CLUSTAL format seed alignment for MF_03052

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A8XXG7_CAEBR          MIPKTCTIFALAGCTNSGKSTLAKEFQRHFGAAETTIINQDEFYKTEDEVDKIYHPAAVT
P91500_CAEEL          MTSTKAYVLALAGCTNSGKSTLAKEFQRFFGAGETTIINQDEFYKTENEVEKIYHPDAEH
A0A2H2ILJ2_CAEJA      ------------------------------------------------------------
A7RSI0_NEMVE          ------------------------------------------------------------
D0NGD0_PHYIT          ------------------------------------------------------------
G3QG23_GORGO          ------------------------------------------------------------
H2QQV7_PANTR          ------------------------------------------------------------
MOC2B_HUMAN           ------------------------------------------------------------
G1RJJ3_NOMLE          ------------------------------------------------------------
F7IBH5_CALJA          ------------------------------------------------------------
G1T185_RABIT          ------------------------------------------------------------
H0X442_OTOGA          ------------------------------------------------------------
E2RI62_CANLF          ------------------------------------------------------------
M3WV85_FELCA          ------------------------------------------------------------
G1LMH7_AILME          ------------------------------------------------------------
MOC2B_BOVIN           ------------------------------------------------------------
F1SMF3_PIG            ------------------------------------------------------------
G5E7D1_LOXAF          ------------------------------------------------------------
MOC2B_MOUSE           ------------------------------------------------------------
MOC2B_RAT             ------------------------------------------------------------
L7N1E2_MYOLU          ------------------------------------------------------------
F6RWP4_MONDO          ------------------------------------------------------------
G3VIP0_SARHA          ------------------------------------------------------------
MOC2B_TAEGU           ------------------------------------------------------------
M3XJ03_LATCH          ------------------------------------------------------------
E7FEQ3_DANRE          ------------------------------------------------------------
I3K3S6_ORENI          ------------------------------------------------------------
Q4TB40_TETNG          ------------------------------------------------------------
F6ZA98_CIOIN          ------------------------------------------------------------
H2Z5M7_CIOSA          ------------------------------------------------------------
MO2B1_AEDAE           ------------------------------------------------------------
MO2B2_AEDAE           ------------------------------------------------------------
MOC2B_ANOGA           ------------------------------------------------------------
MOC2B_DROME           ------------------------------------------------------------
MOC2B_DROPS           ------------------------------------------------------------
E0VV36_PEDHC          ------------------------------------------------------------
A0A088AB86_APIME      ------------------------------------------------------------
A0A158NAQ4_ATTCE      ------------------------------------------------------------
E9GWU7_DAPPU          ------------------------------------------------------------
B7Q3T4_IXOSC          ------------------------------------------------------------
F6HAF9_VITVI          ------------------------------------------------------------
F6HAG2_VITVI          ------------------------------------------------------------
