USTMA      SAQLQYRTTKRFQVTQKLQALPRTARCDSPSVECGDDREVERARRFIPPETGRNSTPAWR
R9NYF0_PSEHS          ------------------------------------------------------------
A0A081CFS5_PSEA2      SARSQHRSSKRFQVQPPASADRHSHHHSEPATNVSLRTVHPSRTRSSWPSTSATQGSTTA
F4P4U4_BATDJ          ---------------------------------------------MNATSSLVQNNSPLR
                                                                                  

MOCOS_EMENI           SKGTAAAYCSGYSEDVDVIREREYPLLKDTT-------------------YLDHAGTTLY
MOCOS_ASPFU           CEEEILEYGRGYSEDVDTIREREYPQLKDTT-------------------YLDHAGTTLY
C0NNC6_AJECG          GLLQG----SPYPEQIEDIREREYPSLRETT-------------------YLDHAGTTPY
J3K5A2_COCIM          GAVDGESAENLYPENVETIRSREFPLLKSTT-------------------YLDHGGATLY
I1RC08_GIBZE          SIRSGNPSRHQYNAAVEDLRASEFPMIKDSI-------------------YLDHAGSTLC
C7YKM0_NECH7          DTDSGGTNGYRYNVAVEHFRAREYPMLQDSV-------------------YLDHAGTTLC
F9FQI9_FUSOF          PILGGDSS---YNRAVEQFREAEYPMIQDSI-------------------YLDHAGTTLC
MOCOS_NEUCR           -MGSLNIQHNGYDADVEKIREEEYPMLKDSI-------------------YLDHAGTTPY
D5G5P1_TUBMM          ------------MVIRQELRDTEYPQLKGIT-------------------YLDHAGTTLY
U9SZA5_RHIID          AFLKEFNVQYGYGGKIDQIREEEYPQLKGAV-------------------FLDHAATTTY
MOCOS_DICDI           NKFSKNQEYGYKDNLIDNELRNHYNNNNNNNNNNNNNNKDDQFPKLKDIVYLDHAASTLA
F1A5V2_DICPU          NRFSKNNEYGY-NGAIDLELRNHYSGNDD----------DDQFPKLKDIIYFDHTASTLP
D3BH81_POLPP          NQYS--DSYGY-NQRIDHIRNNDFSVLNG-----------KVTTQSTNCCYLDHTASTIP
MOCOS_CAEBR           ------------------------------------------------MPYLDHAGSTLP
MOCOS_CAEEL           ------------------------------------------------MPYLDHAGSTLP
MOCOS_HUMAN           YGYG--PGS------LRELRAREFSRLAGTV-------------------YLDHAGATLF
H2QEG1_PANTR          YGYG--QGS------LRELRAREFSRLAGTV-------------------YLDHAGATLF
G3R2H1_GORGO          YGYG--PGS------LRELRAREFGRLAGTV-------------------YLDHAGATLF
G1R2Q1_NOMLE          YGYGYGAGS------LRELRAREFGRLAGTV-------------------YLDHAGATLF
F7F1W1_CALJA          YGYG--PGS------LRELRAREFGRLAGTV-------------------YLDHAGATLF
I3MGJ4_ICTTR          YGYG--PRS------LLDMRESEFGRLAGTV-------------------YLDHAGATLF
MOCOS_BOVIN           YGYG--RGT------LHELRAREFGRLAGTV-------------------YLDHAGTTLF
F1PDQ7_CANLF          YGYG--PRS------LRELRQREFGRLAGTV-------------------YLDHAGATLF
G3T425_LOXAF          YGYG--PRS------LRELREREFGRLAGTV-------------------YLDHAGATLF
H0WXY3_OTOGA          YGYG--PGS------LQELRAREFSRLAGTV-------------------YLDHAGATLF
G1SDV9_RABIT          QGYR--QCN------LHELRAREFRRLAGTV-------------------YLDHAGATLF
MOCOS_MOUSE           HGYG--LRS------MSELRDQEFGRLAGTV-------------------YLDHAGATLF
F7BDB2_ORNAN          YGYHPDHGPDPGPDSLEDMRDREFGRLRGTT-------------------YLDHAGATLF
F6R8F7_MONDO          YGYAQGT--------MRALIESEFSRLRGIT-------------------YLDHAGTTLY
MOCOS_DANRE           YGYGV---------DQQALIDQEFKRIKGVT-------------------YLDHAGTTLF
G3NFC5_GASAC          YGYGG---------DLRHVLEQEFTRTKGIT-------------------YLDHAAATLY
C3ZGY8_BRAFL          TNYGKVYGY---GGRIDKMQEEEFSRLKGIV-------------------YLDHTGTTHY
W4XCH4_STRPU          ETIEKE------EETIEDEAGDHIDVTENTV-------------------YLDHTGATLP
E0VP85_PEDHC          YDDK-----------IITKIYQEFPNTKDVC-------------------YLDHAGATLY
E9GUD0_DAPPU          YGEE-----------AWQSINKNFDHVKGL--------------------YLDHAGSTLY
MOCO1_AEDAE           YTVE-----------EALAIENEFSRLKEK-------------------CYLDHAGTTLY
MOCO3_AEDAE           YTVE-----------EALAIEKEFSRLKEK-------------------CYLDHAGTTLY
MOCOS_ANOGA           FTDE-----------ERLKIEQDFSRLADK-------------------CYLDHAGTALY
W5JIU0_ANODA          YSAE-----------EASKIAYEFRRLQDK-------------------CYLDHAGTALY
MOCO2_AEDAE           YTAE-----------EALNIEKEFTRLKGK-------------------HYMDHAGTTLY
MOCOS_DROME           FSAS-----------EQSQIDAEFSRLASNKS-----------------VYLDHAGTTLY
MOCOS_DROPS           FNAD-----------EQAAIDKEFTRLANNKS-----------------IYLDHAGTTLY
A0A158NCR0_ATTCE      YDDV-----------TARSLAREFTRLEGE-------------------CYVDHAGATLY
F4WEC2_ACREC          YDDD-----------TARSLAREFTRLEGE-------------------CYVDHAGATLY
A0A158ND12_ATTCE      YDDA-----------TVRSLANEFSRLKGE-------------------CYVDHAGTTLY
MOCOS_BOMMO           IKPD-----------DMIKITSEFARLGDR-------------------CYLDNAGATLY
MOCOS_ARATH           YGYPDGPK------NIQEIRDTEFKRLDKG------------------VVYLDHAGSTLY
MOCOS_SOLLC           YGYANSPK------NIDEIRATEFKRLND-------------------TVYLDHAGATLY
MOCOS_ORYSJ           YGYPGAPK------GVDEMRAAEFKRLEG-------------------MAYLDHAGATLY
I1Q4H9_ORYGL          YGYPGAPK------GVDEMRAAEFKRLEG-------------------MAYLDHAGATLY
I1GW21_BRADI          YGYPAAPR------GVDEMRAADFKRLEG-------------------TVYLDHAGATLY
A9RRC7_PHYPA          YGYPESSC------PIDKLRATEFARLNG-------------------VVYVDHAGATLH
H3G8M7_PHYRM          YGYGGGTTL-----RIDDMRSTEFPHMEG-------------------SVYLDHAGATMY
A0A0D1C4I7_USTMA      SSTTT---KATIAQSVAHIRTSQCPQLVDAC-------------------YLDAAAAPPF
R9NYF0_PSEHS          -----------LASSVAHVRSTQCPQLADAC-------------------YLDAAAAPPF
A0A081CFS5_PSEA2      QQALVPRKDGTVAEKVEFVRSEQCPQLADAC-------------------YLDAAAAPPF
F4P4U4_BATDJ          FGSTEFRDRHFPQLVTLNTTGKDSSESQAPL-------------------YLDNAGAPPV
                                                                        :.*  .:.  

MOCOS_EMENI           ANSLIHSFGRDLTGNLYGNPHSMSASSQL--SAQRVDDIRLRALRFFNADPDEFDLVFVA
MOCOS_ASPFU           AKSLIESFSRELTSNLFGNPHSLSTSSQL--STQRVDDVRLRALRFFKADPEEFDLVFVA
C0NNC6_AJECG          PASLIDAFSQEMKTNLFGNPHSASSSSQL--STQRVDDARLRVLRFFNACPHDFDVVFVA
J3K5A2_COCIM          AKSLIDDFSREMTSHIFGNPHSASSSSQL--STQRVDDARLRLLQFFNASPDDFDIVFVA
I1RC08_GIBZE          SKSLMDSFAHEMTTVLYGNPHSASPSSQQ--STSRVEDARMNLLTFFGADPTEYDVVFVA
C7YKM0_NECH7          SKSLMDAFTSSMMETIYGNPHSASPSSQN--STSRIEDARMNLLNFFGADPAEYDVVFVA
F9FQI9_FUSOF          SKSLMDSFAHEMTTVLYGNPHSASPSSQQ--SASRVEDARMNLLTFFGADPTEYDVVFVA
MOCOS_NEUCR           PKSLMDRFAQEMTTNLFGNPHSASASSQL--STQRIQDIRLRALQFFNADPADFDLVFVA
D5G5P1_TUBMM          ATSLIHSFSQDLCTNLYGNPHSPSPSSQQ--TTKRIDDVRHRVLHLFNADPEQFDVVFCA
U9SZA5_RHIID          AKSVLISFTTDLINNLYGNPHANSPSSQL--CNQRLDKVRDRVLRHFNANPGDYQVIFTQ
MOCOS_DICDI           SMNQIEEISKELKNSMFCNPHSVNPIGLK--TKEEVDSIRENILNYFNAPYRQYSVIFTS
F1A5V2_DICPU          SKNQIKNISSNFLNNIYCNPHSINPIGLK--TKESVDSIRELILNHFNAPYKQYSVIFTS
D3BH81_POLPP          SSVQLDLVNQDLKSTIYANPHSLNPIGLK--TTESIDQARERILQLFSAPYRQYTVVFTS
MOCOS_CAEBR           SKTQLEELAKLQTQLILANPHSHHSTAIK--TQQIVSSARHRILRYFNTTADDYFVVFTN
MOCOS_CAEEL           SKIQLEEVAKQQSQLILANPHSHHATAVK--TKQIVNSARLRILQYFNTTSDDYFVVLTN
MOCOS_HUMAN           SQSQLESFTSDLMENTYGNPHSQNISSKL--THDTVEQVRYRILAHFHTTAEDYTVIFTA
H2QEG1_PANTR          SQSQLESFTSDLMENTYGNPHSQNISSKL--THDTVEQVRYRILAHFHTTAEDYTVIFTA
G3R2H1_GORGO          SQSQLESFTSDLMENTYGNPHSQNISSKL--TYDTVEQVRYRILAHFHTTAEDYTVIFTA
G1R2Q1_NOMLE          SQSQLESFTSDLMENTYGNPHSQNISSKL--THDTVEQVRYRILAHFHTTAEDYTVIFTA
F7F1W1_CALJA          SQSQLESFTSDLTENIYGNPHSQNISSKL--THDTVEQVRYRILAYFHTTAEDYSVIFTA
I3MGJ4_ICTTR          PQSQLTSFTNDLMNNIYGNPHSQNTISKL--THDTVEHVRYRILAHFHTTPEEYSVIFTA
MOCOS_BOVIN           PQSQITSFMKDLMENVYGNPHSQNISSKL--THDTVEQVRFRILAHFHTSPEDYTVIFTS
F1PDQ7_CANLF          PQSQLTSFTNDLMENVYGNPHSQNISSKL--THETVEHVRYRILAHFHTSSEDYSVIFTA
G3T425_LOXAF          PQSQLTSFTNDLLKNVYGNPHSQNINSRL--THDTVEQVRYRVLAHFHTSPDDYCVIFTS
H0WXY3_OTOGA          PKSQLENFTRDLMENVYGNPHSQNISSKL--THDTVEQVRYRILAHFHTTAEDYSVIFTA
G1SDV9_RABIT          AQSQLANFTKDLMDNVYGNPHSQNTSSKL--THDTVEQVRYRILAHFHASPEDYSVIFTA
MOCOS_MOUSE           PQSQLTNFTKDLMENVYGNPHSQNITSKL--THDTVEQVRYRILTHFHTTPEDYIVIFTA
F7BDB2_ORNAN          PQSQLTRFMKDLSENVYGNPHSQNLSSKL--TFDTTEHVRYRILEHFNTTAEDYTVIFTS
F6R8F7_MONDO          PQSQLTRFMDDLTKNVYGNPHSQHISSKL--TYDTIEHVRYRILEHFNTTSEHYSVIFTS
MOCOS_DANRE           PESLIKGFHDDISRNVYGNPHSHNSSSRL--THDTVESVRYKILAHFNTSPEDYSVIFTS
G3NFC5_GASAC          PECLVRDYFQDVSRNVYGNPHSHHPSSRL--TQDTVDRVRYRVLHHFNATPEEYSVIFTS
C3ZGY8_BRAFL          AQSQLDAYTRDLQTNVYGNPHTRSASSRL--TTDTIDQLRFRILQHFNTSVEHHSVIFTS
W4XCH4_STRPU          CSSQLDGFSRDMRENLYGNPHSRSSSSSL--CTETIDQTRFRILKHFNTTPEKHTVIFTS
E0VP85_PEDHC          SEKQIKNHLNDLLSNVYGNPHSLNHSSKQ--SLDLIDQVRQRILKFFHATPDEYSLIFTS
E9GUD0_DAPPU          SKSIIENSLTELTQNCFGNPHSRNIPSKI--TSDLIDQTRIELLNFFQADPDQYAVIFTS
MOCO1_AEDAE           ADSQIRSVCEGLAQNLYCNPHTSRT------TEDLLDQVRYRVLRHFNTRSSEYSLIFTS
MOCO3_AEDAE           ADSQIRSVCEGLAQNLYCNPHTSRT------TEDLLDQVRYRVLRHFNTRSSEYSLIFTS
MOCOS_ANOGA           GESQLRAVQELLAGGLYCNPHTSRT------MEDLIDLVRYRVLRWFQTRPADYSLVFTS
W5JIU0_ANODA          GESQMSAVQTMLTGGLFCNPHTSRT------MEDLIDLVRFRVLRWFNTRSADYSLVFTS
MOCO2_AEDAE           AESQIRAVHDMLAQNLFCNPHSSPL------TGKLLQQVRHRLLRFFNTSPSDYSLVFTS
MOCOS_DROME           AESQVTAAAEQLQRNVICNPHTCRL------TGDFVDQVRFKILEFFNTTAEDYHVIFTA
MOCOS_DROPS           AESQVTAAAEQLQRDVICNPHTCRV------TGDYVDQVRFKVLEFFNTKEDDYHVIFTA
A0A158NCR0_ATTCE      SETQVRNASANLHSSLYGNPHSIGNSP----THDIIDHMRYRILSHFNTNPDEYIVIFTS
F4WEC2_ACREC          SETQVRDASANLHGSLYGNPHSIGNSP----THDIIDRMRYRILSHFNTNPDEYTVIFTS
A0A158ND12_ATTCE      SDTQIRNVSADLHGSLYTNPHSTGSSL----TQDIIERMRYRVLSHFNTNPDEYSVIFTS
MOCOS_BOMMO           PKSLITSINEDLLKNVYMNPHTDKN------TKDYIEQIRCLILKHFNTDPSTYTLIFTS
MOCOS_ARATH           SELQMEYIFKDFTSNVFGNPHSQSDISSA--TSDLIADARHQVLEYFNASPEDYSCLFTS
MOCOS_SOLLC           SESQMEAVFKDLNSTLYGNPHSQSTCSLA--TEDIVGKARQQVLSFFNASPREYSCIFTS
MOCOS_ORYSJ           SEAQMADVLKDLASNVYGNPHSQSDSSMA--ASDLVTAARHQVLKYFNASPREYKCIFTS
I1Q4H9_ORYGL          SEAQMADVLKDLASNVYGNPHSQSDSSMA--ASDLVTAARHQVLKYFNASPREYKCIFTS
I1GW21_BRADI          SEAQMANVVKDLTSNVYGNPHSQSDSSMA--ATDLVTAARHQVLKYFNASPRDYKCIFTS
A9RRC7_PHYPA          ANSQLKAALDDFSSNLYGNPHSQSDSSMR--SSDAVETVRQQVLEFCNAPSGEYVCVFTS
H3G8M7_PHYRM          SKTQLDAAFQELNAGLFTNPHSAIGNAHVDSTSAKIEGVRRQLLKFFSASEDEYTLVFTS
A0A0D1C4I7_USTMA      PSGLVTAVAEELSARLLSNPHSKSPSAISTADQIAATRLRMMREVFGIQDTHDWHLIFTS
R9NYF0_PSEHS          PSGLVTAVAQSLSGKLLSNPHSKSPSAISTADQISATRLRIMRDMFGIQDTHDWSLIFTS
A0A081CFS5_PSEA2      PTGLVQAVAEDVSSKLLSNPHSKSPSAIATADHITATRMRVMHELFGIRDTHNWHLVFTA
F4P4U4_BATDJ          PVEVVHAHAHSLAQTLLANPHSSMAAAAAY-TSVSINRVRQRILRHFGVSTATHSVVFTA
                          :             ***:                 *                ::  

