CLUSTAL format seed alignment for MF_03051

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MOC2A_DICDI       ------------------------------------------------------------
F0ZGL6_DICPU      ------------------------------------------------------------
D3AXS2_POLPP      ------------------------------------------------------------
MOC2A_HUMAN       ------------------------------------------------------------
MOC2A_MOUSE       ------------------------------------------------------------
G1KCD1_ANOCA      ------------------------------------------------------------
F8W2T9_DANRE      ------------------------------------------------------------
C6T427_SOYBN      ------------------------------------------------------------
B9IQ84_POPTR      ------------------------------------------------------------
D7TL73_VITVI      ------------------------------------------------------------
M1AMG8_SOLTU      ------------------------------------------------------------
MOC2A_ARATH       ------------------------------------------------------------
M0TUM0_MUSAM      ------------------------------------------------------------
I1P1B8_ORYGL      ------------------------------------------------------------
MOC2A_ORYSJ       ------------------------------------------------------------
I1IAL0_BRADI      ------------------------------------------------------------
C5XUW2_SORBI      ------------------------------------------------------------
A9U0K0_PHYPA      ------------------------------------------------------------
MOC2A_CHLRE       ------------------------------------------------------------
MOC2A_AEDAE       ------------------------------------------------------------
MOC2A_ANOGA       ------------------------------------------------------------
MOC2A_DROME       ------------------------------------------------------------
I5AP57_DROPS      ------------------------------------------------------------
H9J5T5_BOMMO      ------------------------------------------------------------
MOC2A_CAEBR       ------------------------------------------------------------
MOC2A_CAEEL       ------------------------------------------------------------
G4LX65_SCHMA      ------------------------------------------------------------
B7Q3T5_IXOSC      ------------------------------------------------------------
C0NB74_AJECG      ------------------------------------------------------------
C5GBN7_AJEDR      ------------------------------------------------------------
Q4WAK0_ASPFU      ------------------------------------------------------------
B6HMV4_PENRW      ------------------------------------------------------------
MOC2A_EMENI       ------------------------------------------------------------
J3KDI3_COCIM      --------MPSIPDSRLLPLLSRRISPVTGRLGMEHKLPRTQLPPHLAIPAKPGDQIKTK
MOC2A_PHANO       ------------------------------------------------------------
I1S503_GIBZE      ------------------------------------------------------------
C7YK93_NECH7      MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRNVKGPVREDDILCLLES
Q7SGP0_NEUCR      ------------------------------------------------------------
F9WYT5_ZYMTI      ------------------------------------------------------------
D6RM23_COPC7      ------------------------------------------------------------