B9GFS6_POPTR          ------------------------------------------------------------
K4C981_SOLLC          ------------------------------------------------------------
M1A5J7_SOLTU          ------------------------------------------------------------
MOC2B_ARATH           ------------------------------------------------------------
I1NX57_ORYGL          ------------------------------------------------------------
MOC2B_ORYSJ           ------------------------------------------------------------
I1IPN9_BRADI          ------------------------------------------------------------
C5XUJ7_SORBI          ------------------------------------------------------------
A9S6R9_PHYPA          ------------------------------------------------------------
B3RRC7_TRIAD          ------------------------------------------------------------
MOC2B_DICDI           ------------------------------------------------------------
D3BU88_POLPP          ------------------------------------------------------------
A9UST4_MONBE          ------------------------------------------------------------
C0NQH4_AJECG          ------------------------------------------------------------
C5GCQ5_AJEDR          ------------------------------------------------------------
MOC2B_COCIM           ------------------------------------------------------------
MOC2B_EMENI           ------------------------------------------------------------
MOC2B_ASPFU           ------------------------------------------------------------
F9XQE9_ZYMTI          ------------------------------------------------------------
D5GI04_TUBMM          ------------------------------------------------------------
C7YMB7_NECH7          ------------------------------------------------------------
MOC2B_SCLS1           ------------------------------------------------------------
MOC2B_NEUCR           ------------------------------------------------------------
MOC2B_PHANO           ------------------------------------------------------------
A8N1D2_COPC7          ------------------------------------------------------------
A0A0D1E8A8_USTMA      ------------------------------------------------------------
                                                                                  

A8XXG7_CAEBR          LTERGYYWSFDEKEAINIDQFKERILQESKLFKNVIIDGNMITEMDEIVELCDQIVVLTL
P91500_CAEEL          LTDEGYYWSFDEKEAINIDQFRQRILNESKVYKNVIIDGNMITEMDEIVDLCDRIVVMTL
A0A2H2ILJ2_CAEJA      ----------------------------------------MITEMDEILELCDRVIVLTL
A7RSI0_NEMVE          ------------------------------------------------------------
D0NGD0_PHYIT          ------------------------------------------------------------
G3QG23_GORGO          ------------------------------------------------------------
H2QQV7_PANTR          ------------------------------------------------------------
MOC2B_HUMAN           ------------------------------------------------------------
G1RJJ3_NOMLE          ------------------------------------------------------------
F7IBH5_CALJA          ------------------------------------------------------------
G1T185_RABIT          ------------------------------------------------------------
H0X442_OTOGA          ------------------------------------------------------------
E2RI62_CANLF          ------------------------------------------------------------
M3WV85_FELCA          ------------------------------------------------------------
G1LMH7_AILME          ------------------------------------------------------------