MOCOS_EMENI           NATAGIKLVADALQNSP-------------------------QGFWYGYYVDAHTSLVGV
MOCOS_ASPFU           NATAAIKLVADGMRDSTR------------------------QGFWYGYHVDAHTSLVGV
C0NNC6_AJECG          NATAGIKLVADALRDYDE------------------------CGFWYGYHRDAHTSLVGV
J3K5A2_COCIM          NATAGIKLVTEALRDYDQ------------------------RGFWYGYHLDSHTSLVGP
I1RC08_GIBZE          NATAGVKLVVDAMRTQP-------------------------QGFQYAYHQACHTSLVGV
C7YKM0_NECH7          NATAGVKLVVDAMRTLP-------------------------QGFLYAYHEACHTSLVGA
F9FQI9_FUSOF          NATAGVKLVVEAIRNQP-------------------------EGFLYAYHQGCHTSLVGA
MOCOS_NEUCR           NATAGIKLVVEAMRCLP-------------------------TGFDYVYHQSSHTSLVGV
D5G5P1_TUBMM          NATAGMKLVLEAFTARE-------------------------EGFKYRYHVDAHTSLVGV
U9SZA5_RHIID          NATAAIKLVGEMFPWTS-------------------------DQSSYKYLRESHNSLIGL
MOCOS_DICDI           GCTDSLKKVGEYFAWT--------------------------KNSKFYYSLESHNSLLGI
F1A5V2_DICPU          GCTDSLKKVGEYFPWS--------------------------ENSKFYYSLEAHNSLLGI
D3BH81_POLPP          GCTDALKKVGEYFPWQS-------------------------KHSTFFYSTEAHNSLLGI
MOCOS_CAEBR           NTTHALKIVAENFNFGH-------------------------RTQEGVVSEISAVLKGGP
MOCOS_CAEEL           NTTHGLKIVAENFKFGQ-------------------------KTHS--ILNIASVLHGGS
MOCOS_HUMAN           GSTAALKLVAEAFPWVS--------------------QGPESSGSRFCYLTDSHTSVVGM
H2QEG1_PANTR          GSTAALKLVAEAFPWVS--------------------QGPESSGSRFCYLTDSHTSVVGM
G3R2H1_GORGO          GSTAALKLVAEAFPWVS--------------------QGPESSGSRFCYLTDSHTSVVGM
G1R2Q1_NOMLE          GSTAALKLVAEAFPWVS--------------------QGPESSGSHFCYLTDSHTSVVGM
F7F1W1_CALJA          GSTAALKLVAEAFPWVP--------------------QGPESSGSQFCYLTDSHTSVVGM
I3MGJ4_ICTTR          GSTAALKLVAEAFPWVS--------------------QSPDSSGSQFCYLTDSHTSVVGI
MOCOS_BOVIN           GSTAALKLVAEAFPWVS--------------------PGPEGSGSCFCYLTDSHTSVVGM
F1PDQ7_CANLF          GSTAALKLVAEAFPWVS--------------------PGPECSGSRFCYLTDSHTSVVGM
G3T425_LOXAF          GCTAALKLVAEAFPWVP--------------------GGPNSSGSWFCYLTDSHTSVVGM
H0WXY3_OTOGA          GSTAALKLVAEAFPWVS--------------------PGPNSSGSRFCYLTDSHTSVVGM
G1SDV9_RABIT          GCTAALKLVAEAFPWVS--------------------RGPESSGSHFCYLTDSHTSVVGM
MOCOS_MOUSE           GSTAALRLVAEAFPWVS--------------------RSPENSGSHFCYLTDNHTSVVGM
F7BDB2_ORNAN          GSTAALKLVGEVFPWNP--------------------PTSELPGSRFCYLTDSHTSVVGL
F6R8F7_MONDO          GSTAALKLVAEAFPWSS--------------------ASSENEGSRFCYLSDSHTSVVGI
MOCOS_DANRE           GCTAALKLVADTFPWKP--------------------MSNKEPGSQFCYLTDNHTSVVGI
G3NFC5_GASAC          GCTAALKLVAESFPWRP--------------------PTESEAGSRFCYLTDSHTSVVGI
C3ZGY8_BRAFL          GCTDALKLLAESFPWED-GSVFSYLEDNHTSVLGVREVAAKEGATIVCVSEEELLRCSNC
W4XCH4_STRPU          GCTGALKLLAESFDWSGLKSCHRTIESSSTDSHDGNEVGTKKRG-MFCYLQDNHTSVVGM
E0VP85_PEDHC          SATSAIKLLFENFNWNSNFEDEEFYHDTESDFFQNSSQSTPTAQSAFVYTQSNHTSVVGG
E9GUD0_DAPPU          GATDSLRLVAESFKFSN--------------------DPDVGECGSFVYIKESHTSVIGM
MOCO1_AEDAE           GTTASLKLLAESFEFAPE--------------------------GAFVYLKDSHTSVLGM
MOCO3_AEDAE           GTTASLKLLAESYEFAPE--------------------------GAFVYLKDSHTSVLGM
MOCOS_ANOGA           GTTASLKLVAESFEFGPGDAEPG----------------------SFVYLRDSHTSVLGM
W5JIU0_ANODA          GTTASLKLLAEAFDFTAAQSAAGE----------EPDQS-SRQAGAFVYLRDSHTSVLGM
MOCO2_AEDAE           GATASLKLVAESFRFRPPDEPES-----------------SPDEGAFVYLRDNHTSVLGM
MOCOS_DROME           NATAALSLVAENFDFGSS--------------------------GEFHFCQENHTSVLGM
MOCOS_DROPS           NATAALSLVAENFDFGRQ--------------------------GNFHYCQENHTSVLGM
A0A158NCR0_ATTCE      GATASLKIIAEGFRFTDKNNK-------------IPPHS-----GSFVYVQDNHMSVLGM
F4WEC2_ACREC          GATASLKIVAEGFRFTTDENNKTA----------TSLHS-----GSFVYVQDNHMSVLGM
A0A158ND12_ATTCE      GATASLKMIAEGFRFTTDENNKLA----------IAIESPHSSPGSFIYIQDNHTSVLGM
MOCOS_BOMMO           GTTQALKLVIESFQFMKNEDD--------------DLNC-----GSFVYLEDNHTSVVGL
MOCOS_ARATH           GATAALKLVGETFPWTQ--------------------------DSNFLYTMENHNSVLGI
MOCOS_SOLLC           GATAALKLVGETFPWSS--------------------------NSSFMYSMENHNSVLGI
MOCOS_ORYSJ           GATAALKLVGECFPWSR--------------------------ESCYMYTMENHNSVLGI
I1Q4H9_ORYGL          GATAALKLVGECFPWSR--------------------------ESCYMYTMENHNSVLGI
I1GW21_BRADI          GATAALKLVGECFPWSR--------------------------ESCYMYTMENHNSVLGI
A9RRC7_PHYPA          GATSALKLVGETFPWSP--------------------------ESEYWYTLENHNSVLGI
H3G8M7_PHYRM          GATAALKLVGESFPWSE--------------------------DSTFAHSIDSHTSVIGI
A0A0D1C4I7_USTMA      GTTASLKLVGECFDWAPTRG-----------------------KVGFSYFFQSHTSAVGI
R9NYF0_PSEHS          GTTASLKLVGESFDWTQTKG-----------------------KRGFSYLVESHTSAVGI
A0A081CFS5_PSEA2      GTTASLKLVAESIDWASLQSS-------------------SDPHARFSYLRQSHTSVVGM
F4P4U4_BATDJ          NSTAAIKLVADRFPWSP--------------------------KSLFCYHQSSHTSIIGI
                      . * .:  : :                                               . 

MOCOS_EMENI           RELAKMGSRCFVNE---------------------------------------DEVDSWI
MOCOS_ASPFU           RELAEKGGRCFTSD---------------------------------------DEVEDWI
C0NNC6_AJECG          RELAARGRRCFADD---------------------------------------EEVEDWI
J3K5A2_COCIM          RNVATRGSRCFLDS---------------------------------------NGVQEWI
I1RC08_GIBZE          REEAA--ASISINN---------------------------------------SDIESWI
C7YKM0_NECH7          REEAI--DSSLIDD---------------------------------------ENLQSWL
F9FQI9_FUSOF          REEAV--YSTSVDD---------------------------------------GDVQSWL
MOCOS_NEUCR           REEAR--SSVCLDT---------------------------------------RQVEDWL
D5G5P1_TUBMM          RELASE-TTCFSSD---------------------------------------AEVEIWL
U9SZA5_RHIID          RRFAEEADAKLIKAITEDDFICLFENDPKTESIQCDNHYSTNALPRVGLIDSPHGTQQEF
MOCOS_DICDI           REYACESIGGSSTTSFQPIP----------------------------SLYFKC-NNNQF
F1A5V2_DICPU          REYACEKG-----ASFQSIS----------------------------SLYFK---NNSF
D3BH81_POLPP          REYAAERG-----SKFRPIQ----------------------------SAFFKQSNNSHF
MOCOS_CAEBR           SNFAYFND-----SHHSVVG----------------------------LRHVVLGKVDAI
MOCOS_CAEEL           SNLGYLYD-----SHHSVVG----------------------------LRHVVNGKVNSI
MOCOS_HUMAN           RNVTMAIN-----VISTPVR----------------------------PEDLWSAEER-S
H2QEG1_PANTR          RNVTMAIN-----VISTPVR----------------------------PEDLWSAEER-G
G3R2H1_GORGO          RNVTMAIN-----VISTPVR----------------------------PEDLWSAEEH-G
G1R2Q1_NOMLE          RNVTMAIN-----VMSTPVR----------------------------PEDLWSAEER-G
F7F1W1_CALJA          RNVTMAMN-----VMSTPVR----------------------------PEDLWSAKER-R
I3MGJ4_ICTTR          RNVVMAMN-----ATSTAVS----------------------------PEDMWSAKEQ-G
MOCOS_BOVIN           RKITAAMN-----VSSIPVR----------------------------PEDMWSAERQDA
F1PDQ7_CANLF          RKVTTAMN-----VTSIPVR----------------------------PEDMRLAERR-A
G3T425_LOXAF          REVTKAMN-----ITSIPVR----------------------------PEDMQSAETR-G
H0WXY3_OTOGA          RKVTAARN-----VTSTSVR----------------------------PEDLWSAEDQ-G
G1SDV9_RABIT          RKAIMAVG-----VTFIPVR----------------------------PEDLRLAEKR-G
MOCOS_MOUSE           RKVAAAMS-----VTSIPVK----------------------------PEDMWSAEGK-D
F7BDB2_ORNAN          RAITYPLN-----VVSTPVN----------------------------PREILLTEKR-R
F6R8F7_MONDO          RKIAEAMQ-----VSSVSLK----------------------------PEDILLSEKS-N
MOCOS_DANRE           RGATALQG-----VGTISVS----------------------------PREVETRARNKT
G3NFC5_GASAC          RGPACGRG-----AVALPVA----------------------------PQEVESRARTES
C3ZGY8_BRAFL          DDKGTLQN-----RTMTSENNNSMENCEP---------------NNSVPCHFPAETDTFQ
W4XCH4_STRPU          RELAHDKG-----ADCLCLSKDTMEKLCT---------------VNVSSVDKISSHNEIN
E0VP85_PEDHC          RELAQEKN-----IPFYCLGYEE-------------------------ANTLMSDHNHVP
E9GUD0_DAPPU          REYFKSFV-----PCYALPCDEITTYLNPGSATIPN--------AEHKKSNFLSSNTDEN
MOCO1_AEDAE           REIVGTER-----IYPVERE----------------------------QLLKELDSSE--
MOCO3_AEDAE           REIVGTER-----IYPVERE----------------------------QLLKELDSSE--
MOCOS_ANOGA           RELVRTGR-----VQPIERA----------------------------ELLQALNEPE--
W5JIU0_ANODA          RQVVRTER-----IGVIERS----------------------------ELLQSLAGSRSG
MOCO2_AEDAE           RSVVGTER-----IDPLEPE----------------------------ELLRHLKVSA--
MOCOS_DROME           RERVRENG-----IYMLREN----------------------------EISG-GKHKANG
MOCOS_DROPS           RERVQARA-----MYMLKEE----------------------------EITGMASLPSAA
A0A158NCR0_ATTCE      RDVIAAKG-----AEVIYLD----------------------------HNQAFQILSQPS
F4WEC2_ACREC          RDVIAAKG-----ADVIYLN----------------------------HNQAFQILSQPS
A0A158ND12_ATTCE      RDVVVARG-----ADVICLG----------------------------HDEAFKVLGQCS
MOCOS_BOMMO           RELAVDKD-----AEVVHIA----------------------------HEDFLNVINTKA
MOCOS_ARATH           REYALAQGASACAVDIEEAANQPGQ-------------------LTNSGPSIKVKHRAVQ
MOCOS_SOLLC           REYALSKGAAAFAVDIEDTHVGESE-------------------SPQS--NLKLTQHHIQ
MOCOS_ORYSJ           REYALSKGATVLAVDVEEGADLAKD-------------------NGS--YSLYKISRRTN
I1Q4H9_ORYGL          REYALSKGATVLAVDVEEGADLAKD-------------------NGS--YSLYKISRRTN
I1GW21_BRADI          REYALRKGATVLAVDVEEDGDLENN-------------------HGSPSPSMFKISRHSN
A9RRC7_PHYPA          REYALEKDVAVTAVEIEAAQTNSSD-------------------SEV---DFSFTPRTLE
H3G8M7_PHYRM          RGYAAAGGAKVDCVGLEELEEQEYD-------------------AVDEEEELSACSPSTE
A0A0D1C4I7_USTMA      RDLAARAG---------------------------------------------VASASFA
R9NYF0_PSEHS          RDLAALCD---------------------------------------------VTSASFT
A0A081CFS5_PSEA2      RDLAARAG---------------------------------------------VSSSTFS
F4P4U4_BATDJ          RSRFSDTKS----VFCFQSK----------------------------ELDSILSLTEST
                                                                                  

MOCOS_EMENI           SGLGSRREES--------------LGLFAYPAQSNMNGRRVPMRWCEQIRAQK--EN---
MOCOS_ASPFU           SRLCDVRSES--------------LKLFAYPAQSNMNGRRLPFSWCKKIRDQG--ET---
C0NNC6_AJECG          SC--HSPNAQSPV---------SVPTLFAYPAQSNMTGRRLPLDWCRKLRV---------
J3K5A2_COCIM          DGLGASPSGQEEK---------PYPKLFAYPAQSNMTGSRLGLEWCKSIRAK---TG---
I1RC08_GIBZE          QGESPFRDTTNS----------PPTTLFAYPAQSHMEGRRYPLSWTNHIQTTPQNTG---
C7YKM0_NECH7          KGNSPFMDTTYAS---------PPSTLFSYSAQSHMDGKRYPLTWSRDLREANRNPK---
F9FQI9_FUSOF          EGQFPFRNMTDNS---------SATTLFAYPAQSHMDGKRYPLTWAKNLRKLYRKPQ---
MOCOS_NEUCR           SGSCPFDDNEDE----------ERPILFAYPAQSNMDGRRFPLSWSSQICRQSLSPT---
D5G5P1_TUBMM          KGLCQDSPGG----------------LFGWPAQSNFSGRRLPGDWAARLRDN--------
U9SZA5_RHIID          QNTYQQETSIQNN---------IIYNLFAYPAQCNFSGSRFPLNWIQKIKRFN--KN---
MOCOS_DICDI           NDILEIIGNN-------DDNNNESYSLFGYPGQCNYSGTKYPLELINRIQKKY-------
F1A5V2_DICPU          SDIMEIIEGDQLSASKKSDDSQVSYSLFGFPGQCNYSGSKYPLSIINQIQKKF-------
D3BH81_POLPP          NDIVNVIQRE-------VQPNDGSYSLLAFPAQCNYNGSKYNLEVIKILKQKF-------
MOCOS_CAEBR           SCVNEDVVKE-------ECIPKVENSLFVFTAMSNF----LIPFQINEKLIS--------
MOCOS_CAEEL           SCVNEESILE-------HEIPDVEHSLFVLTAMSNFCGKKYSLESVHRLQEK--------
MOCOS_HUMAN           ASASNPDCQLP--------------HLFCYPAQSNFSGVRYPLSWIEEVKSGRLHPV---
H2QEG1_PANTR          ASASNPDCQLP--------------HLFCYPAQSNFSGVRYPLSWIEEVKSGRLRPV---
G3R2H1_GORGO          ASASNPDCQLP--------------HLFCYPAQSNFSGVRYPLSWIEEVKSGRLRPV---
G1R2Q1_NOMLE          ASASDPDCQLP--------------HLFCYPAQSNFSGVRYPLSWIKEVKSGRLRPV---
F7F1W1_CALJA          ASANDPDCKLP--------------HLFCYPAQSNFSGARYPLSWIEEIKSGWLCPV---
I3MGJ4_ICTTR          AVACDPNCQLL--------------HLFCYPAQSNYSGTRYPLSWIGEVKSGRMSPV---
MOCOS_BOVIN           AAAGDPAGQPP--------------HLFCYPAQSNFSGTRYPLSWIGEVKSGRRRPA---
F1PDQ7_CANLF          AAASDPDCQLP--------------HLFCYPAQSNFSGTRYPLSWIGEVKAGRMCPV---
G3T425_LOXAF          AASCDPDSQPL--------------HLFCYPAQSNFSGTRYPLSWIEGIKSGRMCPV---
H0WXY3_OTOGA          AAENDADCQLP--------------HLFCYPAQSNFSGTRYPLSWIADVQAGRRRPE---
G1SDV9_RABIT          AAACDPDCQLP--------------HLFCYPAQSNFSGTRYPLSWIAEVKAGRRSPV---
MOCOS_MOUSE           AGACDPDCQLP--------------HLFCYPAQSNFSGTRYPLSWVEEVKSGRRSPV---
F7BDB2_ORNAN          ESPREPSCKTR--------------HLFCYPAQSNFSGTRYPLSWIREVKAGNLSPM---
F6R8F7_MONDO          GAVYEPACETP--------------HLFCYPAQSNFSGTKYPLSWVEMLKSGRLSPM---
MOCOS_DANRE           QTNGEEECSTP--------------HLFCYPAQSNFSGRKYSLSYVKGIQSQQLYPAC--
G3NFC5_GASAC          QG---AACQTP--------------HLFSYPAQSNFSGRKYPLGLVRGIQARRLYPAC--
C3ZGY8_BRAFL          GSEKLDSGNATSRS----SG---PSHLFTYAAMCNFSGRKFPLNWCSKIKRKQFSLCE--
W4XCH4_STRPU          GTVDDSECNLL------------PNGLFAYPAQSNFCGHKYPLRWVKKVQDGILHHQT--
E0VP85_PEDHC          TNETYPTCNSI----------------FAYPAQCNYSGKKYPLEWIKKVHTGILDSYGNS
E9GUD0_DAPPU          KVSHDEKCSANQHE----KFEPSSNSLFVFPAQCNFSGFKYPLELIAFAQENGFSEMKSD
MOCO1_AEDAE           --------RSDNE----------HSSLIVFPAQCNFNGVKYPLELVRKIQRD--------
MOCO3_AEDAE           --------RSDSE----------HSSLIVFPAQCNFNGVKYPLELVRKIQRN--------
MOCOS_ANOGA           ----D-PRRQHPH----------RPSLLVFPAQCNFNGAKYPLELCELIERN--------
W5JIU0_ANODA          WSNGN-KSPLHHR----------GPSLLAMPAQCNFNGVKYPLELLETVSQN--------
MOCO2_AEDAE           -------RCSGGT----------KPSLLVFPAQNNFNAAKYPLDLVEEIQQN--------
MOCOS_DROME           KVHE----VSGKT----------GNSLLTFSAQCNFSGYKIPLEVIEQIQIDGLAKPGKE
MOCOS_DROPS           NGVD----GSSPG----------DNSLVTFSAQCNFSGYKIPLAAIAGIQKQGLAH-GLG
A0A158NCR0_ATTCE      TPRN---PNERQS----------SNSLFAFSAQCNFSGLKYPLKWIGDAHAGALSI----
F4WEC2_ACREC          SPCD---SNERQS----------SNSLFAFSAQCNFSGLKYPLKWISDAHAGSLSI----
A0A158ND12_ATTCE      TTIHDFYSNEKRN----------SNSLFVYSAQCNFSGLKYPLKWISDTHAGALSV----
MOCOS_BOMMO           KQTS----KYTNG----------GNCLVAYPAQSNFNGFKYPLNCIENIKNGCLNN----
MOCOS_ARATH           MRNTSKLQKEES--------RGNAYNLFAFPSECNFSGLRFNLDLVKLMKENTETVL---
MOCOS_SOLLC           RRNEGGVLKEGM--------TGNTYNLFAFPSECNFSGRKFDPNLIKIIKEGSERIL---
MOCOS_ORYSJ           QRRSKDVLSHNCQNGSLSDISGNNWNIFAFPSECNFSGQKFSLSLVKLIKEG--------
I1Q4H9_ORYGL          QRRSKDVLSHNCQNGSLSDISGNNWNIFAFPSECNFSGQKFSLSLVKLIKEG--------
I1GW21_BRADI          QRRGDNVLSHSCQNGSLSAISGNNWNLFAFPSECNFSGQKFNLNLVKLIKEGK---I---
A9RRC7_PHYPA          QRARASSHQRNN--------PAESINLFAFPLECNFSGAKFDLNLVKYVQDAR-------
H3G8M7_PHYRM          SSES------------------TPMSLFAFPAECNFSGTRHSLGLVDRIRSGR-------
A0A0D1C4I7_USTMA      EEDV-CEAAQE--------------GLIVLPLQCNATGRRYVHLAKQLRRSRS-------
R9NYF0_PSEHS          AESS-ANVNHE--------------GLVVLPLQCNATGKRYVDLAKRLRRSTS-------
A0A081CFS5_PSEA2      EEDADAVAGQA--------------GLVALPLQCNATGRRYFDLMKRICRTKA-------
F4P4U4_BATDJ          NGNVSSINADETH------------HLLSYPAQSNFSGERFPLEWVQAVRSLDHIPQPFS
                                                 .  .   :                         