MOC2A_USTMA       ------------------------------------------------------------
                                                                              

MOC2A_DICDI       ---------------------------------------------------MSNQFKILL
F0ZGL6_DICPU      ----------------------------------------------------MDKFEILL
D3AXS2_POLPP      ----------------------------------------MSTTDTTTDKPNTIEIKCLL
MOC2A_HUMAN       ---------------------------------------------MVPL----CQVEVLY
MOC2A_MOUSE       ---------------------------------------------MVPR----CQIDVLY
G1KCD1_ANOCA      -----------------------------------------------MS----CEVEVLY
F8W2T9_DANRE      -----------------------------------------------MN----TEVSVLY
C6T427_SOYBN      ---------------------MEGD-------IKLLDGDDTHKKKESSL----VKIKVLF
B9IQ84_POPTR      ----------------------MIE-------VKAENTDGEPVGSEGSS----VSIKVLF
D7TL73_VITVI      ------------------MEVKGGE-------KESQTVDSTNKGSDGSS----VGIKFLF
M1AMG8_SOLTU      --------------------MIDKQ-------IDSKDVEALQNGDESRS----LQIKFLF
MOC2A_ARATH       ---------------------MDKE-------VTKIESD------DTSS----VEIKVLL
M0TUM0_MUSAM      ---------------------MTEEPKDTCDMIGSQKTNPSRDKDLAPY----IKIKVLF
I1P1B8_ORYGL      ---------------------MALDPKA----NHAAAAAASADNPTAAA---KVKVKVLF
MOC2A_ORYSJ       ---------------------MALDPKA----NHAAAAAASADNPTAAAAKAKVKVKVLF
I1IAL0_BRADI      ---------------------MLPDAAP----AENPATGSVPAAETAAT----VRVKVLF
C5XUW2_SORBI      ---------------------MAKNPRD----AAAPEEEEMPVAAEGQAAPAAATVKVLF
A9U0K0_PHYPA      --------------------------------MEGSQQEYVGSGKEKVG-----EVQALL
MOC2A_CHLRE       -----------------------------------------------------MQIKVLY
MOC2A_AEDAE       ---------------------------------------MSQGHRSEEV----VRVNLLF
MOC2A_ANOGA       -------------------------------------------MSNTDS----VRVKLLF
MOC2A_DROME       -----------------------------------------MNADGPV-----VNVHVLF
I5AP57_DROPS      ------------------------------------MVFVNMNTSRPVS----VDIHVLF
H9J5T5_BOMMO      ----------------------------------------MEIENIEDT----VTVKLLF
MOC2A_CAEBR       ----------------------------------------------------MVSVKVLF
MOC2A_CAEEL       ----------------------------------------------------MISIKVLF
G4LX65_SCHMA      --------------------------------------------------MTICNKKVLL
B7Q3T5_IXOSC      ---------------------------------------------MHPE----VVVKVLL
C0NB74_AJECG      ---------------------------------------------MSPP-----TFQIHY
C5GBN7_AJEDR      ---------------------------------------------MSPQ-----TFQIHY
Q4WAK0_ASPFU      -----------------------------------------MTSKETQP-----VFQIHY
B6HMV4_PENRW      ----------------------------------------------MPE-----TFTIHY
MOC2A_EMENI       -----------------------------------------------MS-----TFQIHY
J3KDI3_COCIM      LLFLRRAGKVIIHLHIKRRHPAHTETMASTSASPAFISNPSTAASQLNG-----TFQIHY
MOC2A_PHANO       ----------------------------------------MASKKAPTG-----HFSILY
I1S503_GIBZE      ----------------------------------------MSAPKPPAG-----HFNVLF
C7YK93_NECH7      ERTASARYGADIVILQFRFTGTQTSFYNSHNSTGTPTSTMASAPKPPPG-----HFNVLY
Q7SGP0_NEUCR      ----------------------------------------MSAPKPPKG-----HFNILY
F9WYT5_ZYMTI      ----------------------------------------MTATKPPAG-----HFTLLY
D6RM23_COPC7      -----------------------------------------------MT-----SITVLY
MOC2A_USTMA       -------------------------------------------MSNGTP-----SVRVLY
                                                                              