MOC2B_BOVIN           ------------------------------------------------------------
F1SMF3_PIG            ------------------------------------------------------------
G5E7D1_LOXAF          ------------------------------------------------------------
MOC2B_MOUSE           ------------------------------------------------------------
MOC2B_RAT             ------------------------------------------------------------
L7N1E2_MYOLU          ------------------------------------------------------------
F6RWP4_MONDO          ------------------------------------------------------------
G3VIP0_SARHA          ------------------------------------------------------------
MOC2B_TAEGU           ------------------------------------------------------------
M3XJ03_LATCH          ------------------------------------------------------------
E7FEQ3_DANRE          ------------------------------------------------------------
I3K3S6_ORENI          ------------------------------------------------------------
Q4TB40_TETNG          ------------------------------------------------------------
F6ZA98_CIOIN          ------------------------------------------------------------
H2Z5M7_CIOSA          ------------------------------------------------------------
MO2B1_AEDAE           ------------------------------------------------------------
MO2B2_AEDAE           ------------------------------------------------------------
MOC2B_ANOGA           ------------------------------------------------------------
MOC2B_DROME           ------------------------------------------------------------
MOC2B_DROPS           ------------------------------------------------------------
E0VV36_PEDHC          ------------------------------------------------------------
A0A088AB86_APIME      ------------------------------------------------------------
A0A158NAQ4_ATTCE      ------------------------------------------------------------
E9GWU7_DAPPU          ------------------------------------------------------------
B7Q3T4_IXOSC          ------------------------------------------------------------
F6HAF9_VITVI          ------------------------------------------------------------
F6HAG2_VITVI          ------------------------------------------------------------
B9GFS6_POPTR          ------------------------------------------------------------
K4C981_SOLLC          ------------------------------------------------------------
M1A5J7_SOLTU          ------------------------------------------------------------
MOC2B_ARATH           ------------------------------------------------------------
I1NX57_ORYGL          ------------------------------------------------------------
MOC2B_ORYSJ           ------------------------------------------------------------
I1IPN9_BRADI          ------------------------------------------------------------
C5XUJ7_SORBI          ------------------------------------------------------------
A9S6R9_PHYPA          ------------------------------------------------------------
B3RRC7_TRIAD          ------------------------------------------------------------
MOC2B_DICDI           ------------------------------------------------------------
D3BU88_POLPP          ------------------------------------------------------------
A9UST4_MONBE          ------------------------------------------------------------
C0NQH4_AJECG          ------------------------------------------------------------
C5GCQ5_AJEDR          ------------------------------------------------------------
MOC2B_COCIM           ------------------------------------------------------------