MOCOS_EMENI           ------------ADNMIYTLLDAASFVSTSP---LDLSKIAAAPDFTVLSFYKIFGFPDL
MOCOS_ASPFU           ------------TGGNVYTLLDAASLVSTSP---LDLSDASAAPDFTVLSFYKIFGFPDL
C0NNC6_AJECG          --------------CNIYSLLDAASLVSTSP---LDLSDADSAPDFTVLSFYKIFGFPDL
J3K5A2_COCIM          ------------GKQNVFTLYDAAAHVSSSP---LDLSDSDSAPDFTVLSLYKIFGFPDI
I1RC08_GIBZE          ------------HR--TLTLLDASSFVATSR---LDLSNPQISPDFIVLSLYKIFGFPDL
C7YKM0_NECH7          ------------SR--LLTLLDASSFAATSR---LDLSDPTITPDFIVVSLYKIFGFPDL
F9FQI9_FUSOF          ------------HR--FLTLLDASSFAATSY---LDFSDPNLAPDFTVFSLYKIFGFPDL
MOCOS_NEUCR           ------------NKRKTYTLLDAAALVSSSP---LDLSNAETAPDFVVLSFYKIFGFPDL
D5G5P1_TUBMM          -------------RPGWYSLLDAAALVTSTP---LDLHNARVAPDFTVLSFYKMFGFPDL
U9SZA5_RHIID          ------------NNSKTLVLLDAAAYVSSSL---LSLSEVDTSPDFVTISFYKMFGFPTG
MOCOS_DICDI           --------------PKCKVLLDAASLVSTSS---FDLTKY--PVDFMTISFYKMFGYPTG
F1A5V2_DICPU          --------------KNVKVLLDAASLVGTSP---LDLSKY--PADFITISFYKMFGFPTG
D3BH81_POLPP          --------------KNLKILLDVASFVPTSP---FDLSEY--PADFIALSFYKMFGYPTG
MOCOS_CAEBR           ---------------GWSVCVDAAALVSGTR---LDLTAH--RPNFVAFSFYKIFGYPTG
MOCOS_CAEEL           ---------------GWAVCLDAASFVSSSA---LDLSQQ--RPNFIAFSFYKIFGYPTG
MOCOS_HUMAN           -----------STPGKWFVLLDAASYVSTSP---LDLSAH--QADFVPISFYKIFGFPTG
H2QEG1_PANTR          -----------STPGKWFVLLDAASYVSTSP---LDLSAH--QADFVPISFYKIFGFPTG
G3R2H1_GORGO          -----------NTPGKWFVLLDAASYVSTSP---LDLSAH--QADFVPISFYKIFGFPTG
G1R2Q1_NOMLE          -----------STPGKWFVLLDAASYVSTSP---LDLSAH--QADFVPISFYKIFGFPTG
F7F1W1_CALJA          -----------STLGKWFVLLDAASYVSTSP---LDLSVH--QADFVPISFYKIFGFPTG
I3MGJ4_ICTTR          -----------SVPGKWFVLLDAASYVTTSP---LDLSAH--QADFVPISFYKIFGFPTG
MOCOS_BOVIN           -----------SRPGKWFVLLDAAAFVGTSP---LDLSVH--QADFVPISFYKIFGFPTG
F1PDQ7_CANLF          -----------SVPGKWFVLLDAASYVSTSP---LDLSVH--QADFVPLSFYKLFGFPTG
G3T425_LOXAF          -----------NAPGKWFVLLDAASYVSTSP---LDLSVY--QADFVSVSFYKIFGFPTG
H0WXY3_OTOGA          -----------SLPGKWFVLLDAAAYVSTSP---LNLSAH--PADFVPISFYKIFGFPTG
G1SDV9_RABIT          -----------STPGKWFVLLDAASYVSTSP---LDLSAH--QADLVPISFYKIFGFPTG
MOCOS_MOUSE           -----------NAPGKWFVLLDAASYVSTSP---LDLSAH--QADFIPISFYKIFGLPTG
F7BDB2_ORNAN          -----------SEPGEWFVLLDAASYVSTSP---LDLTSH--PADFITVSFYKIFGFPTG
F6R8F7_MONDO          -----------TTPGKWFVLLDAASYVSTSP---LDLTIH--AADFIVISFYKIFGFPTG
MOCOS_DANRE           -----------EHHGQWFVLLDAACFVSCSP---LDLSQY--PADFVPISFYKMFGFPTG
G3NFC5_GASAC          -----------DHRGRWFVLLDAASHVSCSP---LDLQEC--PADFIPISFYKMFGFPTG
C3ZGY8_BRAFL          -----------ESRGQWYTCLDAACYVSTNQ---LDLSCC--EADFVALSFYKIFGFPTG
W4XCH4_STRPU          -----------GCRGNWYVVLDAAALVSTSP---LDLGTC--DADFVTISFYKMFGFPTG
E0VP85_PEDHC          ---------NRKRHSKWFCLLDAASYCSTSD---LDLSQV--HPDFVCISFYKIFGYPTG
E9GUD0_DAPPU          LCLNRELIRKQKKKNNWFCLLDAASFVGTNQ---LNLSVW--KPDMVVISFYKIFGYPTG
MOCO1_AEDAE           ------GISG-YGKERFRVCLDAASFVSTSF---LDLSKY--QPDFVCLSFYKIFGYPTG
MOCO3_AEDAE           ------GISG-YGKERFRVCLDAASFVSTSF---LDLSKY--QPDFVCLSFYKIFGYPTG
MOCOS_ANOGA           ------GLRG-YGGDAFHVCLDAASHVSTSP---LDLSRY--RPSFVCLSFYKIFGYPTG
W5JIU0_ANODA          ------GLPGPYEGDAFQVCLDAASYVSTSY---LDLTRH--KPSFVCVSFYKIFGYPTG
MOCO2_AEDAE           ------GLSG-YDDERFYVCLDAASYVSTNF---LDLGRY--RPDFVCMSFYKIFGYPTG
MOCOS_DROME           LWS-SLGEKKKNMHNDYYICLDAASFVATSP---LDLQKY--RPDYVCLSFYKIFGYPTG
MOCOS_DROPS           KRV-SGEAPQTTDNNNYYVCLDAASFVATNP---LDLQRY--RPDYVCISFYKIFGYPTG
A0A158NCR0_ATTCE      ----FAKKP----STRWYVLLDAASFAATNK---LDLSIF--KPDFVCLSFYKMFGYPTG
F4WEC2_ACREC          ----FAKKP----STRWYVLLDAASFAATNK---LDLSIY--KPDFVCLSFYKMFGYPTG
A0A158ND12_ATTCE      ----FAKKP----STKWYVLLDAASFAATNK---LDLSVY--KPDFVCLSFYKMFGYPTG
MOCOS_BOMMO           ----HLKKHLCEINSDWYVLLDAAAYVATSK---LDLAKV--QPDFVSLSFYKIFGFPTG
MOCOS_ARATH           ------QGSPFSKSKRWMVLIDAAKGCATLP---PDLSEY--PADFVVLSFYKLFGYPTG
MOCOS_SOLLC           ------ESSQYSRG-CWLVLIDAAKGCATNP---PNLSMF--KADFVVFSFYKLFGYPTG
MOCOS_ORYSJ           -------KIPLQQQGKWMVLIDAAKGCATEP---PNLTVY--PADFVVCSFYKIFGYPTG
I1Q4H9_ORYGL          -------KIPLQQQGKWMVLIDAAKGCATEP---PNLTVY--PADFVVCSFYKIFGYPTG
I1GW21_BRADI          ------VELPSSQQGQWMVLIDAAKGCATEP---PNLGVY--PADFVVCSFYKIFGYPTG
A9RRC7_PHYPA          -------HVSSSSRGRWMVLLDAAKGCGTAP---PDLSRF--PADFVAISFYKIFGYPTG
H3G8M7_PHYRM          ------WTNSSRKNSKWFVLLDAAKYVATQR---LDLSVH--HPDFVVLSFYKIFGYPTG
A0A0D1C4I7_USTMA      --------------EKAIVMVDAASFLSSSQNLNLSGWAAEELPDMIAFSCYKIFGHPTG
R9NYF0_PSEHS          --------------DRTLVMVDAASYLSSSQRLNLSLWSANEVPDLIAFSFYKIFGYPTG
A0A081CFS5_PSEA2      --------------DGSLVLLDAASYLSSSTRLYLSQLHADELPDMVAFSFYKIFGYPTG
F4P4U4_BATDJ          ------SHSSSCHKSNWRVLIDCASMVSTTR---LDLAKT--QADFAVVSFYKMFGFPTS
                                           * :           .        .    * **:** *  

MOCOS_EMENI           GALIVRKSSGD---VFKHRKFFGGGTVDMVLTDGNPWHAKKQ---SSIHQSLEDGTLPFH
MOCOS_ASPFU           GALIVRKSAGQ---IFEHRRYFGGGTVDMVLTRGLQWHAKKQ---SSIHDRLEDGTLPFH
C0NNC6_AJECG          GALIVRKSAHN---IFDKRKYFGGGTVGMVTSLEDQWHAKKS---TSVHDQLEDGTLPFH
J3K5A2_COCIM          GVLIVRKEARH---TFEKRTYFGGGTVGMVISLGEEWHAKRN---DAVHDGLEDGTLPFH
I1RC08_GIBZE          GALLVKRSSEW---VFDNRRYFGGGTVEMVVSGKEKWHAPKS---YSLHERLEDGTLPFH
C7YKM0_NECH7          GALLVRRSAEW---VFDHRKYFGGGTVDMVVCGKEKWHAPKS---HSLHERLEDGTLPFH
F9FQI9_FUSOF          GALLVKRSSEW---VFNNRRYFGGGTVDMVVSGKEKWHAPKS---QFLHERLEDGTLPFH
MOCOS_NEUCR           GALIVRKEVQD---VFLSRRYFGGGTVDMVVCLKEQWHAPKD---GFLHERLEDGTLPIH
D5G5P1_TUBMM          GALIIRKDSAD---ILKSRRYFGGGTVDAVVSRTQNFHARKV---DSIHAHLEDGTPAFH
U9SZA5_RHIID          LGALIVKNELE---PILRKRYFGGGTLDSIVYDRPWQKFRK-----SLHERYEDGTVNFL
MOCOS_DICDI           IGALIVKNDSGE-KCLINKKYFSGGTVNVSMAQER-FHVD----RPSLSERLEDGTINFM
F1A5V2_DICPU          LGALIVKNDSS---SILNKVYFSGGTVNASMAQER-FHVH----RDNIAAKFEDGTIDYM
D3BH81_POLPP          LGALIIKNDCF---PLLNKVYFGGGTVNASLSYER-FHVF----RDVLHQKFEDGTLPYQ
MOCOS_CAEBR           IGALLVKKDSS---KSIEKTSFAGGTVQSVDEMTM-HFVI----RD-FERAYEEGTINSY
MOCOS_CAEEL           IGALLVRKDSA---HLIEKTSFAGGTVQSVDEMSM-FFVL----RE-FERAFEEGTLNYY
MOCOS_HUMAN           LGALLVHNRA---APLLRKTYFGGGTASAYLAGED-FYIP----RQSVAQRFEDGTISFL
H2QEG1_PANTR          LGALLVHNRA---APLLRKTYFGGGTASAYLAGED-FYIP----RQSVAQRFEDGTISFL
G3R2H1_GORGO          LGALLVHNRA---APLLRKTYFGGGTASAYLAGED-FYIP----RQSVAQRFEDGTISFL
G1R2Q1_NOMLE          LGALLVHNHA---APLLRKTYFGGGTASAYLAGED-FYIP----RLSVAQRFEDGTISFL
F7F1W1_CALJA          LGALLVHNRV---APLLRKTYFGGGTASAYLAGED-FYIP----RPSVAQRFEDGTISFL
I3MGJ4_ICTTR          LGALLVNNRV---APLLRKNYFGGGTAAAYLAGED-FYIP----RQSVTERFEDGTISFL
MOCOS_BOVIN           LGALLVNNRL---AALLRKTYFGGGTAAAYLAGDD-FYVP----RESVAERFEDGTISFL
F1PDQ7_CANLF          LGALLVNNRV---APLLRKTYFGGGTAAAYLAGED-FYIP----RSSVAERFEDGTISFL
G3T425_LOXAF          LGALLVNNRM---APLLRKTYFGGGTAAAYLAGED-FYVP----RQSVSERFEDGTISFL
H0WXY3_OTOGA          LGALLVNNRV---APLLRKTYFGGGSAAAYLAGED-FYVP----RPSVAERFEDGTISFL
G1SDV9_RABIT          LGALLVHNRV---APLLRKTYFGGGTAAAYLVGED-FYVP----RSSVTERFEDGTISFL
MOCOS_MOUSE           LGALLVNKHV---APLLRKGYFGGGTAAAYLAGED-FYVP----RSSVAERFEDGTISFL
F7BDB2_ORNAN          LGALLVNNRI---APFLRKTYFGGGTASAYLAGED-FYVP----HQSVAERFEDGTISFL
F6R8F7_MONDO          LGALLVNNRV---SHFLQKTYFGGGTAAAYLVGED-FYVP----RKSVSERFEDGTISFL
MOCOS_DANRE           LGALLVRNEA---AEVLRKTYFGGGTAAAYLVEEN-YFIP----KPNLASRFEDGTISFL
G3NFC5_GASAC          LGALLVRNDA---AGVLKKTYFGGGTAAAYLSGED-YYVQ----AANISDRFEDGTVSFL
C3ZGY8_BRAFL          LGALIVRKDA---EDLLRKTYFGGGTAMAVTSNGR-FYIP----RPNLHDRFEDGTLPFL
W4XCH4_STRPU          LGALIVRNDS---AGVLVKEYFGGGSVMAYLAKER-FSKS----RTELAERLEDGTLPFL
E0VP85_PEDHC          LGALLVRNQS---SYVLKKKYFGGGTVEIALPFQN-YHKK----RKTLHERFEDGTIPFL
E9GUD0_DAPPU          LGALIVHRRA---NCVLQKKYVGGGTVDVVSSSRD-FHAA----RQLLEEKFENGTINFL
MOCO1_AEDAE           LGALLVHHTAA--DQLR-KKYYGGGTVKIAMAGRI-FHVK----RDPLVERFEDGTLAFT
MOCO3_AEDAE           LGALLVHHTAA--DQLR-KKYYGGGTVKIAMAGRN-FHVK----RDPLVERFEDGTLAFT
MOCOS_ANOGA           LGALLVRRDAE--PLLRGKRYYGGGTVKIALSGPDRFHER----RDALPDRLEDGTINFL
W5JIU0_ANODA          LGALLVRKDAE--RYLTGKRYFGGGTVQIAMSGRD-FHVP----RTRLSDRFEDGTLNFL
MOCO2_AEDAE           LGALLIRNGSE--DVLD-KKYYGGGTIKIMLSGQN-LHLK----HDDLVTRFEDGTQPFL
MOCOS_DROME           VGALLVSRRGA--EVFQKRR-FFGGGTINYAYPHAMDYQL----RETFHQRYEDGTLPFL
MOCOS_DROPS           VGALLVSRRGA--EAFRKKRNFFGGGTINYAYPHAMDHQL----REVFHQRYEDGTLPFL
A0A158NCR0_ATTCE      IGALLVKNKSS--DVL-DKMYYGGGTVDIALSSER-FHRK----RQILYERFEDGTVPFL
F4WEC2_ACREC          IGALLVKNKSS--DVL-NKIYYGGGTVDIALSSER-FHRK----RSILYERFEDGTVPFL
A0A158ND12_ATTCE      IGALLVKNKSS--DVL-DKMYYGGGTVDVALSFER-FHRK----RQILYQRFEDGTLPFL
MOCOS_BOMMO           LGALLVKKSSE--NVLSQKRYFGGGTVDALLSNEH-YHIK----REIFHERFEDGSLSFL
MOCOS_ARATH           LGALLVRNDAA---KLLKKTYFSGGTVAASIADIDFVKRR-----ERVEEFFEDGSASFL
MOCOS_SOLLC           LGALIVRKDAA---KLMKKTYFSGGTVTAAIADVDFFKRR-----EGVEEFFEDGTISFL
MOCOS_ORYSJ           LGALIVKNEAA---NLLNKTYFSGGTVAASIADIDFVQKR-----KNIEQVLEDGTISFL
I1Q4H9_ORYGL          LGALIVKNEAA---NLLNKTYFSGGTVAASIADIDFVQKR-----KNIEQVLEDGTISFL
I1GW21_BRADI          LGALIVKNEAA---SLLNKTYFSGGTVAASIADIDFAKQR-----KNIEQVLEDGTISFL
A9RRC7_PHYPA          LGALLIRRDAA---SLLKKKYFGGGTVAMSIADADVMRKR-----DRVEQWLEDGTTSFL
H3G8M7_PHYRM          LGALVVRKAAL---TQLKKRYHGGGTVQSILATRNYTVPRGLDCSEDISSRFADGTQSFL
A0A0D1C4I7_USTMA      LGGLLVKRSAA--GRLQHKTYYGGGTVDSILAEARWTKPR-----KDFEARLEDGTSNIH
R9NYF0_PSEHS          LGGLLVRRSAA--PWLLHKTYHGGGTVDSILAESRWTKPR-----KDLEARLEDGTSNIH
A0A081CFS5_PSEA2      IGGLLVKASAA--PHLGGKTYFGGGTVDAILAESAWTKPR-----REFEARFEDGTVNVH
F4P4U4_BATDJ          LGALIVRNDATSLLTTSPRKYFGGGTVAAIAANSEYHRFR-----SGVAEQLEEGTLPFT
                         ::             :    **                      .     :*:    

MOCOS_EMENI           SIIALDSAFETHGRLFRS------MENVASHTRFLAKRLRDRMNALKHYN---GTKVCQL
MOCOS_ASPFU           NIIALDSAFATHERLFGS------MQNISSHTRFLAKRLYDRLNALRHFN---GQRVCEL
C0NNC6_AJECG          SIIALHSALDVHERLYGS------MENISRHTGSLTKILYDSLAAKRHAN---GTVVCEM
J3K5A2_COCIM          SIVAVHSALDVHKRLYGS------MRNVSWHTAALAKNLYCRLEGLRHSN---GEKVCEI
I1RC08_GIBZE          NIVALDIAMKVHERLFGS------MDQVSSHTSYLSQRMLQGLGNLRHAN---NTPVCTM
C7YKM0_NECH7          SIIALDIAMEVHERLFGT------MDEIKSHTSYLSRRLLRELSELRHAN---GEPVCAL
F9FQI9_FUSOF          NIVALDIAMDIHRRLFGS------MDQISSHTSYLAQRMFQELSNMRHAN---GAPVCKI
MOCOS_NEUCR           SIIALDVAMDVHAKLFGS------MERVAGHTGFLARRLYQGLKGLRHAN---DELVCAI
D5G5P1_TUBMM          SILALGTAISTHERLYCS------FNNISRHTFSLTQALHVLLSELVHRN---GRKLCQI
U9SZA5_RHIID          DIIALDHAFDTSERLYNN------FDLIKNHVTSLIIYLSRSMKSLRHYN---GQPVCYI
MOCOS_DICDI           NIISLKHGFNIINNQL------GGIDNVKLHTFSLTQYCKEEMLKLYHSDNSKQQQLCII
F1A5V2_DICPU          NIISLKEGFDQLERL--------GMENIQSHTFSMVQWLKEEISKLTHSN---QMPLCLL
D3BH81_POLPP          SIVSLKYGLDILDGL--------GMENIKKHTFSLIQYLRDKMVELKHSN---GSPLLVI
MOCOS_CAEBR           GIAQLQKGFEEIERC-------GGMQAIRAHTYDLRSKAVQILQSKTHPN---GKKVVEI
MOCOS_CAEEL           GIAQLQKGFEEIERC-------GGISSIRNLTHHLCKNALYMLKSKKHPN---GRPVVEI
MOCOS_HUMAN           DVIALKHGFDTLERLTGG------MENIKQHTFTLAQYTYVALSSLQYPN---GAPVVRI
H2QEG1_PANTR          DVIALKHGFDTLERLTGG------MENIKQHTFTLAQYTYVALSSLQYPN---GAPVVRI
G3R2H1_GORGO          DVIALKHGFDTLERLTGG------MENIKQHTFTLAQYTYMALSSLQYPN---GAPVVRI
G1R2Q1_NOMLE          DVIALKHGFDTLERLTGG------MENIKQHTFTLAQYTYVALSSLQYPN---GAPVVRI
F7F1W1_CALJA          DVIALKHGFDTLERLTGG------MENIKQHTFTLVQYTYEALSSLQYPN---GAPVVRI
I3MGJ4_ICTTR          DIIALKHGFDALERLTGG------MENIRQHTFTLAQYTYTALSSLHYPN---GAPVVRI
MOCOS_BOVIN           DVIALKHGFDALERLTGG------MESIRQHTFTLAQYTYTALSSLRYPN---GAPVVQI
F1PDQ7_CANLF          DVIALKHGFDALERLTGG------MENIKQHTFTLAQYTYTALSALRYPD---GAPVVRI
G3T425_LOXAF          DVIALKHGFDTLECLTGG------MENIKQHTFTLAQYTYSALSSLRYPN---GAPVVRI
H0WXY3_OTOGA          DVIAVKHGFDALERLTGG------MENIKQHTFALAQYTYAALASLRYPN---GAPVVRI
G1SDV9_RABIT          DVIAVKHGFDTLERLTGG------MENIQQHTFSLARYTYTALSSLRYPN---GAPVVRI
MOCOS_MOUSE           DVIALKHGFDALEHLTGG------MVNIQQHTFALVQYTHSALSSLRYLN---GAPVVRI
F7BDB2_ORNAN          DIIALKHGFDTLEMLTGG------MEKIQQHTFTLTRYTYTVLASLRYPN---GAPVVRI
F6R8F7_MONDO          DIIALKHGFDILERLTGG------MENIKQHTFALAHYTYTVLVALRYPN---GAPVIQV
MOCOS_DANRE           DIISLHHGFETLQKLTGS------MTNIQLHTFGLARYTYTVLSCLCHSN---GKHVAQI
G3NFC5_GASAC          DVIAVNHGFDALYRITGG------MHNIQRHTYGLARYTYMLLSSLCHGN---GRPVAQI
C3ZGY8_BRAFL          DIIALRHGFDTMEKLTGG------MLHVSQHTFSLAHYVYLQLTSLKHHN---GQPVAVV
W4XCH4_STRPU          DIVSLRHGFDALEKLGGG------MKSISEHTFLLAKYVCNQLSSWKHYS---GQPVCEM
E0VP85_PEDHC          TIISLEHGLNTLNRLNLN------MKLISNHVFELARLTVKKLKSLIHWN---GTPAVEI
E9GUD0_DAPPU          AILSLRHGMRELKRLVTT------MENVSIHTFQLGQLLYVTLRKLKYAN---GKSLVKI
MOCO1_AEDAE           SIIALLQGFETLERLVPSTAGLRTIERISQQTFHIGRYCYNRLKALRHSN---ENAVVKL
MOCO3_AEDAE           SIIALLQGFETLERLVPSTAGLRTIERISQQTFHLGRYCYNRLKALRHSN---GNAVVKL
MOCOS_ANOGA           SIAALLPCLETLTRLIP----GPTMDRIQRHTFQLARHCYRELQALQHAN---GGRVVDL
W5JIU0_ANODA          AVASLLACMEQLERLIPPTPTRTTIERISQHTFQLAQHCYRQLQQLEHAN---GSKVVEL
MOCO2_AEDAE           SIISLLEGMNTIQRLIPAANGYRPMERISKHVFSLAKYCYRKLGTLQHAN---GKKAILF
MOCOS_DROME           SIVGLLEGFRTLERLVPRTDEFSTMERISRHVFGLAKYLEDQLRQLHHPN---GEPLVKL
MOCOS_DROPS           SIVGLLEGFRTLGRLVPRRSDVATMERISRHVHGLAQYLEKQLRQLKYPN---GQPLIEL
A0A158NCR0_ATTCE      SIVSLQYGFEILSKLT--------MDQISKHVFSLAKTLHHSLLTLHHCN---GKPVVKL
F4WEC2_ACREC          SIVSLQYGFEILSKLT--------MDQISKHVFSLAKTLHHSLLTLHHCN---GKPVVKL
A0A158ND12_ATTCE      SIASLQYGFEILSKLT--------MDQISKHVFSLAKTLHHSLLTLHHCN---GKPVVKL
MOCOS_BOMMO           SIISLKQCLDTMYRIIPRIIHDDIMETISYHTFYLAKDLYCQLLDLRHRN---GTKAIKF
MOCOS_ARATH           SIAAIRHGFKLLKSLTPS--------AIWMHTTSLSIYVKKKLQALRHGN---GAAVCVL
MOCOS_SOLLC           SITAIQHGFKIINMLTTS--------SIFRHTTSIAAYVRNKLLALKHEN---GEFVCTL
MOCOS_ORYSJ           NIASLRHGFKIIEMLTTS--------AIERHTTSLATYVRNKMLDLKHSN---EINVCTI
I1Q4H9_ORYGL          NIASLRHGFKIIEMLTTS--------AIERHTTSLATYVRNKMLDLKHSN---EINVCTI
I1GW21_BRADI          SIASLRHGFKIIDMLTTS--------AIARHTASLATYVRKKMLEMKHNN---KKNVCII
A9RRC7_PHYPA          GISALRHGFALINRIHLP--------NLNMHTGALTKYFANTLAGLKHEN---EVTVCVL
H3G8M7_PHYRM          SILALRHGINQVEKLGME--------NISAHTTALRTLLVDKFTALKHWN---NRPICEI
A0A0D1C4I7_USTMA      AILAVNTALDYYRKVFGP------WDLRGHYVASLGSKLVQGMQSMRHGN---GNPVVQL
R9NYF0_PSEHS          GILAVNTALDYYEKAFGL------WDLRGDYVGGLSSRLVQAMEGLRHGN---GNPVVRI
A0A081CFS5_PSEA2      GILAVNRALDYYAQSFGA------WDARREYVAGLSDKLVSALTGLRHGN---GNAVVRM
F4P4U4_BATDJ          EILALNHGFEFVEKTIGG------WDILSQHVTDLAEYAQSRLGELRHETDH-QLPVCKL
                       :  :   :                      .  :       :    :           .