MOC2A_DICDI       FAKVKEVIG-----KDSIFIDLPLD--ESTSFNLIRKLKHIYPQI--SSTLEVSLLAVNQ
F0ZGL6_DICPU      FAKAKEVVGN----KTSIVVELPKG--KNTTLHLISQLKTLHPEI--IPILDISLLAVNQ
D3AXS2_POLPP      FAKVKEMILGEHSKDDSVIVNLPAN--KCTTHQLISELKLKYPNI--SNLLDVCMVAVNL
MOC2A_HUMAN       FAKSAEITG-----VRSETISVPQE---IKALQLWKEIETRHPGL--ADVRNQIIFAVRQ
MOC2A_MOUSE       FAKSAEIAG-----VRSETISVPQE---IKASELWKELEMLHPGL--ADVRNQVIFAVRQ
G1KCD1_ANOCA      FARSAELAG-----VRTETISVPQH---VTSLQLWEEIVKKHPRL--AAIQDQVVFAVRQ
F8W2T9_DANRE      FAKSAELTG-----LKAEIITVPSN---ISSVQLWQDLENRHPRL--SVLRGKVVLAVRQ
C6T427_SOYBN      FARARDLTG-----LSELPLEVSSG---STTHDCLKKLFVKFPSL--EEIRGCMVLALNE
B9IQ84_POPTR      FARARDITG-----LADMQLEVSSG---STTSDCLNKLIARFPSL--EEIRGCIVLALNE
D7TL73_VITVI      FARARDLTGG----LTDMPMEVPSG---STAHDCLNKLVAKFPRL--EEIRGCMVLALNE
M1AMG8_SOLTU      FARARDLTG-----MTEMPLEVSYG---STAGDCLDKVISHFPRL--EEIRGCMLLARNE
MOC2A_ARATH       FARARELTG-----VPDLTLKMPSG---STTQKCLDELVLKFPSL--EEVRSCVVLALNE
M0TUM0_MUSAM      FARARDLTG-----STELCLEMPDG---STARDCMNKLLIEFPNL--REIYNSMVLALNE
I1P1B8_ORYGL      FARARDLTG-----VTEAPVEVPAG---STAGDCLARVLAAFPRL--EEIRRSMVLALNE
MOC2A_ORYSJ       FARARDLTG-----VTEAPVEVPAG---STAGDCLARVLAAFPRL--EEIRRSMVLALNE
I1IAL0_BRADI      FARARDLTG-----VAESSVEVPPG---STAGACLGQVLASFPKL--EEIRRSMVLALNE
C5XUW2_SORBI      FARARDLTG-----VADSAVEVPPG---STAGECLARVLAQFPKL--EEIRGSVVLALNE
A9U0K0_PHYPA      FAKAQELAG-----VSQITLEIQKG---WTTANCFEAVMTKYPAL--KAIRSCMMVALNH
MOC2A_CHLRE       FAKSREVAG-----VNEQTFELGDG---AHTEDLLAQIIAAHPAL--DSVMKTCVFALNQ
MOC2A_AEDAE       FAKSRELVGT----SSLDNFPLATSGGHLSGSAVLGTICERFPEL--VAIRDSVIIAHNE
MOC2A_ANOGA       FAKSRELAGV----SGTDDFLVPHA--EIKCSELLDLICNRY-NL--SIIRNNVILAHNE
MOC2A_DROME       FAKSRELANT----PR-STVEVPTE---ITATELLDHLVSKF-GL--TSIRDNLILAHNE
I5AP57_DROPS      FAKCRELSQ-----TTRSVFTVPSE---IRASDLLDKIVIQFGLT---TIRHNLIIAHNE
H9J5T5_BOMMO      FAKSKELSGV----RE-TSITLPRK---LGYQRLLNIICDKY-NL--NSIKKNILLAKNE
MOC2A_CAEBR       FGEAFQLVG-----KREETVEFPAE---TDYEELRRIILEKYPAL--SKIEKVMMLAVDQ
MOC2A_CAEEL       FGEACQLVG-----KREEAIDFPEE---TDYEEIRKTILENYPAL--QKIEKVMMLAVDQ
G4LX65_SCHMA      FGEASELVG-----CKEITIQFPLS---CTNKTLKDIIIEQLVKL--EPLKDSLTVAVNW
B7Q3T5_IXOSC      FAKARDLAGG----VSELSLPFPSV--LRDVEELKQVLFSTHPQL--RPLQHCAVIAVNE
C0NB74_AJECG      FSTASSYTR-----KQTESFPAP-----FPLPKLFDLLESRYPGI-KEKVLVSCAVSVGL
C5GBN7_AJEDR      FSIASAYTK-----KHTESLPAP-----LPLFKLFDLLESRYPGI-KEKVLVSCAVSVGL
Q4WAK0_ASPFU      FSSASSYTN-----KATETLPAP-----LPLSRLFDFLEERYPGI-REKVLVSCGVSLGE
B6HMV4_PENRW      FATASQYTS-----KNTESLPAP-----LKLSALFGELEQRYPGI-VPKVLSTCGVSLNG
MOC2A_EMENI       FASASTYTG-----RNTESLPAP-----LPLSSLFDTLEAKYPGI-KEKVLSSCSISLGD
J3KDI3_COCIM      FASAFSFTG-----KATEPLPAP-----LPVHKLFDILDERYPGI-KEKVLSSCAVSVGL
MOC2A_PHANO       FAAASTFTG-----KTSEHLPAP-----IKACDLFDTLEDRYPGI-KGKVLASCAVTVDL
I1S503_GIBZE      FASASSFTG-----KDHEALPAT-----MALSKLFAELENRYPGI-KAKILDSCLVTVNL
C7YK93_NECH7      FATASSFTG-----KDYDAVPAA-----MSLKQLFAELELRYPGI-KAKILDSCLVTVNL
Q7SGP0_NEUCR      FATASSHTG-----KDMEALPAP-----LPLRKLFDTLEERYQGI-REAVLDHSLVTINL
F9WYT5_ZYMTI      FAASTSYSR-----KEHDFFQAP-----LPIAKLFDMLDNQYPGI-KSRVLDSSAVTVNL
D6RM23_COPC7      FAAASTETG-----LTVEKVPIPTQ--GLALSSLPGLLVSRHPGTNLEQVFQTSQWSVDA
MOC2A_USTMA       FASARTTIG-----HSSETISLPTT--PFPLASLITLIANKYSSRGAEAVLRTCRWSVDN
                  *.                 .                 :                  :   