MOC2B_EMENI           ------------------------------------------------------------
MOC2B_ASPFU           ------------------------------------------------------------
F9XQE9_ZYMTI          ------------------------------------------------------------
D5GI04_TUBMM          ------------------------------------------------------------
C7YMB7_NECH7          ------------------------------------------------------------
MOC2B_SCLS1           ------------------------------------------------------------
MOC2B_NEUCR           ------------------------------------------------------------
MOC2B_PHANO           ------------------------------------------------------------
A8N1D2_COPC7          ------------------------------------------------------------
A0A0D1E8A8_USTMA      ------------------------------------------------------------
                                                                                  

A8XXG7_CAEBR          DFKTCRRRREARTDYVPPDTPGYFENVAFPAYLRHLENARKRSRTDPKITFIDVSEPRFE
P91500_CAEEL          DFKTCKRRREARTDYVPADTPGYFVNVAFPAYVRHLERARQRSRTDSRLTFIDVSESKFD
A0A2H2ILJ2_CAEJA      DVNTCRQRREARTDYVPPDTPGYFEHVAFPAYLRHLNRALIRSRTDARFTFIDVSEPRYS
A7RSI0_NEMVE          ------------------------------------------------------------
D0NGD0_PHYIT          --------------------------------------------------MNTTMTSHTS
G3QG23_GORGO          -----------MSSLEISSSCFNLETKLPLSPRLVEDSAFEPS-----------RKDMDE
H2QQV7_PANTR          -----------MSSLEISSSCFNLETKLPLSPPLVEDSAFEPS-----------RKDMDE
MOC2B_HUMAN           -----------MSSLEISSSCFSLETKLPLSPPLVEDSAFEPS-----------RKDMDE
G1RJJ3_NOMLE          -----------MSSLEISSSCFNLETKLPLSPPLAEDSAFEPS-----------RKDTDE
F7IBH5_CALJA          -----------MSSLEISSSCFNQETKLLLSPPLAEGSAFEPS-----------RGDMDE
G1T185_RABIT          -----------MSSLEISSSSFSPETKLLLSPPLVEASAFKPC-----------RKDMDD
H0X442_OTOGA          -----------MSSLETSSSCFNQETRSPLSPPSVEDSAFEPS-----------RKDVDE
E2RI62_CANLF          -----------MSSLEISSSTFSQEMKLPSSPPLVEGSALEPF-----------RKDLNE
M3WV85_FELCA          -----------MSSLEINSSSFSQEMKLPLSPPLVEGSTLEPLGCV--------RKDMNE
G1LMH7_AILME          -----------MSSLEISSSSFSREMKLPLSPPLVEGSAQQPL-----------GEDLNE
MOC2B_BOVIN           -----------MSSLEISSSCFNQETKLPLSLPLVEGSTFEPP-----------GKDMNE
F1SMF3_PIG            -----------MSSLEISSSCCNQEMKLPLSPPLVEGSAFVPP-----------GKDMNE
G5E7D1_LOXAF          -----------MSSLEINSSSSNPEMKLPLSPPLVEDSAFELP-----------GKNTNE
MOC2B_MOUSE           -----------MSSLEISNSCFSPETRSPSSRQSVEDNASEPSG-----------KDVDD
MOC2B_RAT             -----------MSSLEINNSCFSLETKLPSSHQSVEDSASEPSGYEAKDPPQDTLKDVDD
L7N1E2_MYOLU          -----------MSSLEISSFCFDQETKSPSSPPSVEASAGGPLE-----------EDVGE
F6RWP4_MONDO          -----------MSSLEINSCSYNQATRLQLFPPLVEDNISGLL-----------GESMSS
G3VIP0_SARHA          -----------MSSLEISSSSCSQVTRLQLFPPLAEDNISGLL-----------GESMSA
MOC2B_TAEGU           ---------------------------------------------------------MEE
M3XJ03_LATCH          ---------------------------------------------------------MDE
E7FEQ3_DANRE          -----------------------------------------------------------M
I3K3S6_ORENI          ----------------------------------------------------------MS
Q4TB40_TETNG          ----------------------------------------------------------MS
F6ZA98_CIOIN          ------------------------------------------------------------
H2Z5M7_CIOSA          ------------------------------------------------------------
MO2B1_AEDAE           ------------------------------------------------------------
MO2B2_AEDAE           ------------------------------------------------------------