MOCOS_EMENI           YMSPNSSYDDASSQGPILAFNLRNSRGMWIGKSEVERLASIKNIQIRSGTLCNPGGTALS
MOCOS_ASPFU           YKSPRSDYNQPSTQGPIIAFNLRNSQGSWIGKSEVERLAATKNIQIRSGSLCNPGGTSGS
C0NNC6_AJECG          YKHKDSSFDERTTQGPIVSFNLRNSDGEWVGKSEVEKLAAVKNIQIRSGTLCNPGGMAYH
J3K5A2_COCIM          YKSSYSTYGDPATQGPVVAFNLKDSRGSWVGSSDVEKLAAVKDIHIRSGGLCNPGGIASY
I1RC08_GIBZE          YTTTS-GEGDLGN-GPIVSFNLRNSHGAWISLAEFEKLANLKSINIRTGGLCSPGGVAAA
C7YKM0_NECH7          YTKASSGVESLGT-GPVVSFNLRNSRGAWVSLTEFEKLANLKKMHIRTGGLCSPGGIASA
F9FQI9_FUSOF          YTSASSDKNTLGN-GPVVSFNLRNSQGAWISLAEFEKLANLKNIHIRTGGLCSPGGIASA
MOCOS_NEUCR           YSPDP---ETEES-GPLVAFNIRNAQGIWISLAEVEKLATLKGIHIRTGGVCNPGGIASA
D5G5P1_TUBMM          YSPGG--HTSSITQGPIVAFNMQRADGSWIGYAEVEKLASVKNIHIRTGGLCNPGGIETS
U9SZA5_RHIID          YSNRD--FSNNTLQGPVFSFNAKRADGSWVGYLELERLASVNNIHIRTGRLCNPGSSARW
MOCOS_DICDI           YSDNHFK-DSSKQ-GSIINFNIFRSNGELFGYNQVEKLASLSSIYLRTGCFCNPGACHGY
F1A5V2_DICPU          YTDNHYK-DPNKQ-GAIINFNLLRSTGEMVGYNEVEKLASLSNIFIRSGCFCNPGACHGY
D3BH81_POLPP          YADNHYI-DSNRQ-GAIINFNVLKTNGQPVGFNEVEKLASLCNIHLRIGCFCNPGACHSY
MOCOS_CAEBR           YSQPHIQVSPETQ-GAIVAFNLVRPDNGYYGYTEVEKMCAIFGIELRTGCFCNIGACKKY
MOCOS_CAEEL           YSQSEQFENPDKQ-GPIVAFNLKRPDGGYYGYTEVEKMCAIFGIELRTGCFCNIGACKKY
MOCOS_HUMAN           YSDSEFS-SPEVQ-GPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRTGCFCNTGACQRH
H2QEG1_PANTR          YSDSEFS-SPEVQ-GPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRTGCFCNTGACQRH
G3R2H1_GORGO          YSDSEFS-SPEVQ-GPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRTGCFCNTGACQRH
G1R2Q1_NOMLE          YSDSEFS-SPEVQ-GPIINFNVLDDKGNIIGYSKVDKMASLYNIHLRTGCFCNTGACQRH
F7F1W1_CALJA          YSDSDFS-SPEVQ-GPVINFNVLDDKGNIIGYSQVDKMASLYNIHLRTGCFCNTGACQRH
I3MGJ4_ICTTR          YRDSDFS-SPDVQ-GPVINFNVLDDNGNVIGYSQVDKMASLYNIHLRTGCFCNTGACQRH
MOCOS_BOVIN           YSDSDFS-SPEVQ-GPVISFNVLDDHGNVVGYSQVDKMASLHNIHVRTGCFCNTGACQRH
F1PDQ7_CANLF          YSDSEFS-SPEEQ-GPIINFNVLDHSGNIIGYSQVDKMASLYNIHVRTGCFCNTGACQRH
G3T425_LOXAF          YSDSEFS-SPEVQ-GPIINFNVLDDRGNVIGYSQVDKMASLYNIQVRTGCFCNTGACQRH
H0WXY3_OTOGA          YSDSEFS-SPEVQ-GPIINFNVLDDIGNVIGYSQVDKMASLYNIHLRTGCFCNTGACQRH
G1SDV9_RABIT          YSDTEFS-SPEVQ-GPIINFNVLDDNGDVIGYSQVDKMACLHNIHLRTGCFCNTGACQRH
MOCOS_MOUSE           YSDSEFS-SPDVQ-GPIINFNVLDDGGKIIGYSQVDKMASLYNIHLRTGCFCNLGACQRH
F7BDB2_ORNAN          YSDTEFD-DPATQ-GPIINFNVLDENGHVVGYSQVDKMASLHNIHVRTGCFCNTGACQRH
F6R8F7_MONDO          YSDTEFN-SPEIQ-GPIINFNVLDDNGDIIGYSQVEKMASLHNIHVRTGCFCNTGACQRH
MOCOS_DANRE           YCDNDFQ-SIAEQ-GAIINFSLLDCHGRTVGYSQVDKMASLFNIHIRTGCFCNTGACQHY
G3NFC5_GASAC          YTEGLFE-SPNTQ-GAILNFNLRDSHGQIIGYSQVDTMASLYDIHVRTGCFCNTGACQSF
C3ZGY8_BRAFL          YTDTDFD-DISTQ-GGIVNCNLLRANGDFVGYSEVDKLAALHDIHLRTGCFCNSGACRKY
W4XCH4_STRPU          YNRSGFD-SVDHQ-GPIVNFNLLRSNGEHAGYAEFERLASLHDIHLRTGCFCNTGACQHY
E0VP85_PEDHC          YADTNYD-DVRTQ-GGIVNFNLKRANHQYIGFVEVLHMANLRKIYIRTGCFCNLGACQKH
E9GUD0_DAPPU          YSHTEFT-DRHRQ-GAIVTFNLMTEKGDYIGYAHVEKILALYDIHVRTGCFCNPAACQKF
MOCO1_AEDAE           YHDTGFE-DRGLQ-GGIVNFNILHEDGTYVGFAEVSYMASLHNILLRTGCFCNPGACQRH
MOCO3_AEDAE           YHDTGFE-DQGLQ-GGIVNFNILHEDGTYVGFAEVSYMASLHNILLRTGCFCNPGACQRH
MOCOS_ANOGA           YHDTAFG-DARTQ-GAIVNFNVLNDDGGHVGFAEVACMAANHGIYLRTGCFCNPGACQRH
W5JIU0_ANODA          YHDTAYS-DGRSQ-GPIVNFNVLNDDGGYVGFAEVACMASNHGIYLRTGCFCNPGACQRH
MOCO2_AEDAE           YSDTRYE-TRDRQ-GGIVTFNVLKDDGSHLGFSEFAKFAGQHQIYVRTGCFCNAGSCQKH
MOCOS_DROME           YNKVGYQ-DKSRQ-GGIVAFNVRTESGSFVGFGEIACVAALHGILLRTGCFCNIGACQYY
MOCOS_DROPS           YNRVGYE-ERHRQ-GGIVAFNVRTDAGPFVGFGEIACVAALQGILLRTGCFCNIGACQRY
A0A158NCR0_ATTCE      YSDSDYE-DRSSQ-GGIVAFNVMRSNGEYVGYMEVLNMAASFKIHLRTGCFCNPGACQRH
F4WEC2_ACREC          YCDSDYE-DRSSQ-GGIVAFNVMRSNGEYVGYMEVLNMAASFKIHLRTGCFCNPGACQRH
A0A158ND12_ATTCE      YSDSDYE-DHSSQ-GGIVAFNVMRSNGEYIGYMEVLNMAAIFKIHLRTGCFCNPGACQRH
MOCOS_BOMMO           YLDSDFS-DITKQ-GGVLTFNLVREDGTYIGFSEFQHMADLFNISVRTGCFCNSGSCQRH
MOCOS_ARATH           YGSENLELSSHKS-GPTVTFNLKRPDGSWFGYLEVEKLASLSGIQLRTGCFCNPGACAKY
MOCOS_SOLLC           YG-----LLSSEM-GPTVSFNMKRPDGTWYGYREVEKLATLAGIQLRTGCFCNPGACAKY
MOCOS_ORYSJ           YGQQYSKVEGLKM-GPTITFNLKREDGSWFGYREVEKLASLFGIHLRTGCFCNPGACAKY
I1Q4H9_ORYGL          YGQQYSKVEGLKM-GPTITFNLKREDGSWFGYREVEKLASLFGIHLRTGCFCNPGACAKY
I1GW21_BRADI          YGQQASKVADLKM-SPTITFNLKREDGTWFGYREVEKLASLSGIHLRTGCFCNPGACAKY
A9RRC7_PHYPA          HGNH--DLDHCNQ-GPIVTFNLKRADGSWVGHREVEKLAALENIQLRTGCFCNPGACAKY
H3G8M7_PHYRM          YANDN---RIKQQ-GPTVACNFLRSDGSYVGYSEVHKLAEIHNIHLRTGCFCNPGACQHY
A0A0D1C4I7_USTMA      YRGRG---DAGADRGPIVNFNILTANGFIVPPQEVDRLASISNIHLRMGRHCNPGFVTSQ
R9NYF0_PSEHS          YRGRG---QIEAEFGPIVNFNVLAADGTIVPPQEVDRLASISNIHLRTGRHCNPGFVTSQ
A0A081CFS5_PSEA2      YRDAD---VRAEGFGPIVNFNLLTATGAIVPPQEVDRLASISNIHMRMGRHCNPGFVTTH
F4P4U4_BATDJ          YSPMTQN-----TKGPIIAFNIQTSTGTLIHHSQFMTLASIHNINIRSGCFCNPGACQQY
                      :             .  .  .            ..  .     : :* *  *. .     

MOCOS_EMENI           LGWTGADMLRHFS-AGMRCGDDHDIMDE--RPTGILRISLGAMSSLTDVDTFIAFLEEFY
MOCOS_ASPFU           LGWTGADLLQQFS-AGLRCGDDHDVMDG--RPTGVLRLSLGPMTNLEDINTFVELVEEFY
C0NNC6_AJECG          LGLKTEEMKRNYN-AGQRCGDDNDIIDG--KPTGGLRVSLGAMSSIRDVNRFLDFIDEFY
J3K5A2_COCIM          LHFNPEEMKRNYT-SGLRCGDETDLMGE--KPSGAIRVSLGAMSSMRDIDTFVNFISDFY
I1RC08_GIBZE          LDLQPWEMRKNFS-AGFRCGTDNDIMSG--KPTGVIRASLGAMSTEADVDNFVAFIDDFY
C7YKM0_NECH7          LGLQPWEMKKNFS-AGFRCGADNDIMSG--KPTGVIRASLGAMSTKADVDRFVDFIKEFY
F9FQI9_FUSOF          LDLQPWEMKKNFS-AGFRCGADNDIMSG--KPTGVIRASLGAMSTKTDVDGFVAFLKEFY
MOCOS_NEUCR           LGLEPWEMKQNFS-SGFRCGTDNDTMGG--KPTGIIRVSLGAMSTIADVDRFVQFVKEFY
D5G5P1_TUBMM          VGVEPWEIKQNYL-AGHRCWDEQDVMHG--KPTGAIRASLGAMSTIDDLMVFVKFLEEFY
U9SZA5_RHIID          TKLDSEDIIDSFY-NGKTCHDDQDMWNG--KPAGTIRISVGAMTTIDDILIWMNFFKKYY
MOCOS_DICDI           LNLSKKDIEQHLK-DGHVCWDSKDILNG--KPTGSVRISFGYMNNFNDVYKFINFLKSNF
F1A5V2_DICPU          LNLTKSDIEEHLK-EGHICWDDKDILNG--KPTGSLRLSLGYMNNFEDLYKFVEFLKTNF
D3BH81_POLPP          LSLTRDDVEKHLK-DGHVCWDDKDIIDG--KLTGSIRVSLGYMSNFKDIFTFIEFLKDNF
MOCOS_CAEBR           LGITSEMIKENMS-KGKRCGDEIDLING--RPTGAVRISFGRMSTEQDIEVLKQMIDTCF
MOCOS_CAEEL           LGITSEMIQENMS-KGKRCGDEIDLING--TPTGAIRISFGRTSTEHDITALEQMIDTCF
MOCOS_HUMAN           LGISNEMVRKHFQ-AGHVCGDNMDLIDG--QPTGSVRISFGYMSTLDDVQAFLRFIIDTR
H2QEG1_PANTR          LGISNEMVRKHFQ-AGHVCGDNMDLIDG--QPTGSVRISFGYMSTLDDAQAFLRFIIDTR
G3R2H1_GORGO          LGISNEMVRKHFQ-AGHVCGDNMDLIDG--QPTGSVRISFGYMSTLDDVQAFLRFIIDTR
G1R2Q1_NOMLE          LGISNEMVKKHFQ-AGHVCGDNMDLIDG--QPTGSVRISFGYMSTLDDVQAFLRFIIDTR
F7F1W1_CALJA          LGISSEMVRKHFQ-AGHVCGDNMDLIDG--HPTGSVRISFGYMSTLDDAQAFLRFIIDTC
I3MGJ4_ICTTR          LGISNEKFKKHLQ-AGHVCGDDVDLIDG--QPTGSVRVSFGYMSTLEDAQAFLRFIIATR
MOCOS_BOVIN           LGISDEMVKKHLQ-AGHVCGDDVDLIDG--QPTGSVRISFGYMSTLEDAQAFLRFIIATR
F1PDQ7_CANLF          LGISDEMVKKHLQ-AGHVCGDDVDLIDG--QPTGSVRISFGYMSTVEDAQAFLRFIIAMQ
G3T425_LOXAF          LGISNERVKKHLQ-AGHVCGDNIDLIDG--QPTGSVRISFGYMSTLEDAQTFLRFIIATR
H0WXY3_OTOGA          LGISNVMVRKHVQ-AGHVCGDDIDLIDG--QPTGSVRISFGYMSTLEDAQAFLRFIIGTR
G1SDV9_RABIT          LQISNEMVKKHHQ-AGHVCGDNVDLIDG--QPTGSVRISFGYMSTLEDAQAFLTFIRATW
MOCOS_MOUSE           LGLSDEMVKKHFQ-AGHVCGDDVDIIDG--RPTGSVRISFGYMSTLEDAQAFLRFISTIY
F7BDB2_ORNAN          LEISNETVKRNLQ-AGHVCGDNMDIIDG--QPTGSVRISFGYMSTLADAQAFLKFILVTR
F6R8F7_MONDO          LKISNETIKKNLQ-AGHICGDDIDLIDG--HPTGSVRISFGYMSTIEDAQTFLKFIITTR
MOCOS_DANRE           LAISNQNVKSNLH-AGHICGDNIDLVDG--RPTGSLRVSFGYMSSFEDCQNFLRFVVNCF
G3NFC5_GASAC          LGITNEQMRKNLQ-AGHVCGDRVDTVDG--QPTGSVRVSFGYMSTFEDCEKFLRFVAECF
C3ZGY8_BRAFL          LGLSNQQIKDNYQ-AGHVCGDDKDLISG--QPTGSIRVSFGYMSTFEDAQFFLDFVQECF
W4XCH4_STRPU          LNISDQDIKDNLD-AGHVCGDDMDLING--RPTGSVRISFGYMSNQEDADRFLKFVKNYF
E0VP85_PEDHC          LNLSDADLKLYYQ-AGHVCGDAKDLIDG--KPTGSIRVSFGYMSTENDVNKLVNMIKETF
E9GUD0_DAPPU          LDLSEEDLCSNYL-SGHKCGDENDLIDG--RPTGAVRVSFGYMSQGNDVVQFVNILRQCQ
MOCO1_AEDAE           LQLSDEDVLKQFD-AGHVCGDANDLIDG--QPTGSVRVSFGYMTRKEDIDCLLEMIEKCY
MOCO3_AEDAE           LQLSDEDVLKQFD-AGHVCGDANDLIDG--QPTGSVRVSFGYMTRKEDIDCLLEMVEKCY
MOCOS_ANOGA           LRLADDDLLRHYR-AGHVCGDANDLIDG--QPTGSVRVSFGYCTRRSDVDRLVAMVRRCY
W5JIU0_ANODA          LRLSDDDIRRHFQ-AGHVCGDANDLIDG--QPTGSVRVSFGYMNRLADVERLIGMISRCY
MOCO2_AEDAE           LGLTDEDILMFYE-MGKVCGDDTDMIEG--RPTGTVRVSFGYMNKKEDVNRLVDMINDCF
MOCOS_DROME           LGLDEDALDAIYKRAGRICGDYFDLIDG--QPTGAVRVSFGYMTTIQDVDKLLQMLRSSY
MOCOS_DROPS           LGLDETMMDAIYKRAGRICGDYYDLIDG--QPTGAVRVSFGYMTRRQDVDELLKMLQLSY
A0A158NCR0_ATTCE      LSFSTKEILKYYE-AGYICGGETDLING--KPIGAVRISFGYMSTIKDVQTVLLMITK-F
F4WEC2_ACREC          LSFSTKEILKYYE-AGYICGGETDLING--KPIGAGLEYDREWTIVTSSGTCLT------
A0A158ND12_ATTCE      LSLSTKDILQNYE-AGYTCGGIADLING--KPTGAVRISFGYMSTIEDVQTILLMITKCF
MOCOS_BOMMO           LHMSNKDMKDMYN-AGHRCGDEVDLINE--KPTGAIRISFGYYNTFEDVDKFVNMICRCF
MOCOS_ARATH           LELSHSELRSNVE-AGHICWDDNDVING--KPTGAVRVSFGYMSTFEDAKKFIDFIISSF
MOCOS_SOLLC           LGLSHLDLLSNIE-AGHVCWDDRDILHG--KPTGAVRVSFGYMSTFEDAMKFVNFVESNF
MOCOS_ORYSJ           LGLSHSDLVSNFE-AGHVCWDDNDIING--KPTGAVRISFGYMSTFEDAEKFLKFLQSSF
I1Q4H9_ORYGL          LGLSHSDLVSNFE-AGHVCWDDNDIING--KPTGAVRISFGYMSTFEDAEKFLKFLQSSF
I1GW21_BRADI          LGLSHSDLVSNFE-AGHVCWDDNDVIKG--KPTGAVRISFGYISTYQDAEEFLKFLESSF
A9RRC7_PHYPA          LGLSQEDLVANFE-SGHVCWDDQDVIHG--RPTGAVRVSFGYMSTFEDCWVTSSTVETDY
H3G8M7_PHYRM          LGLRESDLMSNIA-AGHICGDDIDVVNG--LPTGAIRLSLGYMTTFEDVEAFVEFASKYF
A0A0D1C4I7_USTMA      LGVSAAQLKQEYADGVGCDDAGSTSLEGTSKASTSLRVSLCILNTDEDVERLVGFIARFF
R9NYF0_PSEHS          LGVTEAHLKQEYADGVGCDDAGDAALEGSSKASASLRASLCLLNAIEDVERLVGFIARFF
A0A081CFS5_PSEA2      LGIPALRLQQEYAEGAGCDDAGDAALEG-GLVSASVRASLCLLNTEEDVERLVGFVARFF
F4P4U4_BATDJ          LEISAQDIKQNHEVYGHVCGGSTDIGRP----TGALRISFGFANIVSDVDRFLDFIQEFF
                             .                                   .   .            