MOC2A_DICDI       EYISRD------QD----------------------------IKINSNDEIAIIPPVSGG
F0ZGL6_DICPU      EYVERG------RD----------------------------IEINSKDEIAIIPPVSGG
D3AXS2_POLPP      EYIDRS------ND----------------------------LEIKKRDEVAIIPPVSGG
MOC2A_HUMAN       EYVELG-----DQL----------------------------LVLQPGDEIAVIPPISGG
MOC2A_MOUSE       EYVELG-----DQQ----------------------------LLLQPGDEVAIIPPISGG
G1KCD1_ANOCA      EYVLLG-----DQL----------------------------LDLRSGDEVAIIPPISGG
F8W2T9_DANRE      EFVSLC-----EQP----------------------------LSLRDGDELAIIPPLSGG
C6T427_SOYBN      EYT--------TES----------------------------TIVKDTDELAIIPPISGG
B9IQ84_POPTR      EYT--------TEA----------------------------AIVKEKDELAIIPPISGG
D7TL73_VITVI      EYT--------PES----------------------------TVVKDRDELAIIPPISGG
M1AMG8_SOLTU      EYT--------AES----------------------------TTVKDGDELAIIPPISGG
MOC2A_ARATH       EYT--------TDS----------------------------AIVQHRDELAIIPPISGG
M0TUM0_MUSAM      EYA--------PES----------------------------TVLRNKDELAIIPPISGG
I1P1B8_ORYGL      EYA--------PED----------------------------AAVGDGDELAIIPPISGG
MOC2A_ORYSJ       EYA--------PED----------------------------AAVGDGDELAIIPPISGG
I1IAL0_BRADI      EYA--------PES----------------------------AAVADGDELAIIPPISGG
C5XUW2_SORBI      EYA--------ADS----------------------------TPVADGDELAVIPPISGG
A9U0K0_PHYPA      DYV--------TEP----------------------------VAVKDGDELALIPPISGG
MOC2A_CHLRE       EYVRP------QDK----------------------------EALKDGDEVAIIPPLSGG
MOC2A_AEDAE       QYCEDL-----TEP----------------------------ISLADGDEIAVIPPIAGG
MOC2A_ANOGA       QYCADL-----SET----------------------------IRIRNGDELAVIPPISGG
MOC2A_DROME       SYIDNL-----SDR----------------------------ILFKEGDELAIIPPLSGG
I5AP57_DROPS      SFVENLN-----DS----------------------------IFLKDGDELAVIPPLSGG
H9J5T5_BOMMO      VVCEDT-----VD-----------------------------IEINEQDNLAVIPPLSGG
MOC2A_CAEBR       EYANPG------DR----------------------------FELERFTEIAVIPPLSGG
MOC2A_CAEEL       EYANPG------DR----------------------------FELVRFTEIAVIPPLSGG
G4LX65_SCHMA      KYTDINTS---LNQ----------------------------ISIEEIEELAILPPISGG
B7Q3T5_IXOSC      SYVESG------AQ----------------------------LTLRPNDEIAFIPPISGG
C0NB74_AJECG      EYVDVAV----ADTNAAK--LDGKDGKEEGGEG--VVQGEEVRIIGPGEEVAIIPPVSSG
C5GBN7_AJEDR      EYVDVHA----DGNGDGDGAVTKADGGEEGGAGGGEQQEKKVRIIGPGEEVAIIPPVSSG
Q4WAK0_ASPFU      EYVDVEA----DGE----------------------------VVIGAGDEVAIIPPVSSG
B6HMV4_PENRW      EYVDAEE----DGE----------------------------VVIQAGGEVAVIPPVSSG
MOC2A_EMENI       EYVDLVS----DGEKSGN----------------------EGLLIQGGDEVAIIPPVSSG
J3KDI3_COCIM      EYVDADG----EDDDANG------------------------RIIQAGEEVAIIPPVSSG
MOC2A_PHANO       EYIDINE----GDAADLE------------------------RVIQEGDEVAIIPPVSSG
I1S503_GIBZE      DYVDLPG---EEGAED--------------------------TMIQEADEVAIIPPVSSG
C7YK93_NECH7      DYVELSS---EEGVDD--------------------------TVIQEADEVAIIPPVSSG
Q7SGP0_NEUCR      GYVDMPSSEDEDGEDNV-------------------------TVIQEGDEVAIIPPVSSG
F9WYT5_ZYMTI      DYVDVEE---ETGKGDAG------------------------LIIKEGDEVAIIPPVSAG
D6RM23_COPC7      EMVE--------DPTTV--------------------------TLRGGEEVAVICPVSGG
MOC2A_USTMA       TLIEI------DELIEW--------------------------TLHGREEVAAIPPVSGG
                                                              .    ::* : *::.*