MOC2B_ANOGA           ------------------------------------------------------------
MOC2B_DROME           ------------------------------------------------------------
MOC2B_DROPS           ------------------------------------------------------------
E0VV36_PEDHC          ------------------------------------------------------------
A0A088AB86_APIME      ------------------------------------------------------------
A0A158NAQ4_ATTCE      ------------------------------------------------------------
E9GWU7_DAPPU          ------------------------------------------------------------
B7Q3T4_IXOSC          ------------------------------------------------------------
F6HAF9_VITVI          -------------------------------------------------------MADEE
F6HAG2_VITVI          -------------------------------------------------------MADEE
B9GFS6_POPTR          -------------------------------------------------------MATEE
K4C981_SOLLC          -----MLNLLQQLRDHFCQFSLPKIVFTSTLQSSERSNLQSCGSATSQPLHCVIQMADED
M1A5J7_SOLTU          -------------------------------------------------------MADED
MOC2B_ARATH           -------------------------------------------------------MSAEE
I1NX57_ORYGL          -------------------------------------------------------MASDE
MOC2B_ORYSJ           -------------------------------------------------------MASDE
I1IPN9_BRADI          -------------------------------------------------------MAGDE
C5XUJ7_SORBI          ----------------------------------------------MASVDLPPPPPSEE
A9S6R9_PHYPA          -------------------------------------------------------MVGDD
B3RRC7_TRIAD          -------------------------------------------------------MAQVT
MOC2B_DICDI           -------------------------------------------------------MSKES
D3BU88_POLPP          -------------------------------------------------------MSTVD
A9UST4_MONBE          -------------------------------------------------------MVDAQ
C0NQH4_AJECG          -----------------MQNPTPQP--EVDLNPVASASSSSNPLPAHLNPANYPQTRYFS
C5GCQ5_AJEDR          -----------------MSNSTTSQSQEHHLNPEASSEA----LPAHLNPANYPQTRHIP
MOC2B_COCIM           -----------------MSTLPSTDPPPLPASTSSQQPAVHIPPPSYLDPTTYPQTLYLD
MOC2B_EMENI           -----------------MSARPEPQ----PGSERNATEP----LPSHLDPTTYPRTLTTT
MOC2B_ASPFU           -----------------MATQP-------PQDQTSTTPS----LPPHLDPTTYPRILTSA
F9XQE9_ZYMTI          -----------------MAPPDPPKQ-----QFSGEQS------------------LTEP
D5GI04_TUBMM          -----------------MSEQANKVEGEKEKEWEGKQSP-------------HPEFLTKE
C7YMB7_NECH7          -----------------MTASENTQ---------------------------DAWELSDE
MOC2B_SCLS1           -----------------MASSK---------------------------------ELIEE
MOC2B_NEUCR           -----------------MATQQPTQTDNSAQAQPPQTNPA------------KPTEISEP
MOC2B_PHANO           -----------------MSTSETSSY--------TPDIPS------------EPVTKTTD
A8N1D2_COPC7          -----------------------MQGLLHSASTDARLEL--------------AEGI---
A0A0D1E8A8_USTMA      -----------------MTGTLSQEGGLSPASAEASPST--------------SGSIRNQ
                                                                                  

A8XXG7_CAEBR          NKSESIQDFRRQILNNHIKLMDLKIEVGLV-DQLVNHPSCGAISTFNGVTR-DNHAGKEV
P91500_CAEEL          DKNKSIVNFRQQILDDHIKLTDEVIDVKVV-DQLVSHPSCGAISTFNGVTR-DNHGGRDV
A0A2H2ILJ2_CAEJA      DRNESIIDYRTQILNDHIKITDTRLDLETI-MKLAADSSCGAISTFCGVTR-DNHDGRGV
A7RSI0_NEMVE          ------------MADDVTVITPDVLHVEQV-MALAQSPSAGAVSLFVGTTR-DNFEGKNV
D0NGD0_PHYIT          ---------PEAGVGDFVEVGFEPLDNQRA-VALVTHPSAGAISTFVGTTR-DNFQGKKV
G3QG23_GORGO          ---------VEEKSKDVINFTAEKLSVDEV-SQLVISPLCGAISLFVGTTR-NNFEGKKV