MOCOS_EMENI           VDKPP-------------------------------------------------------
MOCOS_ASPFU           VEKAA-------------------------------------------------------
C0NNC6_AJECG          VDKSN-------------------------------------------------------
J3K5A2_COCIM          VEK---------------------------------------------------------
I1RC08_GIBZE          RESTL-------------------------------------------------------
C7YKM0_NECH7          LETTL-------------------------------------------------------
F9FQI9_FUSOF          QERTV-------------------------------------------------------
MOCOS_NEUCR           CEDTP-------------------------------------------------------
D5G5P1_TUBMM          IDKEP-------------------------------------------------------
U9SZA5_RHIID          VEIAP-------------------------------------------------------
MOCOS_DICDI           INDHKFEKEVIKSNKKINN-----------------------------------------
F1A5V2_DICPU          INDHEKSRVYGVSTCGNRD-----------------------------------------
D3BH81_POLPP          IDEN--------------------------------------------------------
MOCOS_CAEBR           VSSE--------------------------------------------------------
MOCOS_CAEEL           TEGE--------------------------------------------------------
MOCOS_HUMAN           LHSSGDWPVPQA---HADT---------------------GETGAPSADSQADVIPAVMG
H2QEG1_PANTR          LHSSGDWPVPQA---HADT---------------------GETGAPSADSQADVTPAVMG
G3R2H1_GORGO          LHSSGDWPVPQA---HADT---------------------GETGAPSADSQADVTPAVMG
G1R2Q1_NOMLE          LHSSGDWPVPQA---HADT---------------------GETGAPTAESQADVTPAVMG
F7F1W1_CALJA          LHSSGGWPISQA---CADT---------------------RDSEAPSAEGQADVAPAVVH
I3MGJ4_ICTTR          LRS----PSDQL---LAGP---------------------RVAGVPSAEGKAQDMPAVTD
MOCOS_BOVIN           LHSSHGQPLPLA---TPGE---------------------AGA-PPEDSEAQNAVPAARA
F1PDQ7_CANLF          LHQSDGQPLPQT---MPAE---------------------AGA-PSE-SEAQDAIPAIMD
G3T425_LOXAF          LHWPDGQLLPQT---LAGE---------------------APA-PLAECKSLSTL-AVVD
H0WXY3_OTOGA          LCSAGGHPVPQA---SAPG---------------------KGE----------------C
G1SDV9_RABIT          LHPAAGHTTHPA---ADAL---------------------GRG---------------AA
MOCOS_MOUSE           LRSPSDQPVPQA---SISD---------------------AGA-------------LTSK
F7BDB2_ORNAN          LLKSNAITPSLA---TLQE---------------------LTS---GSKGSLALNVCADR
F6R8F7_MONDO          LGKADSKLPFQV---TPGE---------------------TAA---VTGEPVVQDEWVNK
MOCOS_DANRE           VDKPLILDQTKL---AKLN---------------------SAA-----------------
G3NFC5_GASAC          VEKPVTVDQVRL---QKLI---------------------SAS-----------------
C3ZGY8_BRAFL          VEKSPNTTGAMN---GQNEQYYNTE-------LTLAPNVQSTNEGLDTKDDRRE-TEVNT
W4XCH4_STRPU          VEREHSTTVHSV---VESTALVPTEDTGRIERLKPSANSSSSSSSFSSSSSSSSSSSLPP
E0VP85_PEDHC          VELTPQIMPYKR---KITS-----------------------------------------
E9GUD0_DAPPU          CEKVEMKPEQLV---SSQP-----------------------------------------
MOCO1_AEDAE           IRKT--------------------------------------------------------
MOCO3_AEDAE           IRKT--------------------------------------------------------
MOCOS_ANOGA           VRRS--------------------------------------------------------
W5JIU0_ANODA          IRRS--------------------------------------------------------
MOCO2_AEDAE           VSKA--------------------------------------------------------
MOCOS_DROME           LATKPLQRI---------------------------------------------------
MOCOS_DROPS           LATKPQQRL---------------------------------------------------
A0A158NCR0_ATTCE      IDEPCVRKIPEWWKEH--------------------------------------------
F4WEC2_ACREC          ------------------------------------------------------------
A0A158ND12_ATTCE      IDKPCIRKFPEWWKDH--------------------------------------------
MOCOS_BOMMO           VNAKARK------QKR--------------------------------------------
MOCOS_ARATH           ASPPKKTGNGTVVS----------------------------------------------
MOCOS_SOLLC           VIS---SFNRCALQ----------------------------------------------
MOCOS_ORYSJ           VSLPVQFNNGYMLN----------------------------------------------
I1Q4H9_ORYGL          VSLPVQFNNGYMLN----------------------------------------------
I1GW21_BRADI          LSKPIASNNGYTLN----------------------------------------------
A9RRC7_PHYPA          CRCILTRLNVEIMA----------------------------------------------
H3G8M7_PHYRM          VSRTVPAADVKASS----------------------------------------------
A0A0D1C4I7_USTMA      LCASL-------------------------------------------------------
R9NYF0_PSEHS          LSCSP-------------------------------------------------------
A0A081CFS5_PSEA2      LSPHP-------------------------------------------------------
F4P4U4_BATDJ          VSKHD-------------------------------------------------------
                                                                                  

MOCOS_EMENI           ------------------------------E-GLPVPLTGNVSLH---------------
MOCOS_ASPFU           ------------------------------TVDSLVAPVHSVPLQ---------------
C0NNC6_AJECG          ------------------------------ANTVLRPQGVIQSKRGPQ------------
J3K5A2_COCIM          ------------------------------EKRTSLPEAPVPST--PL------------
I1RC08_GIBZE          ------------------------------STVRPDSTLLNSTTMPQ-------------
C7YKM0_NECH7          ------------------------------PTIEPIISTTSPTAISE-------------
F9FQI9_FUSOF          ------------------------------PIVSSDLDLQKSIDVP--------------
MOCOS_NEUCR           ------------------------------PILPP-PETKLDPSLRN-------------
D5G5P1_TUBMM          ------------------------------VSLALQGPVGKPEAV---------------
U9SZA5_RHIID          ------------------------------SSVMNNSISFSQNLV---------------
MOCOS_DICDI           ---------------NLCDISDNISCSGSCGGSCGSSGSGIEDYQVQYSNNIKEEKEEEE
F1A5V2_DICPU          ---------------KNKNKMNYLLNNQKLNSSGINGGIGIDIPQNESDNESESENEFGG
D3BH81_POLPP          --------------------------HSQLSSPCVSSSINGQADRGD-------------
MOCOS_CAEBR           -----------------------------KVFSPSLQSLKIDSFLPT-------------
MOCOS_CAEEL           -----------------------------HQAQSKPDPMNIESYSPT-------------
MOCOS_HUMAN           RRSLSPQEDALTGSRVWNNS-STVNAVPVAPPVCDVARTQPTPSEKA-------------
H2QEG1_PANTR          RRSLSPQEDALTGSRVWNNS-STVNAVPVAPPVCDVARTQPTPSEKA-------------
G3R2H1_GORGO          RRSLSPQEDALTGSRVWNNS-STVNAVPVAPPVCDVARTQPTPSEKA-------------
G1R2Q1_NOMLE          RRSLSPQEDALIGSRLWNNSSTAVNAVPVAPPVCDIARTQQTPSEKA-------------
F7F1W1_CALJA          RHSLSPREDALTGSRVWNNSPTAVNAAPVAPPVCDVTRIQQTPSEKA-------------
I3MGJ4_ICTTR          RHVLS-QNDVGTGSGVCLDAHPGSNAICLHPPQSEATRSQQLSLEKA-------------
MOCOS_BOVIN           RGSSSPQEDTSPHSGVWNNSPTAVDAEGLCPPLLEATGTQQTTSEKA-------------
F1PDQ7_CANLF          GCSSSPQEDAPIASGVCSDLPSTVGAADLHSPLPMTTGTQHTPLERA-------------
G3T425_LOXAF          GHSLSPQEDTLADSGVWDNLSTTMNAVGLCPPVCEVNRSQQTPSEKA-------------
H0WXY3_OTOGA          GCSPSSQEGAPTDSRVGTDLSSAISAMALPSSLCAAPGAQQTPLQKA-------------
G1SDV9_RABIT          QDRAAGQDTSSPSPREGTLPALAAAAVGLCPAPCEAVGAQPTTSSGA-------------
MOCOS_MOUSE           SDCHSPQEGSCTDPSVCNGSYPDTNIMDLHPSLSKASSAQQTPQDKA-------------
F7BDB2_ORNAN          KESNDVSRKD----LPLDPELWSGSAGDTRTLKMESERGSLASSEAA-------------
F6R8F7_MONDO          HETGKLGQEDGLLQTELDKSSMTTKETDFHPPATKPGGGLQIPSLTS-------------
MOCOS_DANRE           ----------PIEPSSSYSP-----------SPDRMAVSEVTMSKDG-------------
G3NFC5_GASAC          ----------AASQCSPEDPPINITNGGTLGAEERAEPTHASPRRSG-------------
C3ZGY8_BRAFL          RSTFATTSATLKSSGLKNEPKKQADCLQEDHRVFLEKEVEQKSLKDQ----GLDSQTHSV
W4XCH4_STRPU          PSSLPPPSPSSSSPSSSSSSSATAVSFTPPPPPSSPSSSSSSSSSSSSVSSGPQNTPSSW
E0VP85_PEDHC          ---------------------------------------------NG-------------
E9GUD0_DAPPU          ------------------------------------------------------------
MOCO1_AEDAE           ----------------------------IANGF-TRTQIVSKYKSHD-------------
MOCO3_AEDAE           ----------------------------IANGF-TRTQIVSKYKSYD-------------
MOCOS_ANOGA           ----------------------------LTGPL-SRADVLAQYKSYD-------------
W5JIU0_ANODA          ----------------------------VMGPLVSRKEVLARYKNYD-------------
MOCO2_AEDAE           ----------------------------VSNVA--MVSPIRNVIKNE-------------
MOCOS_DROME           --------------------------QFIEEQAEQLPPLLKERVQLL-------------
MOCOS_DROPS           --------------------------QLIEEQAGELPKALKERAQRL-------------
A0A158NCR0_ATTCE      --------------------KLRIFKN--CGHFYNSNVDYSIPRITKKEXN--NFQ----
F4WEC2_ACREC          ------------------------------QKYQTNLYLLKPIILRK-------------
A0A158ND12_ATTCE      -------------------KMGIFKNHIYKNFYNTNIDYSVSYIIKNEKNVNNFQ-----
MOCOS_BOMMO           -------------------IINHFVETPKIKHYNGNVNKIINEQIYF-------------
MOCOS_ARATH           ---------------------------------GRFPQLPSEDLESK-------------
MOCOS_SOLLC           ---------------------------------PRSISLPIEGIA---------------
MOCOS_ORYSJ           ---------------------------------LNSLNLIDNSSQ---------------
I1Q4H9_ORYGL          ---------------------------------LNSLNLIDNSSQ---------------
I1GW21_BRADI          ---------------------------------MNMLNLVDNRSQ---------------
A9RRC7_PHYPA          ---------------------------------PLTVFLPVLMRG---------------
H3G8M7_PHYRM          ---------------------------------LPATNSPR-------------------
A0A0D1C4I7_USTMA      -----------------------------TARYESVKSIGGKPNEGR-------------
R9NYF0_PSEHS          -----------------------------STRADPLDRT--EAPVER-------------
A0A081CFS5_PSEA2      -----------------------------APTLAPSVQA--QRGLQR-------------
F4P4U4_BATDJ          ---------------------------------AIDNGIVSGLTRPR-------------
                                                                                  

MOCOS_EMENI           ----------------------------QPSFYVESLSVYPIKSCGAFRIPDGQR-----
MOCOS_ASPFU           ----------------------------QPRFYIESLSLYPIKSCGPFKVPDGRR-----
C0NNC6_AJECG          ----------------------------PSSFYVDKLCVYPIKSCGAFIVPDGKQ-----
J3K5A2_COCIM          ----------------------------NPEFYIEQIYVYPIKSCGALVIPEGEQ-----
I1RC08_GIBZE          ----------------------------SSILQVNSMTIYPIKSCAGFSIPAGVP-----
C7YKM0_NECH7          ----------------------------FPRLQVKTITIYPIKSCAGFSIPPRVS-----
F9FQI9_FUSOF          ------------------------------------------------------------
MOCOS_NEUCR           ----------------------------TPELFIKSIVVYPIKSCAGFHVPPGID-----
D5G5P1_TUBMM          ---------------------------------VESLTIYPIKSCGGFRIPPGEC-----
U9SZA5_RHIID          ---------------------------------LEKVTLFPIKSCHGFSISPSTS-----
MOCOS_DICDI           K---------------EEIENLKNEKDNDE-VLLSEIYIYPVKSCSGHKVVN--------
F1A5V2_DICPU          GG------------ACDDESGLQSDSQSDSSVELSEIYVYPVKSCSGYRVTN--------
D3BH81_POLPP          -------------------------------IYLSEINVYPVKSFGAFTV----------
MOCOS_CAEBR           ---------------------------------VVNLFSFPIKSVGSVAK----------
MOCOS_CAEEL           ---------------------------------VVNLFSFPIKSVGSVGR----------
MOCOS_HUMAN           -------------AGVLEGAL--------GPHVVTNLYLYPIKSCAAFEVTR--------
H2QEG1_PANTR          -------------AGVLEGAL--------GPHVVTNLYLYPIKSCAAFEVTR--------
G3R2H1_GORGO          -------------AGVLEGAL--------GPHVVTNLYLYPIKSCAAFEVTR--------
G1R2Q1_NOMLE          -------------AGVLEGAL--------GPHVVTNLYLYPIKSCAAFEVTR--------
F7F1W1_CALJA          -------------AGVLEGAL--------GAHVITNLYLYPIKSCAAFEVTR--------
I3MGJ4_ICTTR          -------------AGALHGDH--------GPRVVTNLYLYPIKSCAAFEVTK--------
MOCOS_BOVIN           -------------ADVPDGDL--------RSHVITNLFLYPIKSCAAFEVIR--------
F1PDQ7_CANLF          -------------AGVLDGGL--------GPYVITNLYLYPIKSCAAFEVTT--------
G3T425_LOXAF          -------------EGVLNGDR--------GPHIVTNICLYPVKSCAAFEVTR--------
H0WXY3_OTOGA          -------------TGVLDGDL--------GPHVVTNIYLYPIKSCAAFEVTR--------
G1SDV9_RABIT          -------------APVPDGDL--------GTHVVTNIYLYPIKSCAAFEVSR--------
MOCOS_MOUSE           -------------AGILNGDP--------GSHIVTNIYLYPIKSCAAFEVTK--------
F7BDB2_ORNAN          -------------IMRRGGLL--------KPVTVTNIYIYPIKSCAAFEVSR--------
F6R8F7_MONDO          -------------AATLDGRL--------PKFTITNIYIYPIKSCAALEVTK--------
MOCOS_DANRE           -------------KKDG------------SSCTLTNLFIFPVKSCASFEVTE--------
G3NFC5_GASAC          -------------QRESKTQW--------EAYTLTNIYIYPIKSCGAFEVHD--------
C3ZGY8_BRAFL          RDSERSVPQSTWRKEEPSGSR---EVRVPAQRHLTNIFLYPVKSCGAFQVKS--------
W4XCH4_STRPU          DQTDVSCAETRSSRTTSQGQRTTDEHSITDAPRLSGIYLYPVKSCGAMEVSE--------
E0VP85_PEDHC          -----------------------------SGKYLSKILLFPIKSCGAMEVTS--------
E9GUD0_DAPPU          ------------------------------NIELSGICIYPIKSCGAFSPKA--------
MOCO1_AEDAE           ------------------------------QPRLKMICLFPIKSCGAFKV---TT-----
MOCO3_AEDAE           ------------------------------QPRLKMICLFPIKSCGAFKV---TT-----
MOCOS_ANOGA           ------------------------------RPRLVQLCLYPVKSCGPLRVTTGG------
W5JIU0_ANODA          ------------------------------RARLVQICLFPIKSCGPFRVVGAGK-----
MOCO2_AEDAE           ------------------------------GIALKAIYLYPIRSCGGYRI---TA-----
MOCOS_DROME           ------------------------------RPKLLQMAIYPVKSCAAFKIELPG------
MOCOS_DROPS           ------------------------------RPQLLQLAIYPVKSCAAFKIKEGGGGGGAG
A0A158NCR0_ATTCE      NNFHNENLD----RTKNFIN-SSKINTQIYKCILQRLFIYPIKSCGAYEITD--------
F4WEC2_ACREC          ---------------QNIMR-LTYPGRPTIDVSLENVY----------------------
A0A158ND12_ATTCE      NNSHNENKNLNYFNIRNFIN-FNKINTQINKCILQRLYVYPIKSCGAYEITD--------
MOCOS_BOMMO           ---------------KNVDDVLINIPPMSTKIILKEICIFPIKSCGAFKILS--------
MOCOS_ARATH           --------------------------ESFPSHYLKSITVYPIKSCAGFSVIR--------
MOCOS_SOLLC           --------------------------EAAARHFLTSITVYPIKSCAGFSVDQ--------
MOCOS_ORYSJ           --------------------------KAVSDIHLKSIIIYPVKSCQGFSVKS--------
I1Q4H9_ORYGL          --------------------------KAVSDIHLKSITIYPVKSCQGFSVKS--------
I1GW21_BRADI          --------------------------QVVPDVRLKSIIIYPVKSCQGFSVQS--------
A9RRC7_PHYPA          --------------------------SSVDLSCLENLVIYPIKSCGGFSANV--------
H3G8M7_PHYRM          --------------------------PLCKGPYLCKLTLFPIKSCTGMVVNA--------
A0A0D1C4I7_USTMA      ------------------------------RFELANITMYPIKSCSGQHLEHGEK-----
R9NYF0_PSEHS          ------------------------------RFDLANITVYPIKSCSGQNLERGER-----
A0A081CFS5_PSEA2      ------------------------------RFELASITVYPIKSCAGQELARGEA-----
F4P4U4_BATDJ          -----------------------------LIPYISAIHVYPIKSCGAISVTS--------
                                                                                  

MOCOS_EMENI           ----WEVRREGLAWDREWCLVHQGTGITLNQKRYPRMA-LIRPTLDLERCLLRITCGE--
MOCOS_ASPFU           ----WEIRREGLAWDREWCLIHQGTGAALNQKKYPRMA-LIRPSIDLDRNVLRVTCGE--
C0NNC6_AJECG          ----WEVKQEGLAWDREWCLIHQGTGVALNQKRYPRMA-LIRPVIDLDNGILQISRWM--
J3K5A2_COCIM          ----WEVKPEGLAWDREWCLIHLGTNTALNQKKYPRMA-LIRPIIDFKKGFLRITCGT--
I1RC08_GIBZE          ----WEVRPEGLAWDREWCLVHHGSGHALSQKRCPKMA-LLRPVLDFDKGKLIITY----
C7YKM0_NECH7          ----WEIRPEGLAWDREWCLVHHGSGHALNQKRCPRMA-LLRPRIDFDKGELVVSY----
F9FQI9_FUSOF          ------------------------NSSALKLRRVPD-P-IWGSLGDFGKGELIVTY----
MOCOS_NEUCR           ----WEVRPEGLVWDREWCLVHRGSGQALSQKRYPRMA-LLRPNLDFTKGELQVTF----
D5G5P1_TUBMM          ----WEIRPHGFAWDREWCLVHLGTGSAIDQKRYNKMA-LIRPRVDLTSGYLEVYL----
U9SZA5_RHIID          ----WPITSKGLMYDREWMLVDAGNGRALSQKRFPRMT-LICPEIIRDKGLLAVSAP---
MOCOS_DICDI           --DKWELVPSGLKYDREWTIID-QSGNYINQKKLPILA-LIQTEIDLINDKLILTAP---
F1A5V2_DICPU          --GKWELVASGLKYDREWTIID-QSGNYLNQKKLPILA-LIQTDIDLISDKLVLTAP---
D3BH81_POLPP          --DEWEIGPSGLLYDREWTLID-QNGVYINQKKLPVLS-LISTHIDLQDRVLKLKAP---
MOCOS_CAEBR           --SRYELTPRGFKHDREFLVVK-DD-VTLNLKMHPELC-RLTATIVNDEELHIQTFD---
MOCOS_CAEEL           --KRYELTARGFKNDREFLIVN-DD-VTLNLKTHPELC-MLTATIVDDDQLLIQTFD---
MOCOS_HUMAN           ----WPVGNQGLLYDRSWMVVN-HNGVCLSQKQEPRLC-LIQPFIDLRQRIMVIKAK---
H2QEG1_PANTR          ----WPVGNQGLLYDRSWMVVN-HNGVCLSQKQEPRLC-LIQPFIDLRQRIMVIKAK---
G3R2H1_GORGO          ----WPVGNQGLLYDRSWMVVN-HNGVCLSQKQEPRLC-LIQPFIDLRQRIMVIKAK---
G1R2Q1_NOMLE          ----WPVGNQGLLYDRSWMVVN-HNGVCLSQKQEPRLC-LIQPFIDLQQRIMVIKAR---
F7F1W1_CALJA          ----WPVGNQGLLYDRSWMVVN-HNGVCLSQKQEPRLC-LIQPFIDLQQRIMVIKAK---
I3MGJ4_ICTTR          ----WPVGNHGLLYDRSWMVVN-HNGICLSQKQEPRLC-LIQPFIDLQQRIMVIKAQ---
MOCOS_BOVIN           ----WPLGSQGLLYDRSWMVVN-HNGICLSQKQEPRLC-LIQPFIDLQRRIMVIKAQ---
F1PDQ7_CANLF          ----WPLGNQGLLYDRSWMVVN-HNGVCLSQKQEPRLC-LIQPFIDLQQKVMVLKAK---
G3T425_LOXAF          ----WPVGNQGLLYDRSWMVVN-HNGICLSQKQEPRLC-LIQPFIDLQQRIMVLKAK---
H0WXY3_OTOGA          ----WPVGNQGLLYDRSWMVVN-HNGACLTQKQEPRLC-LIQPFIDLQQKIMVIKAQ---
G1SDV9_RABIT          ----WPIGKQGLLYDRSWMVVN-HNGICLSQKQEPRLC-LIRPFIHLQHRVMVIEAK---
MOCOS_MOUSE           ----WPVGSQGLLYDRSWMVVN-HNGICMSQKQEPRLC-LIQPFIDLQQRIMVIKAE---
F7BDB2_ORNAN          ----WPVGDRGLLHDRSWMIVN-QNGVCLSQKQDPRLC-LVSPSIDLKQGIMILKAE---
F6R8F7_MONDO          ----WPIGNQGLLYDRNWMIVN-HNGICLSQKQEPRLC-LIKPLIDLHRKTLVVTAE---
MOCOS_DANRE           ----WPLGPQGLLYDRLWMVVN-ENGVCLSQKREPKLC-LIQPVVCLAANTLKLQIS---
G3NFC5_GASAC          ----WPLGPLGLLYDRSWMVVN-GNGVNLGQKREPRLC-LVRPQVHLPSNKLLLRAP---
C3ZGY8_BRAFL          ----WQLSARGLMYDRDWMVVN-ESGVCLSQKREPKLC-LIRPAIYLTEGVLQLSAE---
W4XCH4_STRPU          ----WELSEAGLMYDRRWMIVN-DGGVYMSQKRIPHLC-LIKPSIDLDNKRLMLAYK---
E0VP85_PEDHC          ----WKLNSKGLEYDREWMVTT-TSGVCLTQKQEPKLC-MICPNINLKNQTLTLTFD---
E9GUD0_DAPPU          ----WPISKSGLLYDRCWVIVN-EAGAALTQKREPKLC-MIRPEIDLKEKKLILKCL---
MOCO1_AEDAE           ---RWPLSRRGLKHDREFVIVD-ENGVALTQKKLAEMC-LIRPQINVKTNEMTLSHP---
MOCO3_AEDAE           ---RWPLSRRGLKHDREFVIVD-ENGVALTQKKLTEMC-LIRPQINLKTNEMTLSHP---
MOCOS_ANOGA           ----WPLAPTGLLYDRAFLIVD-EHGAAMTQKKLPTMC-RIRPDI--ADGRLVLRHA---
W5JIU0_ANODA          ---EWPLSATGLLYDREFVIVD-EHGMAITQKKVATLC-LIRPTINLAAKQMTLHHP---
MOCO2_AEDAE           ---AWPLTERGLKYDREFTIVD-SNGNPLMRNKHAEMS-TIHPKIDPSLNFLILTHP---
MOCOS_DROME           ---SWPLTDQGLKYDREWMIVD-MNGMALTQKRCTELC-LIRPVIKVDQLELQFGEN---
MOCOS_DROPS           AGRTWPLTAQGLQYDREWMIVD-MNGMAVTQKRCSELC-LIRPLIRDDQLVLHFGDS---
A0A158NCR0_ATTCE      ---SWNLNSKGLEYDREWTIVT-SSGICLTQKYHTNLY-LLKPVILRKQNIMRLTYQ---
F4WEC2_ACREC          -----------------------------------------EKSMEY-------------
A0A158ND12_ATTCE      ---SWNLNSKGLEYDREWMIMT-SSGTCLTQKHYTNLC-LLKPVIVKKQKIMKLTYP---
MOCOS_BOMMO           ---GWNIGPKGFEYDREWMIVK-DNGVCLTQKQNTRMC-MIRPQIDLKQKVMILNFP---
MOCOS_ARATH           ----WPLCRTGLLHDREWMVQG-LTGEILTQKKVPEMS-LIKTFIDLEEGLLSVESS---
MOCOS_SOLLC           ----WPLTSTGLLHDREWILKS-TTGEILTQKKVPEMC-YISTLIDLNLGKLFVESP---
MOCOS_ORYSJ           ----WPLTTGGLMYDREWLLQG-SGGEILTQKKVPELG-SIRTLIDLELGKLFIESP---
I1Q4H9_ORYGL          ----WPLTTGGLMYDREWLLQG-SGGEILTQKKVPELG-SIRTLIDLELGKLFIESP---
I1GW21_BRADI          ----WPLTTGGLKYDREWLLQG-SGGEILTQKRVPELG-SIRTLINLELGKLFVESP---
A9RRC7_PHYPA          ----WPLSDCGLLYDREWMIQS-STGDVLTQKKLNSLC-SIQTFIDLTTGIMHVRAP---
H3G8M7_PHYRM          ----WPVGSRGLLFDREFAIVDLSTGSALTLKTVPEMC-FLHPVIDLGRETLTISYCKPD
A0A0D1C4I7_USTMA      ----WNLTRHGLEFDREWIVMNLANGKALSQKRFPKMA-LIRPSVNVSARTMTVSIVG--
R9NYF0_PSEHS          ----WRLTRHGLEYDREWIVMNLANGKALSQKRFPKMV-LIRPRIDLVGRTMSISIAG--
A0A081CFS5_PSEA2      ----WQLTPHGLQFDREWIVMNLANGKTLSQKRFPKMA-LIRPRIDTHTRQLVITIAG--
F4P4U4_BATDJ          ----WPMCDSGLVCDRKWMLVDRIHFQPLTQKKCPKMCRILIEKLDPYVGMMQVVYSSEY
                                                                                  

MOCOS_EMENI           --------ANSRDGKTLEISLNRIGTNSLTTSLCQ------NASK-PSTVCGDKVVLQAY
MOCOS_ASPFU           --------PGSTDQKLLEVSLLRENTELATTSLCQ------RTSK-ASTVCGDQVTVQAY
C0NNC6_AJECG          --------PGADD-NPLKLPLSDQYVDISTAELCE------NSMKKSSTVCGDRVPVQIY
J3K5A2_COCIM          --------TGSEDWNSIEIPLFPDDTKGQTAVQMQ------QNAK-AATVCGDTVTVRVY
I1RC08_GIBZE          --------IGKEYN--DKQQQISIPLSADPSVMDS------NLDKRSSRVCGEKVTTQIY
C7YKM0_NECH7          --------HGKRRD--NQPHQISIPLSADPSVIDS------TLDRQRS------------
F9FQI9_FUSOF          --------HGTQHS--GQPSQISIPLSADPSVIDS------SIDRQSSRVCGEKVSTQIY
MOCOS_NEUCR           --------AGDISSSPGLPSSISVPLSKNPKMYAP------KKSGMSSRVCGEEITPQTY
D5G5P1_TUBMM          --------------HKSSVAPLKVPLSLAPSASCT------LKSS-QSRVCGDKIAALTY
U9SZA5_RHIID          -------------------DKEPLYIDLNIYPNTV------EFSTCSSQVCGDKIQTCVY
MOCOS_DICDI           -----------------EMKVLSIPLSYYPISA-----------FDQIQVCGDKVDGLLY
F1A5V2_DICPU          -----------------EMKPISISLSYYPVSA-----------FDQIQVCGDKVDGLLY
D3BH81_POLPP          -----------------EMPELVLPLDYYPRSS-----------MDVIQVCGDSVEGLLY
MOCOS_CAEBR           -----------------QNDNLVIPMSLSLKE------------NDAKVVCKKTIATFDC
MOCOS_CAEEL           -----------------QNENLVLPMSLSLKD------------NGAKLVCKNTIATMDC
MOCOS_HUMAN           -----------------GMEPIEVPLEENSE-RT---------QIRQSRVCADRVSTYDC
H2QEG1_PANTR          -----------------GMEPIEVPLEENSE-RT---------QIRQSRVCADRVSTYDC
G3R2H1_GORGO          -----------------GMEPIEVPLEENSE-RT---------QIRQSRVCADRVSTYDC
G1R2Q1_NOMLE          -----------------GMEPIEVPLEENSE-QS---------QIRQSRVCADRVSTYDC
F7F1W1_CALJA          -----------------GMEPIEVPLEENSE-RA---------QICQSKVCADRVNTYDC
I3MGJ4_ICTTR          -----------------GMEPIEVPLEEDSE-QA---------QICQSKVCADRVNTYDC
MOCOS_BOVIN           -----------------GMEPIEVPLEENSE-QV---------QICQSKVCADRVNTYDC
F1PDQ7_CANLF          -----------------GMEPIEVPLEEDGE-QA---------QIYQSKVCADRVNTYNC
G3T425_LOXAF          -----------------GMEPIEVPLEGNGE-RA---------QICQSKVCADRVNTYDC
H0WXY3_OTOGA          -----------------GMEPIEVPLEENSE-QA---------RICQSKVCADRVDTYDC
G1SDV9_RABIT          -----------------GMEPIEVPLEESSE-QA---------QVCQSKVCADRVNTYDC
MOCOS_MOUSE           -----------------GMEPIQVPLEEDGE-QT---------QICQSRVCADRVNTYDC
F7BDB2_ORNAN          -----------------GMEPITVPLERESGVGN---------QICQRRVCGDRVNTYDC
F6R8F7_MONDO          -----------------GMDPIDVPLDENNEKEN---------QICQSKVCADRVNTYDC
MOCOS_DANRE           -----------------GSEAITVPLDPSLEKSD--------LRTSQSKVCGDRVQTVDC
G3NFC5_GASAC          -----------------GMDTISVPLKNNTQTHES-------YQVCQSKVCGDRVEAVDC
C3ZGY8_BRAFL          -----------------GMKLLNVSLTGARMGDVE-------ASMCQSKVCGDRITGLDC
W4XCH4_STRPU          -----------------DKQPFILPLDISRSHINE-------RSLSQGKVCGDRVNTIDC
E0VP85_PEDHC          -----------------KKDAITFPIDFDDNNNNQ-------YGLCESKVCNNFIQAYDC
E9GUD0_DAPPU          -----------------TQPSITMDIEDYNLSAT--------NELKFTKICGRVMRFAEC
MOCO1_AEDAE           -----------------GMADFVLQLDLLGESQ--------RIKLCQTKVCQDNVQAIDC
MOCO3_AEDAE           -----------------SMDDFVLDLDLLGESQ--------RIKLCQTKVCQDNVQAIDC
MOCOS_ANOGA           -----------------DLEDEPLTIGLEGGGE---AGEPAAAHLCQTKVCRDSVQGVDC
W5JIU0_ANODA          -----------------DVEQDLIVDLADTDDQSDHRPADAPFRLCQTKVCQDNVQGVDC
MOCO2_AEDAE           -----------------FMEDLILKIRKLPTEF-------------------NDGESIDL
MOCOS_DROME           ------------------STISVPLSLDDQAAD---------TAKCVSKVCRQPVEGLDC
MOCOS_DROPS           -----------------PAGVSLPLSLADQAEN---------SSRCRSKVCRQPVEGLDC
A0A158NCR0_ATTCE      ------------------GRPTIDVSLENIYEK---------SMEYQSRVHESKVQGIDC
F4WEC2_ACREC          ----------------------------------------------QSRVHESKVQGIDC
A0A158ND12_ATTCE      ------------------GMPTIEISLENTYEK------SIKHPISQSRICESRVEGIDC
MOCOS_BOMMO           -----------------GKTPISIPLENSINEV------QKNGSLCHSKVCTDMIKGIDC
MOCOS_ARATH           ----------------RCEDKLHIRIKSDSYNPRNDE----------FDSHANILENRNE
MOCOS_SOLLC           ----------------RCKEKLQIELKSSSLVTERDE----------MDIQNHRYEVTSY
MOCOS_ORYSJ           ----------------TRRDKLQLSLL-ESLADLSEE----------VDVFGQRYEVQSY
I1Q4H9_ORYGL          ----------------TRRDKLQLSLL-ESLADLSEE----------VDVFGQRYEVQSY
I1GW21_BRADI          ----------------KRKDKLQISLL-ENLTHLTAE----------VDVYGQRYEVESY
A9RRC7_PHYPA          ----------------SMQRELAISLQSKPKCTTSNG----------VMFCGNSVEGNRY
H3G8M7_PHYRM          GVGVRQATTTQSPSESRSPSSFTISLRADVSTTKHQDE----DNPRSMRVCTGVCKGRDV
A0A0D1C4I7_USTMA      -----------------TTRAFTIKLDDESQYV------DEASGDTNVEVCGAELRPRPH
R9NYF0_PSEHS          -----------------IDQPFTLDLDDESQYAG-----QEATESRTVQVCGVETRPRAH
A0A081CFS5_PSEA2      -----------------TSSRFAVSFDDDGQYS--------DSKGQATQVCGAEIWPRAH
F4P4U4_BATDJ          ETHKTN------------DDQLVIMFDPIMPHSDRVPLNHDPADYDHQLSEKGDFSIVPK
                                                                                  

MOCOS_EMENI           TSPA---------------------VSRFFTDFLGVPCTLARFPPQSSTRFHSRATAAIN
MOCOS_ASPFU           TSPP---------------------VAQFFSDFLGVPCTLARFPPHSSTRYASPRKAPGA
C0NNC6_AJECG          SSPV---------------------VSAFFSEFLGVPCTLARFPANSSLRYSKHQQRSYL
J3K5A2_COCIM          STPT---------------------VTAFFSDFLSTPCTLARLPPQSTMRYYKPRLPATE
I1RC08_GIBZE          TSAK---------------------INSFFSTVLGVPCVLARFPPGGLGL-KSRLSKAQI
C7YKM0_NECH7          ------------------------------------------------------------
F9FQI9_FUSOF          TSDR---------------------INSFFSNALGVPCVLARFPPGGLGL-KSRLSKAQI
MOCOS_NEUCR           ASAQ---------------------INDFFSTVLGVPCVLARFPPGGQGKGMTRHAKAHL
D5G5P1_TUBMM          TSPH---------------------ITDFFTSAVGVPCTLARFPAASENRHFKPHLKGSS
U9SZA5_RHIID          TSSE---------------------INEWFSSFLNVSCRLARHASMKDNSLLQHRFIKSY
MOCOS_DICDI           GDKDFSNTSGSSAGSGGGGGGNIDNISEWLYQFIGKRCYLVRKSPESHRKSKVDSSN---
F1A5V2_DICPU          GDKDFNSAT------------QIDNVTNWLYQFTGKKCYLVRKAPESFRKSKVDDSN---
D3BH81_POLPP          GKDDLETVG---------------DVSNWMYTFTGKQCHLVRKNPDSHRKSRMAVKHNNN
MOCOS_CAEBR           GDK----------------------VGQWLENALDMTNCRLLRVAGESKKN---------
MOCOS_CAEEL           GDK----------------------VGKWLDNALDRQNCRLLRVAEDSKKN---------
MOCOS_HUMAN           GEK----------------------ISSWLSTFFG-RPCHLIKQSSNSQRNAKKKHGKDQ
H2QEG1_PANTR          GEK----------------------ISSWLSTFFG-RPCHLIKQSSNSQRNAKKKHGKDQ
G3R2H1_GORGO          GEK----------------------ISSWLSTFFG-RPCHLIKQSSNSQRNAKKKHGKDQ
G1R2Q1_NOMLE          GEK----------------------ISSWLSTFFG-RPCYLIKQSSNSQRNAKKKHGKDQ
F7F1W1_CALJA          GEK----------------------ISSWLSTFFG-RPCHLIKQSSDFQRNAKKKHGKDQ
I3MGJ4_ICTTR          GEK----------------------VASWLSKFFG-RPCHLIKQSSSFQRNAKKKLGKDL
MOCOS_BOVIN           GEK----------------------ISNWLSKFFG-RPYHLIKQSSDFQRNAKKKHGKDQ
F1PDQ7_CANLF          GEK----------------------ISSWLSRFFG-RPCQLIKQSSKFQRSAKKQ-GKDQ
G3T425_LOXAF          GEK----------------------ISRWLSKFFG-RECHLIKQSSNFQRKAKKKHGKDQ
H0WXY3_OTOGA          GEK----------------------ISSWLSKFFG-RPCHLIKQSSNSQRSAKKKHGKED
G1SDV9_RABIT          GEK----------------------ISNWLSRFFG-RPCHLIKQSSSFQRNAKKKHGQDQ
MOCOS_MOUSE           GEN----------------------VSRWLSKFLG-RLCHLIKQSPHFQRNARKTPKKGQ
F7BDB2_ORNAN          GEE----------------------IADWLTEFFG-RQCRLIKQSSDFKRAANKKQVKEL
F6R8F7_MONDO          GEK----------------------ISDWLSKFFG-RHCRLIKQSSNFKRSANKKHTKDS
MOCOS_DANRE           GEE----------------------VSAWLSEFLG-KPCRLIRQRPEFLRDMKF----GQ
G3NFC5_GASAC          GDE----------------------AASWLSDFLG-QPCRLIRQSPDFTRDGKKRLSGGV
C3ZGY8_BRAFL          GNE----------------------AADWLTRFLG-RPCRLVRQNPDSDRDCKI------
W4XCH4_STRPU          GDE----------------------VAAWLTEVIG-QRCRLQQQDPEYHRASKLNRNIAK
E0VP85_PEDHC          GEN----------------------VSQWLSAHLNIEGLRLVKQSKNDNRSSKKSKNVKN
E9GUD0_DAPPU          ESV----------------------VNEWLSKVIGQPALKLLRCFESHS-----------
MOCO1_AEDAE           GDQ----------------------VAEWISVALQTSGLRLLKQSDEEVRTFQQ------
MOCO3_AEDAE           GDQ----------------------VAEWISVALQTSGLRLLKQSDEEVRTFQQ------
MOCOS_ANOGA           GER----------------------AADWVSRALGVSGLRLLRQSGQEPRRQRQ------
W5JIU0_ANODA          GED----------------------AADWVSLALGVSGLRLLRQTRFHEQRTRRNR----
MOCO2_AEDAE           GDA----------------------AAAWISKALRMPKLRLLRTSATDRK----------
MOCOS_DROME           GDR----------------------VAQWLSENLGMEGLRLLRQS-GQR---NSSK----
MOCOS_DROPS           GDE----------------------VALWLSQHLGLEGLRLLRQS-SQRSASNGVR----
A0A158NCR0_ATTCE      GSK----------------------VSEWLSLVLGKPNLRLIRQSHERQKNG--------
F4WEC2_ACREC          GSE----------------------VSEWLSLALGKPNLRLIRQNRERQKN---------
A0A158ND12_ATTCE      GAE----------------------VSEWLSLALGKPNLRLVRQSHGRQKKG--------
MOCOS_BOMMO           GDE----------------------VADWISEALEVSFLRLIRQSSNDNRSLKKKK----
MOCOS_ARATH           ETR----------------------INRWFTNAIGRQCKLLRYSSSTSKDCLNRNKSP-G
MOCOS_SOLLC           NNE----------------------VDIWFSRAIDRPCTLLRNSDSQSHSCINKNGSP-G
MOCOS_ORYSJ           DDR----------------------VNTWFSEAIGRPCTLVRCSSSKYRSCTYTGLRD-R
I1Q4H9_ORYGL          DDR----------------------VNTWFSEAIGRPCTLVRCSSSKYRSCTYTGLRD-R
I1GW21_BRADI          DDK----------------------VNTWFSEAIGRHCTFVRCSNSKKRSCTFAGKNG-R
A9RRC7_PHYPA          GDE----------------------VAAWFTEALGVSCTLVRKEPKILSLKSRRGRSVSR
H3G8M7_PHYRM          GSK----------------------VSRWLSACLGRQCALVRVSSRHLRASQADRPKKSG
A0A0D1C4I7_USTMA      KSEV---------------------VRSVLTDLLGVSCTLARQATEVSRHSKLDSGR---
R9NYF0_PSEHS          KSEQ---------------------LRILLSNLLGVSCTLAKQAIDTSRHSKLGSGS---
A0A081CFS5_PSEA2      TSPA---------------------LRSMLSELLGVSCTLARQASGISRHSKLPTAT---
F4P4U4_BATDJ          KISQ---------------------ADEWFSRHLGVDVCFVRSSTTAHIQSATMANLDKH
                                                                                  