H2QQV7_PANTR          ---------VEEKSKDVINFTAEKLSVDEV-SQLVISPLCGAISLFVGTTR-NNFEGKKV
MOC2B_HUMAN           ---------VEEKSKDVINFTAEKLSVDEV-SQLVISPLCGAISLFVGTTR-NNFEGKKV
G1RJJ3_NOMLE          ---------VEEKSKDVINFTAEKLSVDEV-SQLVMSPLCGAISLFVGTTR-NNFEGKKV
F7IBH5_CALJA          ---------VEEKSKDIINFTAEKLSVDEI-SKLVISPLCGAISLFVGTTR-NNFEGKKV
G1T185_RABIT          ---------VEEKPKDIIKFTAEKLSVDEV-SQLVISPPCGAVSLFVGTTR-NNFEGKKV
H0X442_OTOGA          ---------VKEKSKDIIKFTEEKLSVDEV-SQLVVSPLCGAVSLFVGTTR-NNFEGKKV
E2RI62_CANLF          ---------IEEKPKDIIKFTAEKLSVDEV-SQLVISPLCGAVSLFVGTTR-NNFEGKKV
M3WV85_FELCA          ---------IEEKSKDIIKFTAEKLSIDEV-SQLVVSPLCGAVSLFVGTTR-NNFEGKKV
G1LMH7_AILME          ---------VEEKSKDIIKFTTEKLSIDEV-SQLVISPLCGALSLFVGTTR-NNFEGKKV
MOC2B_BOVIN           ---------VEEKSKDIIKFTSEKLSVDEV-SQLVISPLCGAISLFVGTTR-NNFEGKKV
F1SMF3_PIG            ---------VEEKSKDIIKFTSEKLSIDEA-SQLVISPVCGAVSLFVGTTR-NNFEGKKV
G5E7D1_LOXAF          ---------IEETAKDIIKFTAEKLSIDEI-SQLVTSPLCGAISLFVGTTR-NNFEGKKV
MOC2B_MOUSE           ---------VQEKPKDIIQFTAEKLSVGEV-SQLVVSPLCGAVSLFVGTTR-NNFEGKKV
MOC2B_RAT             ---------VLEKPKDIIQFTAKKLSVGEV-SQLVVSPLCGAVSLFVGTTR-NNFEGKKV
L7N1E2_MYOLU          ---------DEEKPKDIIRFTAEKLSVEEV-SQLVTSPLCGAVSLFVGTTR-NHFEGKKV
F6RWP4_MONDO          ---------TEDKPKDIIKFTPEKLSVDEV-SQLVISPVCGAVSLFVGTTR-NNFEGKKV
G3VIP0_SARHA          ---------IEEKPKDIIKFTLEKLSVDEV-SQLVVSPVCGAVSLFVGTTR-NNFEGKKV
MOC2B_TAEGU           ---------REDAPKDFIKLKSEKLSVGEV-SELVVSPYCGAVSLFIGTTR-NNFEGKKV
M3XJ03_LATCH          ---------CEDDPKEFVKLTYEKLSVDYI-SELVTSPSCGAVSLFIGTTR-NNFEGKKV
E7FEQ3_DANRE          ---------AADGGRDLITLTTDKLFADRV-SESVTCPSCGAVSLFIGTTR-DNFEGKKV
I3K3S6_ORENI          ---------KGP--RDVFKLSHDWLSVQEV-VDAVSSPSCGAISVFIGTTREDEADSRKV
Q4TB40_TETNG          ---------HSEDGRDVFKLTPDWLSVQEV-VDAVGSSSCGAVSVFIGTTREDELGGRKV
F6ZA98_CIOIN          --------------MNDIVFTNDALNVQAA-VDKVSSETCGAVSIFLGTTR-NHFNGKKV
H2Z5M7_CIOSA          --------------MNDIILTHDHLDVQST-VDKVSSDDCGAVSVFLGTTR-NHFKGKKV
MO2B1_AEDAE           --------------MNYLKLTFDKLEVGEI-NDLVAHESCGAISLFVGTTR-DNFDGKTV
MO2B2_AEDAE           --------------MNYLKLTFDKLEVGEI-NDLVAHESCGAISLFVGTTR-DNFDGKTV
MOC2B_ANOGA           --------------MNYLKLTFDKLDVGAL-NDQVAHESCGAVSLFVGTTR-DNFEGKTV
MOC2B_DROME           --------------MDHVKLVNDPIDIAHI-HQLLADEGCGASSVFVGTTR-DNFQGKKV
MOC2B_DROPS           --------------MNHIKLIDCPIDVTYA-INLISDPSCGASSIFIGTTR-DSFQGKKV
E0VV36_PEDHC          --------------MDFVRLSKDKLCVESI-YNMVCSAEFGAVSLFVGTTR-DNFEGKTV
A0A088AB86_APIME      ---------<MGTTKDIVKLQQEELNIGYI-IDLVTASNCGAVSNFIGITR-DNFDNKRV
A0A158NAQ4_ATTCE      ----------MEILKNFVKLQQEELNIAEI-MELVTFPNCGAISNFIGITR-DNFENKKV
E9GWU7_DAPPU          --------------MDIINLVEEQLDVNSI-YSKVVEHSTGAVSLFVGTTR-NNFEGKKV
B7Q3T4_IXOSC          --------------MDYTELCTSKIDTEKL-ISQVGAPDCGAISVFIGTTR-NHFEGKRV
F6HAF9_VITVI          -----------RNLVEILEEHN-VIDIAKY-INYVSAPQAGAVATFSGTTR-DTFDGKTV
F6HAG2_VITVI          -----------RNLVEILEEHN-VIDIAKY-INYVSAPQAGAVATFSGTTR-DTFDGNTV
B9GFS6_POPTR          -----------KTLVEILEENN-LIDLAKY-VNYVSASQAGAIATFSGTTR-DTFEGKTV
K4C981_SOLLC          -----------RNLIEILEANS-PIDFNKY-IGYVSSPKCGAIATFAGTTR-DTFDGKEV
M1A5J7_SOLTU          -----------RNLIEIL-ANS-PIDFNKY-IGYVSSPKCGAIATFAGTTR-DTFDGKEV
MOC2B_ARATH           -----------KNLIEILEEGH-KVDVVKY-IDYVSAPQAGAIATFSGTTR-DMFEGKTV
I1NX57_ORYGL          LPVAAAAAEE-EDLVEILDEGSGRLDIARY-VGHVRDLAAGAIATFEGTTR-DSFEGRRV
MOC2B_ORYSJ           LPVAAAATEE-EDLVEILDEGSGRLDIARY-VDHVRDLAAGAIATFEGTTR-DSFEGRRV