MOCOS_EMENI           RDQN-----------YSQKQSPSMPGSFPQAP--------SSPDPYPT------------
MOCOS_ASPFU           WKQY-----------LRKF---VMPGSFPQDP--------SPPPAEKH------------
C0NNC6_AJECG          PETP-----------SPFH---SMPGAFPQPN--------LASQVHKN------------
J3K5A2_COCIM          TNKR-----------SSIL---STTFSKPRP------------SLHRN------------
I1RC08_GIBZE          QRYQ------------QPSKVHAIPGSFPDV------PSPPDSDSEQH----------KT
C7YKM0_NECH7          ----------------RPSRIRTLPGAFPDV------PSPPDSDSEQK----------KP
F9FQI9_FUSOF          QRYQ------------QPSKIHTLPGSFPDV------PSPPDSDSEQQ----------KP
MOCOS_NEUCR           QRHQHQQPHPAVSVSTRLTKPAMMPGAFPSPKAVETPPSPPDSDTERSATPTQEAQGPKP
D5G5P1_TUBMM          LTQE--------------------------------------KDGRIA------------
U9SZA5_RHIID          FNVP------------------------------------------------------DN
MOCOS_DICDI           ------------------------------------------------------------
F1A5V2_DICPU          ------------------------------------------------------------
D3BH81_POLPP          DSTTS------------------------------------------TTTTTEASKGTRG
MOCOS_CAEBR           ------------------------------------------------------------
MOCOS_CAEEL           ------------------------------------------------------------
MOCOS_HUMAN           L-------------------------------------------------------PGTM
H2QEG1_PANTR          L-------------------------------------------------------PGTM
G3R2H1_GORGO          L-------------------------------------------------------PGTM
G1R2Q1_NOMLE          L-------------------------------------------------------PGTM
F7F1W1_CALJA          P-------------------------------------------------------SGTT
I3MGJ4_ICTTR          P-------------------------------------------------------PGTA
MOCOS_BOVIN           S-------------------------------------------------------AHTT
F1PDQ7_CANLF          P-------------------------------------------------------AGTT
G3T425_LOXAF          S-------------------------------------------------------PGST
H0WXY3_OTOGA          RNT-----------------------------------------------------GLTL
G1SDV9_RABIT          F-------------------------------------------------------PAAT
MOCOS_MOUSE           P-------------------------------------------------------PGTT
F7BDB2_ORNAN          S-------------------------------------------------------SAPA
F6R8F7_MONDO          S-------------------------------------------------------HVTT
MOCOS_DANRE           G-------------------------------------------------------DCCP
G3NFC5_GASAC          L-------------------------------------------------------PATS
C3ZGY8_BRAFL          ------------------------------------------------------------
W4XCH4_STRPU          R--------------------------------------------------------ASN
E0VP85_PEDHC          E---------------------------------------------------------NS
E9GUD0_DAPPU          ------------------------------------------------------------
MOCO1_AEDAE           ----------------------------------------------------------SK
MOCO3_AEDAE           ----------------------------------------------------------SK
MOCOS_ANOGA           ----------------------------------------------------------TD
W5JIU0_ANODA          ----------------------------------------------------------SE
MOCO2_AEDAE           ------------------------------------------------------------
MOCOS_DROME           ----------------------------------------------------------DQ
MOCOS_DROPS           ----------------------------------------------------------QQ
A0A158NCR0_ATTCE      ---------------------------------------------------------LDK
F4WEC2_ACREC          ----------------------------------------------------------DK
A0A158ND12_ATTCE      ---------------------------------------------------------LDK
MOCOS_BOMMO           --------------------------------------------------------DEDK
MOCOS_ARATH           LCRD------------------------------------------------------LE
MOCOS_SOLLC           MCRD------------------------------------------------------VG
MOCOS_ORYSJ           PCRD------------------------------------------------------TQ
I1Q4H9_ORYGL          PCRD------------------------------------------------------TQ
I1GW21_BRADI          LCRD------------------------------------------------------TR
A9RRC7_PHYPA          QGDS------------------------------------------------------ST
H3G8M7_PHYRM          QSSPD------------------------------------------LRPEAAAPTPIAT
A0A0D1C4I7_USTMA      ----------------------------------------------------------DK
R9NYF0_PSEHS          ----------------------------------------------------------EK
A0A081CFS5_PSEA2      ----------------------------------------------------------SK
F4P4U4_BATDJ          H--------------------------------------------------------HTT
                                                                                  

MOCOS_EMENI           -PILLSNESPLLLISRSSVNRLNESIKSASQ-----------------------------
MOCOS_ASPFU           -PILLSNESPILLISRSSVNYLNENIKANQK-----------------------------
C0NNC6_AJECG          -PIRLSNESPMLLVSRSSVNKLNETIKSYG------------------------------
J3K5A2_COCIM          -PILLSNESPMLLVSRSSVNRLNEEIKTR-------------------------------
I1RC08_GIBZE          SRILLSNESPILMIHSSSVDALNQDITRR-------------------------------
C7YKM0_NECH7          AKILLSNESPILMIHSSSVDELNREIMNR-------------------------------
F9FQI9_FUSOF          AKILLSNESPILVIHSSSVDALNQQIIDR-------------------------------
MOCOS_NEUCR           RRILLSNESPILAITSTSVDALNQSIALL-------------------------------
D5G5P1_TUBMM          -PILLSNESPILLINSSSIDKLNETIGRT-------------------------------
U9SZA5_RHIID          MHLSLSNESPFLIISHSSVNYINKKIIEG-------------------------------
MOCOS_DICDI           -EISFANESPYLLINEESVSDLKKRIIKDN------------------------------
F1A5V2_DICPU          -KISFANESPYLLINEESVKDLKERIYSDN------------------------------
D3BH81_POLPP          EEISFANESPFLMISESSVKDLRDRVVSRNQ-----------------------------
MOCOS_CAEBR           ----FVNDSPFLLINEASVYMLARHIDMDV------------------------------
MOCOS_CAEEL           ----FVNDSPFLLINEASVYMLSRYINMEV------------------------------
MOCOS_HUMAN           ATLSLVNEAQYLLINTSSILELHRQLNTS-------------------------------
H2QEG1_PANTR          ATLSLVNEAQYLLINTSSILELHRQLNTS-------------------------------
G3R2H1_GORGO          ATLSLVNEAQYLLINTSSILELHRQLNTS-------------------------------
G1R2Q1_NOMLE          ATLSLVNEAQYLLINTSSILELHRQLNTS-------------------------------
F7F1W1_CALJA          ATLSLVNEAQYLLINTSSILELHQWLNTS-------------------------------
I3MGJ4_ICTTR          ATLSLVNEAQYLLINTSSILELQQQLCTS-------------------------------
MOCOS_BOVIN           ATLSLVNEAQYLLINRSSILELQQQLSTS-------------------------------
F1PDQ7_CANLF          ASLSLVNEAQYLLINRSSVLELQQQLNAS-------------------------------
G3T425_LOXAF          PTLSLVNEAQYLLLNRSSVLELQQQLNFS-------------------------------
H0WXY3_OTOGA          NMPEIIHGSLYLNLCRKSLMKTHKVLNS--------------------------------
G1SDV9_RABIT          ATLSLVNEAQYLLVNRSSVWELQQQLSTS-------------------------------
MOCOS_MOUSE           VALSLVNEAQYLLVNTSSILELQRQLNAS-------------------------------
F7BDB2_ORNAN          ASLSLVNQAQYLLINTASILELRQQLNNS-------------------------------
F6R8F7_MONDO          ASLSLVNEAQYLLINRASVLELHQLLNES-------------------------------
MOCOS_DANRE           TPLSLVNEAQFLLINRASVCFLQEAIANRY------------------------------
G3NFC5_GASAC          TSLSLVNEAPYLMINRASAELIHKLMSSRQ------------------------------
C3ZGY8_BRAFL          ------------------------------------------------------------
W4XCH4_STRPU          CSLSLANQSQYLLVTASSSASLLSAVKQSS------------------------------
E0VP85_PEDHC          VKLSLTNQAQFLMINNESVRWLHEIINQD-------------------------------
E9GUD0_DAPPU          ---SLVNDSSFLLVNLNSVSSLQMQFRND-------------------------------
MOCO1_AEDAE           QEIALANQAQFLLINQASVRWLADKVPDWD------------------------------
MOCO3_AEDAE           QEIALANQAQFLLINQASVRWLADKVPDWD------------------------------
MOCOS_ANOGA           RALSLNNQAQLLLINRTSVRWLRDKV---G------------------------------
W5JIU0_ANODA          HQLSLNNQAQFLLINRTSVRWLSDAVDDWG------------------------------
MOCO2_AEDAE           ------PPHKLLMINWDAMKTLSDDE----------------------------------
MOCOS_DROME           QKLSLVNQAQFLLLNKSSVRSLQFEE----------------------------------
MOCOS_DROPS           QKLSLVNQAQFLLVNRSSVRSLQFEE----------------------------------
A0A158NCR0_ATTCE      TELS--NQASYLAINEASMS-FIDKISDDL------------------------------
F4WEC2_ACREC          AELS--NQASYLAVNEASVSLFIDKISDDL------------------------------
A0A158ND12_ATTCE      IELSFSSQAQYLAINEASVSWLIDKVSHDL------------------------------
MOCOS_BOMMO           KLLSLSNQAQYLLINKATVKWLSEKIKDPL------------------------------
MOCOS_ARATH           SNINFANEAQFLLISEESVADLNRRLEAK-------------------------------
MOCOS_SOLLC           ARLNFVNEAQFLLISEESIKDLNSRLKSN-------------------------------
MOCOS_ORYSJ           SKLNFVNEGQLLLISEESISDLNSRLNSG-------------------------------
I1Q4H9_ORYGL          SKLNFVNEGQLLLISEESISDLNSRLNSG-------------------------------
I1GW21_BRADI          SKLSFVNEGQLLLISEQSVSDLNSRLSSS-------------------------------
A9RRC7_PHYPA          RELSFANEGQFLLVSKASVDELNRRDNVS-------------------------------
H3G8M7_PHYRM          PSIGFANQAQYLLISRQSIAHFNAVLRSV-------------------------------
A0A0D1C4I7_USTMA      VPLIFSNESPFLLINAASVDKVSEWVDQETAVSPACSCSCSCSCSCSSTAMDELASDSGY
R9NYF0_PSEHS          VPLIFSNESPFLLINSASIDEVCEWMQQDTA-----------EAGYTSVGTEEVASDSGY
A0A081CFS5_PSEA2      VPLIFSNESPFLLINSASVARVGEWMHAAAH-----------------PGTEDLASDSGY
F4P4U4_BATDJ          MTPSFANKSPYLIISQSSYDLVATRVKQKN------------------------------
                                                                                  

MOCOS_EMENI           ---PCSNPGSAASKKAVAADVFRANVVVAENISTA-------------------------
MOCOS_ASPFU           ---KIR----TGTSKAVAADVFRANIVVAESLADSPK-----------------------
C0NNC6_AJECG          -------KSTSKGTRAVAADVFRANIIVAENPALAPSSRNGDSNGSATGSICTPPTL---
J3K5A2_COCIM          ----------QNNAKTVPCNVFRANIIVSEDLSPSRMDRRTGDNES--------------
I1RC08_GIBZE          ---------GGN---PAEDKSFRANIVLGRASGFKALPA---------------------
C7YKM0_NECH7          ---------GGS---PVEERAFRANIVLEHAPGTKAYTA---------------------
F9FQI9_FUSOF          ---------GGS---SVEEKSFRANITLEQAPGFKAQPA---------------------
MOCOS_NEUCR           ---------NPSVSQPISEAVFRANLVLSPSPSTPSASPSNPLTPSPSPSTTSKPTPKPK
D5G5P1_TUBMM          ------------GGKLAKPEVFRGNIVIRETTVVKRA-----------------------
U9SZA5_RHIID          ------------GNQEVEPDCFRGNFLIKGTKEFE-------------------------
MOCOS_DICDI           ------PDSVPSDWNWISKHSFRANFIITG------------------------------
F1A5V2_DICPU          ------PNSDKSEWNWISKHSFRANLIIKG------------------------------
D3BH81_POLPP          ------SNSLANEWNWITTSSFRANFVIKG------------------------------
MOCOS_CAEBR           ---------------QDILTRFRSNIVVRG------------------------------
MOCOS_CAEEL           ---------------REILTRFRSNIVVRG------------------------------
MOCOS_HUMAN           ----DENGKEELFSLKDLSLRFRANIIING------------------------------
H2QEG1_PANTR          ----DENGKDELFSVKDLSLRFRANIIING------------------------------
G3R2H1_GORGO          ----DENGKDELFSVKDLSLRFRANIIING------------------------------
G1R2Q1_NOMLE          ----DKNGKEELFSVKDLSLRFRANIIING------------------------------
F7F1W1_CALJA          ----DENGKEELFSVKDLSLRFRANIIISG------------------------------
I3MGJ4_ICTTR          ----DENGKEELFPMKDLISRFRANIITNG------------------------------
MOCOS_BOVIN           ----CENGKEELFPMNNLISRFRANIITNG------------------------------
F1PDQ7_CANLF          ----DENGKEELFPMKDLISRFRANIITNG------------------------------
G3T425_LOXAF          ----DENGKEKLFPMSDLISRFRANIITNG------------------------------
H0WXY3_OTOGA          ----DQNGKGELFPVKDLILRFRANIITNG------------------------------
G1SDV9_RABIT          ----NENGRQESFPMQDLISRFRANIIISG------------------------------
MOCOS_MOUSE           ----DEHGKEESFSMKDLISRFRANIITKG------------------------------
F7BDB2_ORNAN          ----VENQVEDLFEIKELIPRFRANIVVDG------------------------------
F6R8F7_MONDO          ----DENGTKELLPMRELIERFRANIVING------------------------------
MOCOS_DANRE           ----NSDNEETWRDTEQLVQRFRANLVISA------------------------------
G3NFC5_GASAC          ----DDTEGDQLLDTQNVISRFRANLVIAG------------------------------
C3ZGY8_BRAFL          ------------IPIEDLVLRFRGNLVIDS------------------------------
W4XCH4_STRPU          ----HQESNGNQLSMDDMVSRFRSNLVVEG------------------------------
E0VP85_PEDHC          ----------GDLDFNNVSNRFRGNFYIEG------------------------------
E9GUD0_DAPPU          ----DSSAPISTVTNEELVTRFRGNFVISG------------------------------
MOCO1_AEDAE           ---ELHEE----PTLESLVDRFRGNLIVET------------------------------
MOCO3_AEDAE           ---ELHEE----PTLESLVDRFRGNLIVET------------------------------
MOCOS_ANOGA           ---DGDWDGADAPSLDALVDRFRGNLIVET------------------------------
W5JIU0_ANODA          ---DVDDDGANPPTLDSLVDRFRGNLIIET------------------------------
MOCO2_AEDAE           ---GVESD----ATMSWLVDHFRGSLIVEG------------------------------
MOCOS_DROME           -------------PLDETVDRFRANIIIDT------------------------------
MOCOS_DROPS           -------------SLDETVDRFRANIIIDT------------------------------
A0A158NCR0_ATTCE      ---NFQKDI---------VYQFRANIIVEG------------------------------
F4WEC2_ACREC          ---NFQKDI---------VHQFRANIIVEG------------------------------
A0A158ND12_ATTCE      ---DFKKDTA--------VHRFRGNIIVEG------------------------------
MOCOS_BOMMO           ----FTDDLNH------LTDRFRGNLIIEM------------------------------
MOCOS_ARATH           -----DED-YKRAHEKLNPHRFRPNLVISG------------------------------
MOCOS_SOLLC           -----GRRRNGGQAVQVGVMRFRPNLVASS------------------------------
MOCOS_ORYSJ           -----KGD--CKQKLPVDAMRFRPNLVISG------------------------------
I1Q4H9_ORYGL          -----KGD--CKQKLPVDAMRFRPNLVISG------------------------------
I1GW21_BRADI          -----NGN--GKQQMLVDAMRFRPNIVISG------------------------------
A9RRC7_PHYPA          -----LQQ---PSLIEVDALRFRPNIVVSG------------------------------
H3G8M7_PHYRM          -----DSS------MAVDEDVFRANLIVDGC-----------------------------
A0A0D1C4I7_USTMA      SSASHTEGKDKQDGLIAQGASFRANFLISPIDGTA-------------------------
R9NYF0_PSEHS          SSGPHPERRDKRSGLLAQAASFRANFLVSPCDGGP-------------------------
A0A081CFS5_PSEA2      SSASHSTDPTPTS---AQAASFRANFMISSADGKEG------------------------
F4P4U4_BATDJ          ------------PVAHVDIMAFRPNLVIHG------------------------------
                                           ** ..                                  