I1IPN9_BRADI          -PQAAAAS---EDLVEILDEESGRLDIARY-VDHVRDLSAGAIATFEGTTR-DHFAGRRV
C5XUJ7_SORBI          TPAAVAAAEEDEDLIEIVEEGSGRLDIARY-VDHVRDLSAGAIATFEGTTR-DHFAGRRV
A9S6R9_PHYPA          -----------GDVVEIVEE---VIDLKKY-VDVVRDDGAGAIATFLGTTR-DMFEDKRV
B3RRC7_TRIAD          ------------NDADIIEICHEPLDIAKL-SSLVSTPSAGAISTFTGITR-DNFEGKKV
MOC2B_DICDI           --RIF------------IEISENIIDLNYW-YKIVSDDSSGATSSFLGTTR-NEFKGKSV
D3BU88_POLPP          --IIFDKNKDGIDRGLYIEVSEEPIDFKVGGYNRVEDDNAGAISTFLGTTR-NNFKGKNV
A9UST4_MONBE          -------PSGQDNARIHVALRYEALDTLAL-HKLVTVPEAGAISTFVGITR-NTFQGKMV
C0NQH4_AJECG          ------------DSNIHLELTYNPLDPTKS-LAQIRSPHAGANVLFLGTTRSTFD-NRPV
C5GCQ5_AJEDR          ------------DANIHLELTYSPLNPTRS-IIHVRSPHAGANILFLGTTRSTFD-NHPI
MOC2B_COCIM           ------------PERIFIELTYHPLSPSTY-LAHTRSPAAGANVLFLGTTRDTFE-DKPV
MOC2B_EMENI           H--------GPTSIPLHLELTYHTLSPTTA-LQHVSSPSSGANILFLGTTRDTFD-DRPV
MOC2B_ASPFU           ------------THNIHLELTYSTLNPTVA-LEHTSSPAAGANVLFLGTTRDTFE-GRAV
F9XQE9_ZYMTI          --------------NIYVSLTYDPLDATAQ-MARVKSPQAGAVVLFAGTTRSHFSPSRPI
D5GI04_TUBMM          --------------NIHVELTSAPLSITQV-MDRVRSPKAGALVLFAGTTRDNFD-NKPV
C7YMB7_NECH7          --------------GCHVALTHDHLNAQAI-MDRVRSPSAGAIVLFAGTTRDNFA-GKPV
MOC2B_SCLS1           --------------NCYVALTHEHLDAKVM-MDKVRSPKAGAIVLFAGTTRDNFG-GKPV
MOC2B_NEUCR           --------------GIYVALTHDHLNYQSV-IDRVRSPEAGAIVVFAGTTRNNFN-SLPV
MOC2B_PHANO           --------------TIHIELTPNDLDSLAA-TRFVRSPSAGATVLFIGTTRDSFN-DKAV
A8N1D2_COPC7          -----------------CVLTYSKLIVEDI-TNIVRDDGAGAIAVFIGTTRNSFK-GKVV
A0A0D1E8A8_USTMA      -------------YGDEAVLTYSVLDEKQA-MKFVADDGAGATVLFSGTTRDSFR-GKKV
                                              :               **   * * **     .  :

A8XXG7_CAEBR          VHLSYDCHDLMAYKKLRGICEEVRKELP----------------------DIKKIAIFHR
P91500_CAEEL          SNLSYDCHDLMAYKKLRGICAEIRAEYP----------------------DVKKIAIFHR
A0A2H2ILJ2_CAEJA      ASLSYDAHDLMAYKKLRKICARIREQHP----------------------DIRKIVIFHR
A7RSI0_NEMVE          VRLEYEAYIPMASSEMRKICKLAREKW-----------------------NIMKIAIYHR
D0NGD0_PHYIT          VRLEYEGYTPMAVSELRKICVIIREKWP----------------------DVVGVALFHR
G3QG23_GORGO          ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------VKHIAVFHR
H2QQV7_PANTR          ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------VKHIAVFHR
MOC2B_HUMAN           ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------VKHIAVFHR
G1RJJ3_NOMLE          ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------VKHIAVFHR
F7IBH5_CALJA          ISLEYEAYLPMAENEVRKICGDIRQKWP-----------------------VKHIAVFHR
G1T185_RABIT          ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------VTHIAVFHR
H0X442_OTOGA          ISLEYEAYLPMAENEVRKIFSEIRQKWP-----------------------IKHIAVFHR
E2RI62_CANLF          ISLEYEAYLPMAENEIRKICSDIRQKWP-----------------------VKHIAVFHR
M3WV85_FELCA          ISLEYEAYLPMAENEIRKICSDIRQKWP-----------------------VKHIAVFHR
G1LMH7_AILME          ISLEYEAYLPMAENEIRKICSDIRQKWP-----------------------VKHIAVFHR
MOC2B_BOVIN           ISLEYEAYLPMAENEIRKICSDMRQKWP-----------------------VRHIAVFHR
F1SMF3_PIG            ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------VRHIAVFHR
G5E7D1_LOXAF          ISLEYEAYLPMAENEVRKICSDIRQKWP-----------------------IRHIAVFHR
MOC2B_MOUSE           ISLEYEAYVPMAENEIRKICNDIRQKWP-----------------------VRHIAVFHR
MOC2B_RAT             ISLEYEAYLPMAENEIRKICNDIRQKWP-----------------------VRHIAVFHR
L7N1E2_MYOLU          ISLEYEAYIPMAENEVRRICGDVRRKWP-----------------------VRHIAVFHR
F6RWP4_MONDO          VSLEYEAYVPMAEAEVRKICNAVRQQWP-----------------------VKHIAICHR