MOCOS_EMENI           ------ERPYIEDTWASLSIGSGPE------------------QLRFDVLGSCERCQMVC
MOCOS_ASPFU           -----MEQPYIEDQWEALKIGPG--------------------ELRFDVLGSCQRCSMVC
C0NNC6_AJECG          ----LTEHPYVEDTWRGFRVGPH----------------------KFDVLGSCQRCQMVC
J3K5A2_COCIM          ----LTEHPYIEDHWSGFRIGNW----------------------RFDVLSSCQRCQMVC
I1RC08_GIBZE          ---------FSEDSWDSVHIGLQS----------------------FKLMGACRRCQMVC
C7YKM0_NECH7          ---------FAEDDWGSVHIGRQN----------------------FKLLGACHRCQMVC
F9FQI9_FUSOF          ---------FSEDRWSSMSIGCQN----------------------FRLL----------
MOCOS_NEUCR           QKPKQKLNPYEEDTWSSLTIFNSSSFSSSSSSCSTPSSSGFQTTTKFQMLGSCRRCHMVC
D5G5P1_TUBMM          ---------YAEDFWKHVKIGQEH----------------------FQLLGPCRRCHMVC
U9SZA5_RHIID          -----------EDQWKFVKFDEQV----------------------FKIIGPCRRCNMTC
MOCOS_DICDI           ------GKAYQEDLWSQFQLISKQQND---------TTQSSSSPLVFNSVGDCNRCKMIC
F1A5V2_DICPU          ------GKPYQEDLWSQFQLISDNEENNQGNGGGSPSITATKHPLLFNLVGDCNRCKMVC
D3BH81_POLPP          ------GYPYEEDGYDRFTIGEN----------------------TFQTIGLCNRCKMIC
MOCOS_CAEBR           ------LPPFIEDTAKRLSIENL----------------------EFEVVDKCTRCEMIC
MOCOS_CAEEL           ------LPPFIEDTAKRLSIENL----------------------EFEVVDKCTRCEMIC
MOCOS_HUMAN           ------KRAFEEEKWDEISIGSL----------------------RFQVLGPCHRCQMIC
H2QEG1_PANTR          ------KRAFEEEKWDEISIGSL----------------------RFQVLGPCHRCQMIC
G3R2H1_GORGO          ------KRAFEEEKWDEISIGSL----------------------RFQVLGPCHRCQMIC
G1R2Q1_NOMLE          ------KRAFEEEKWDEISIGSL----------------------HFQVLGPCHRCQMIC
F7F1W1_CALJA          ------KRAFEEEKWDEISIGSL----------------------RFQVLGPCHRCQMIC
I3MGJ4_ICTTR          ------TRAFEEEKWGEISIGPL----------------------RFQVLGPCHRCQMIC
MOCOS_BOVIN           ------TRAFEEEKWDEISIGSL----------------------RFQVLGPCHRCQMIC
F1PDQ7_CANLF          ------TRAFEEEKWDEISIGSL----------------------RFQVSGPCHRCQMIC
G3T425_LOXAF          ------TRAFEEEKWDEISIGSL----------------------RFQVSGPCHRCQMIC
H0WXY3_OTOGA          ------MKAFEEEKWDEISIGSL----------------------RFQVMGPCHRCQMIC
G1SDV9_RABIT          ------TRAFEEENWDGISVGSL----------------------HFQVVGPCHRCQMIC
MOCOS_MOUSE           ------ARAFEEEKWDEISIGSL----------------------HFQVLGPCHRCQMIC
F7BDB2_ORNAN          ------TEAFEEEMWTEVGIDTL----------------------RLEVVGPCHRCQMIC
F6R8F7_MONDO          ------TQAFEEEKWEEISIGTL----------------------NFLVLGPCHRCQMIC
MOCOS_DANRE           ------QEPFAEDNWSHLTIGNT----------------------QFQVIGKCGRCQMIG
G3NFC5_GASAC          ------GEPFEEDNWPHLIIGNT----------------------RFVVAGQCGRCQMVG
C3ZGY8_BRAFL          ------GQAYEEDQWSEVMIGQQ----------------------QFQSRGQCSRCQMVC
W4XCH4_STRPU          ------CGAFDEESWSKIAIGGQ----------------------EFEVKGCCNRCQMIC
E0VP85_PEDHC          ------GVEFSENNWKTVSIGSV----------------------KFKVEGPCGRCQMIC
E9GUD0_DAPPU          ------ANAFEEDSWTKIKIGPF----------------------AFKNVGPCYRCQMVC
MOCO1_AEDAE           ------PKSMEECDWKRVTIGYL----------------------EFAVDGPCSRCQMIC
MOCO3_AEDAE           ------PTSMEECDWKRVTIGYL----------------------EFAVDGPCSRCQMIC
MOCOS_ANOGA           ------VRPLEESDWRQVLIGPS----------------------QFTVDGPCTRCQMIC
W5JIU0_ANODA          ------SRPLEEADWSGVTIGER----------------------QFGVDGPCTRCQMIC
MOCO2_AEDAE           ------KAEEDLQGWKEVKIGKK----------------------RFKVQANCSRCPMIH
MOCOS_DROME           ------GSAFEELTYKALSIGGI----------------------QFQVEGPCQRCDMIC
MOCOS_DROPS           ------GSAFEELSYKQLTIGQV----------------------QFQVEGPCQRCDMIC
A0A158NCR0_ATTCE      ------CKAFDEMQWKHVRIGNN----------------------NFKVNSSCTRCQMIS
F4WEC2_ACREC          ------CEAFDEMQWKHVRIGNN----------------------NFKVNDSCTRCQMIG
A0A158ND12_ATTCE      ------CKAFDEMKWEHIRIGNN----------------------NFKINGPCTRCQMIC
MOCOS_BOMMO           ------EQELLEREWHSVIIGNH----------------------EFKVEGQCPRCQMVC
MOCOS_ARATH           ------GEPYGEDKWKTVKI----------------------GDNHFTSLGGCNRCQMIN
MOCOS_SOLLC           ------GEPYAEDGWSNINI----------------------GGKYFMSLGGCNRCQMIN
MOCOS_ORYSJ           ------SSPYSEDNWKKLRI----------------------GEACFTSMGGCNRCQMIN
I1Q4H9_ORYGL          ------SSPYSEDNWKKLRI----------------------GEACFTSMGGCNRCQMIN
I1GW21_BRADI          ------SMPYDEDNWKELCI----------------------GEACFTSMGGCNRCQMIN
A9RRC7_PHYPA          ------SAAHDEDHWQSISI----------------------CSQNFRVVGGCNRCQMVN
H3G8M7_PHYRM          ------AESFEEDQWRGVRIRGGGGA----------------GDFDFDVSGPCSRCSVIN
A0A0D1C4I7_USTMA      ------PAAFVEDGISRVVLGAKH---------------------VFGVLGECRRCQMVC
R9NYF0_PSEHS          ------EAPFAEDMFSRVTLGDKH---------------------VFAVLGECRRCQMVC
A0A081CFS5_PSEA2      ------KDAFVEDGLSRVVIGGKH---------------------VFGVLGECRRCQMVC
F4P4U4_BATDJ          ------LIPFSEDQWISKSIQLGGT--------------------QFEIQEHCSRCQMIC
                                         .                          :             

MOCOS_EMENI           VDQYTGQRGD--EPYATLAKTRK-IDRKILFGRHISPVGR---PKDAENGCL--------
MOCOS_ASPFU           IDQFTGVRRD--EPFSTLAKTRK-INNKIVFGRHCSLSASEVTQDQHDNAER--------
C0NNC6_AJECG          VDQFTAVRSE--EPFTTLAKTRK-VDGKVTFGKHVCLSHD-NSEDGVNGRGK--------
J3K5A2_COCIM          IDQDTGVRSE--EPYSTLAKTRK-INGKVYFGRHICLANA-SS--GRQG-LC--------
I1RC08_GIBZE          IDQDTGEKKE--EPFVTLAKTRR-FDGKVYFGVHMRHDPLAHGDLTSKESQ---------
C7YKM0_NECH7          IDQETGEKRE--EPFVTLAKTRR-FDGKVYFGVHMRHDSFAQGDCTTKETQ---------
F9FQI9_FUSOF          -DQETGEKKE--EPFVTLAKTRR-FDGKVYFGVHMRHDPFAEGDVMKKESQ---------
MOCOS_NEUCR           IDQTTGSKTAGGEPFVTLSKTRR-FEGKVFFGVHMGLQAEDEEDGHAEDIEKEGTGMGMG
D5G5P1_TUBMM          VDQETAEKNE--EPYVTLAKTRR-IDGRVLFGQHAVHLPLESAGVVPRIRVGD-------
U9SZA5_RHIID          INHKTAEVAK--EPYSTLALCRQ-FNGKIHFGQHMIHVPELSEK----------------
MOCOS_DICDI           INQKMG--IEEREPLSTLASYRR-SGGKIIFGQHLNFADSIKRNNSHTNDTALS------
F1A5V2_DICPU          INQKMG--IEEREPLTTLSKYRR-SNGKIIFGQHLNLSDSILNIINSNNSIGNG------
D3BH81_POLPP          INQTMG--IEEKEPLATLSTYRR-NQGKIVFGQHLQYVESQ-------------------
MOCOS_CAEBR           VDPMTG--EKDPSLLLALRDYR--NKQKMTFGIYIRQSNFE-------------------
MOCOS_CAEEL           VDPMTG--EKDPSLLLALRDYR--NKQKMTFGIYIRQTNFE-------------------
MOCOS_HUMAN           IDQQTG--QRNQHVFQKLSESR---ETKVNFGMYLMHASLD-------------------
H2QEG1_PANTR          IDQQTG--QRNQHVFQKLSESR---ETKVNFGMYLMHTSLD-------------------
G3R2H1_GORGO          IDQQTG--QRNQHVFQKLSESR---ETKVNFGMYLMHASLD-------------------
G1R2Q1_NOMLE          IDQQTG--QRNQHVFQKLSESR---ETK--FGMYLMHTSLD-------------------
F7F1W1_CALJA          IDQQTG--QRNQHIFQKLSESR---ERKVNFGMYLMHTSLD-------------------
I3MGJ4_ICTTR          IDQKTG--QRNQDVFQKLSESR---ERKVNFGVYLMHESLD-------------------
MOCOS_BOVIN           IDQQTG--QRNQDVFQKLSERR---ERKVKFGVYLMHTSLD-------------------
F1PDQ7_CANLF          IDQQTG--QRNQNVFQKLSERR---ERKVNFGVYLMHMSLD-------------------
G3T425_LOXAF          IDQQTG--QRNQEVFQKLSESR---KRKVNFGVYLMHTSLD-------------------
H0WXY3_OTOGA          IDQQTS--QRNQDVFQTLSESR---KRKVNFGVYLTHVSLD-------------------
G1SDV9_RABIT          IDQKTG--QRNQDVFQKLSESR---KRQVNFGVYLMHTSPD-------------------
MOCOS_MOUSE           INQQTG--QRNQDVFQTLSESR---GRKVNFGVYLMHSYLD-------------------
F7BDB2_ORNAN          IDQGTG--ERNKDIFQTLSASR---DRKVNFGIYLMQHSLD-------------------
F6R8F7_MONDO          IDQKTG--QRNQDVFQALSASR---KRKVNFGIYLMHEPSD-------------------
MOCOS_DANRE           VDQKTA--TRTQEPLRSLSECR---SGKVTFGVYLAHQSAR-------------------
G3NFC5_GASAC          VDQETG--SKTKEPLMSLSAYR---NGKVTFGVYLTHQLPEG------------------
C3ZGY8_BRAFL          LDQATA--QRSKEPLMTLFQLR---GKKVPFGIHLVHNMAD-------------------
W4XCH4_STRPU          INQDTA--EKGTEPLYTLSAVR---SKKIFFGVHLMNGANL-------------------
E0VP85_PEDHC          IDQKTG--EKNRKPLVALSRAL---SGKLQFGIYLSQQIQPE------------------
E9GUD0_DAPPU          VDQNTA--SRNQEALSVLANFR---GKKMPFGICLEMSSQS-------------------
MOCO1_AEDAE           IDQGTG--VKATEPLRTIGREF---KGKMRFGIYLSHVNPLR------------------
MOCO3_AEDAE           IDQGTG--VKTTEPLRTIGREF---KGKMRFGIYLSHVNPLR------------------
MOCOS_ANOGA           IDQATG--ERTAEPLRTISREF---GGRMRFGVYLSLAGDWA------------------
W5JIU0_ANODA          IDQATG--KKTAEPLRTICREF---GGKMRFGIYLSHAGTLS------------------
MOCO2_AEDAE           VDQSGE--AIPADSLKAIANVF---TKKIPLGVHLTAVDEGF------------------
MOCOS_DROME           INQRTG--ERSPETLTTISRLQ---KGRMRFGIYITRIPQDT------------------
MOCOS_DROPS           INQRTG--ERSPETLTTISRLQ---SGKMRFGIYISRISTEN------------------
A0A158NCR0_ATTCE      YQITGE--KII-EPLRTL-EKL---DGKLRFGICLTRLDNMQ------------------
F4WEC2_ACREC          DQIIDE--KIIKQPLRTLTEEL---HGKLRFGICLTRLDNTQ------------------
A0A158ND12_ATTCE      IDQTTG--KKTIEPLRTLAEKF---HGKLRFGIYLTRLENTQ------------------
MOCOS_BOMMO           IDQQTG--EKTVEPLRTIAEQF---GGKLRFGIYLSYVGTVN------------------
MOCOS_ARATH           ISNEAGLVKKSNEPLTTLASYRR-VKGKILFGTLLR-YEIDEKRQ---------------
MOCOS_SOLLC           INPEAGEVQRFTEPLATLAGYRR-AKGKIMFGILLR-YENNTKTES----D---------
MOCOS_ORYSJ           LHQDSGQVLKSKEPLATLASYRR-KKGKILFGILLN-YEDIMEGENETIAG---------
I1Q4H9_ORYGL          LHQDSGQVLKSKEPLATLASYRR-KKGKILFGILLN-YEDIMEGENETIAG---------
I1GW21_BRADI          LHQSSGQVIKSKEPLATLASYRR-EKGKIMFGVLFN-YEDGLDGEEETVAE---------
A9RRC7_PHYPA          IDQSSG-LRESNQPLATLASYRR-HKGQITFGILLQQYKFDVEDSNSKLCDNPE------
H3G8M7_PHYRM          LDQRTGQFNRR--PLQVLSSYRR-QRSSIFFGQFLTLQAAASASV---------------
A0A0D1C4I7_USTMA      VDQRTG--EIKPQLLKTLAKHRRNGKGRIIFGSHLAWLPNLSASNR--------------
R9NYF0_PSEHS          VDQCTG--EVKPQTLKTLAKHRRNGRGRIIFGSHLAWLPGLELRSSGRF-----------
A0A081CFS5_PSEA2      VDQKTG--QVKPQTLKTLARWRRNARGRIIFGSHLAWLPDLAPSAAA-------------
F4P4U4_BATDJ          IDQATC--KRHSEPLSTLAKMHR-IDGRVVFGVHAWSKDQHL------------------
                                       :                                          

MOCOS_EMENI           ------------------GTIMVGDAVTPSYDNES-------------------------
MOCOS_ASPFU           ------------------WTLMVGDIVIPSYAHDYTL-----------------------
C0NNC6_AJECG          ------------------VMIMTGQVVEPLYEETV-------------------------
J3K5A2_COCIM          ------------------PTVKVGDRVEPFYGRFG-------------------------
I1RC08_GIBZE          -----------------YPTIQVGDSVSVQHRG---------------------------
C7YKM0_NECH7          -----------------YPTIEVGDSVSVEPRD---------------------------
F9FQI9_FUSOF          -----------------YPTIEVGDSVSVELRG---------------------------
MOCOS_NEUCR           TGTGTGTGTRSMGGNGSVVKVRVGDVVRPSYL----------------------------
D5G5P1_TUBMM          ----------------VVRILQDGDVEEVDQGSLAGQAGVA-------------------
U9SZA5_RHIID          ------------------PYLIKMDYMELVMD----------------------------
MOCOS_DICDI           -------SNESSISSSNPIFLHVPSKLKVLSERY--------------------------
F1A5V2_DICPU          ------GSSESSTSLPTPVFINVPSKIKVISERY--------------------------
D3BH81_POLPP          ----------EGCDGTIKKLISIHSKVERINNCNT-------------------------
MOCOS_CAEBR           ----------------PGQFVEAGSAVRFFTD----------------------------
MOCOS_CAEEL           ----------------SGQYLESGMSVNFSTD----------------------------
MOCOS_HUMAN           ------LSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS-----------------
H2QEG1_PANTR          ------LSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS-----------------
G3R2H1_GORGO          ------LSSPCFLSVGSQVLPVLKENVKGHDLPASEKHQDVTS-----------------
G1R2Q1_NOMLE          ------LSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS-----------------
F7F1W1_CALJA          ------LSSPCFLSVGSQVLSVLKENVEGHDLPASEKHQDVTS-----------------
I3MGJ4_ICTTR          ------LSSPCFLSVGSQVLPVSKENVELHNSPALKKHRDVSS-----------------
MOCOS_BOVIN           ------LSSPCYLSVGSQVLPLLKENMEHHDIPATE------------------------
F1PDQ7_CANLF          ------LSSPRFLSVGSQVCPVLKENAECPDLPASD------------------------
G3T425_LOXAF          ------LSSPRFLSVGSQVLPVLKENGEC-------------------------------
H0WXY3_OTOGA          ------SSSPCFLSVGSRVLPVLKENLECHNIPASEKHQDVIS-----------------
G1SDV9_RABIT          ------SSSPCFLSVGSQVLPVLKENVQHHDLPASEKPQDVSS-----------------
MOCOS_MOUSE           ------LSSPCFLSVGSEVLPVLKDCGVS-------------------------------
F7BDB2_ORNAN          ------VSSPCLLTVGTPVLPVLKEERKLTVDQGVNRRCQDNTWAGLTGQNRLSHPVPAS
F6R8F7_MONDO          ------SSSSCFLSVESQLLPVLKDTENHS------------------------------
MOCOS_DANRE           ------NSTHPVLSIGSHVIPKISDSTDKF------------------------------
G3NFC5_GASAC          ------SSTISVLSAGSPIQP---------------------------------------
C3ZGY8_BRAFL          -------TEPCCIQVGDEVTPVTMATD---------------------------------
W4XCH4_STRPU          -------KEGVKVRKGDVVRVLARCTSSETTV----------------------------
E0VP85_PEDHC          ------IKKEEIVINVGDVIEITE------------------------------------
E9GUD0_DAPPU          --------NGSVVEIGSRIVRDYTEDSTI-------------------------------
MOCO1_AEDAE           ------DGSEQ-----WLYCNSVVEGLSE-------------------------------
MOCO3_AEDAE           ------DGSEQ-----WLYCNSVVEGLSE-------------------------------
MOCOS_ANOGA           ------DRE--------LPLGATVSGVIEESE----------------------------
W5JIU0_ANODA          ------DGAT-------LVVDASVSGVYE-------------------------------
MOCO2_AEDAE           ------PEGV-------LECGSILEPVRQSDSPKAHIIKDSVSTRYNFLVK---------
MOCOS_DROME           ------KELEP-----KEQHMTCGDVVLVE------------------------------
MOCOS_DROPS           ------NKE--------QQHLTCGDVVVVT------------------------------
A0A158NCR0_ATTCE      ------------------SILKIGDHIYCS------------------------------
F4WEC2_ACREC          ------------------SILKIGDHIYCS------------------------------
A0A158ND12_ATTCE      ------------------GMLKIGDHIYYS------------------------------
MOCOS_BOMMO           ------KSDD--------RTLKTYSPIKAILNDDNISR----------------------
MOCOS_ARATH           ------------------CWIGVGEEVNPDIE----------------------------
MOCOS_SOLLC           ------------------TWIRVGEEIIPNGDRH--------------------------
MOCOS_ORYSJ           ------------------RWLQVGQQVYPSTE----------------------------
I1Q4H9_ORYGL          ------------------RWLQVGQQVYPSTE----------------------------
I1GW21_BRADI          ------------------RWLQVGQEVHSSTW----------------------------
A9RRC7_PHYPA          ------IEYTKWLRTRYTRLISVGSSVNVNKLI---------------------------
H3G8M7_PHYRM          -------------------WLRVGDRVEAHWTV---------------------------
A0A0D1C4I7_USTMA      --------------DEDDAKVWVGMQVVAT------------------------------
R9NYF0_PSEHS          --------------DLDDARVWVGMSVVTS------------------------------
A0A081CFS5_PSEA2      --------------PDEANQVWVGMDVIAS------------------------------
F4P4U4_BATDJ          ----------------EFKIIHVGDVYTPPKMNL--------------------------
                                                                                  

MOCOS_EMENI           -------
MOCOS_ASPFU           -------
C0NNC6_AJECG          -------
J3K5A2_COCIM          -------
I1RC08_GIBZE          -------
C7YKM0_NECH7          -------
F9FQI9_FUSOF          -------
MOCOS_NEUCR           -------
D5G5P1_TUBMM          -------
U9SZA5_RHIID          -------
MOCOS_DICDI           -------
F1A5V2_DICPU          -------
D3BH81_POLPP          -------
MOCOS_CAEBR           -------
MOCOS_CAEEL           -------
MOCOS_HUMAN           -------
H2QEG1_PANTR          -------
G3R2H1_GORGO          -------
G1R2Q1_NOMLE          -------
F7F1W1_CALJA          -------
I3MGJ4_ICTTR          -------
MOCOS_BOVIN           -------
F1PDQ7_CANLF          -------
G3T425_LOXAF          -------
H0WXY3_OTOGA          -------
G1SDV9_RABIT          -------
MOCOS_MOUSE           -------
F7BDB2_ORNAN          SYPGPVK
F6R8F7_MONDO          -------
MOCOS_DANRE           -------
G3NFC5_GASAC          -------
C3ZGY8_BRAFL          -------
W4XCH4_STRPU          -------
E0VP85_PEDHC          -------
E9GUD0_DAPPU          -------
MOCO1_AEDAE           -------
MOCO3_AEDAE           -------
MOCOS_ANOGA           -------
W5JIU0_ANODA          -------
MOCO2_AEDAE           -------
MOCOS_DROME           -------
MOCOS_DROPS           -------
A0A158NCR0_ATTCE      -------
F4WEC2_ACREC          -------
A0A158ND12_ATTCE      -------
MOCOS_BOMMO           -------
MOCOS_ARATH           -------
MOCOS_SOLLC           -------
MOCOS_ORYSJ           -------
I1Q4H9_ORYGL          -------
I1GW21_BRADI          -------
A9RRC7_PHYPA          -------
H3G8M7_PHYRM          -------
A0A0D1C4I7_USTMA      -------
R9NYF0_PSEHS          -------
A0A081CFS5_PSEA2      -------
F4P4U4_BATDJ          -------