G3VIP0_SARHA          VSLEYEAYMPMAEAEVRKICSAVRQQWP-----------------------VRHIAVYHR
MOC2B_TAEGU           IHLEYEAYTSMAETEMKKICRDVRQKWP----------------------SVKHIAVHHR
M3XJ03_LATCH          VWLEYEAYAPMAETEIKKICRAVRQKWL----------------------TVKHIAVHHR
E7FEQ3_DANRE          VRLEYEAYAPMAESKLKKICSHIRTKWP----------------------SVRHINIQHR
I3K3S6_ORENI          VGLEYEAYEPMAQSEFNKLCADIRARWQ----------------------SVTHICVHHR
Q4TB40_TETNG          TGLEYEAYEPMARSEFSKLCADIRQRWP----------------------AVANICVHHR
F6ZA98_CIOIN          LRLDYECYGQMAHKELEKICERLREKWP----------------------DILHILIHHR
H2Z5M7_CIOSA          VQLDYECYENMAKKEMLKICEIMREKWP----------------------DIMHIAVHHR
MO2B1_AEDAE           VLLEYEAYEAMALKTMNQICEELRARWP----------------------DIKHIGIHHR
MO2B2_AEDAE           VLLEYEAYEAMALKTMNQICEELRARWP----------------------DIKHIGIHHR
MOC2B_ANOGA           VLLEYEAYEAMAIKTMNLLCEEVRARWP----------------------DVVNIGIHHR
MOC2B_DROME           LSLAYEAYDSMALKEMNKICSDLRSKWL----------------------DLKHIVIYHR
MOC2B_DROPS           VSLAYEAYENMALKEMDKICSDLRATWP----------------------DLKHILIYHR
E0VV36_PEDHC          TKLEYEAYEQMAVKSLQKICHDIRGKF-----------------------DVGNIAIFHR
A0A088AB86_APIME      LKLEYEAYEPMALKEMNNICSKIRSQW-----------------------NVHHIAIYHR
A0A158NAQ4_ATTCE      IKLEYEAYESMALKEMTNICNKIRSQW-----------------------DVEGIAIYHR
E9GWU7_DAPPU          ISLEYEAFKPMACKEIKKICENIREKWK-----------------------VKHIAFHHR
B7Q3T4_IXOSC          LKLSYEAYGPMAERELVRMCADVRTKWN-----------------------VKNVAVVHR
F6HAF9_VITVI          VELRYEAYVPMAIRCINDICSSARASWS-----------------------LISIAVAHR
F6HAG2_VITVI          VELRYEAYVPMAIRCINDICSSARASWS-----------------------LISIAVAHR
B9GFS6_POPTR          VELRYEAYVPMAIRQMKSICSSARSSWD-----------------------IHSIAVVHR
K4C981_SOLLC          LELQYEAYVPMAVRCLKSLCSSARSSWD-----------------------IHSIAVAHC
M1A5J7_SOLTU          LELQYEAYVPMAIRCLKSLCSSARSSWD-----------------------IHSIAVAHC
MOC2B_ARATH           LELRYEAYVPMATRCLSSICTTARSTWD-----------------------IHKIAVAHR
I1NX57_ORYGL          VELRYEAYGAMARRRLAAILREARAAHS-----------------------LRRLAVAHR
MOC2B_ORYSJ           VELRYEAYGAMARRRLAAILREARAAHS-----------------------LRRLAVAHR
I1IPN9_BRADI          VELRYEAYASMARRRLEAILAEARDAHA-----------------------LSRLAVAHR
C5XUJ7_SORBI          VELRYEAYAAMARRRLGAILREARSLHA-----------------------LRRLAVAHR
A9S6R9_PHYPA          LELRYEAYHAMALEHLRRICKVARSRWA-----------------------LTRIAIVHR
B3RRC7_TRIAD          LRLEYDAYIPMAMSELKTICATIRNKWA-----------------------VKKIAIFHR
MOC2B_DICDI           ERLEYETYEPMAIKEIEKICKTILNGFEN---------------------DIKKIGIVHR
D3BU88_POLPP          EKLEYEAYTPMAVKEIAKICSHLFTTY-----------------------NILHIAVLHR
A9UST4_MONBE          ARLEYEAYETMAVKKMRAIAATCLERWD-----------------------LERCAIEHR
C0NQH4_AJECG          ARLTYTSYAPLALRTLEKIARGAVTKY-----------------------QLCGISISHR
C5GCQ5_AJEDR          ARLTYISYTPLALRTLEKIARNAVAKY-----------------------KLQGISISHR
MOC2B_COCIM           ARLAYTSYAPLALRTLSSIARDAVAKH-----------------------GLCGVSIAHR
MOC2B_EMENI           ARLSYTSYPALALKSLHKISSEAVEKF-----------------------GLNGVYIAHR
MOC2B_ASPFU           SQLSYTSYPPLALKSLMSIATRAVEKF-----------------------DLKGVYIAHR
F9XQE9_ZYMTI          THLSYTTYPSLALRTLLRLSTSILTSH-----------------------SLTSIAITHR
D5GI04_TUBMM          AHLAYTAYTPRALATMMSICEEVLRER-----------------------GLMAICIVHR
C7YMB7_NECH7          KELQYTAYRPRALRSMLTIAKDVRDRH-----------------------GLRGVAMIHR
MOC2B_SCLS1           KELQYTSYEPRALQSMLSICKTILHKH-----------------------SLTSIAMIHR
MOC2B_NEUCR           QHLSYTSYAPLALRTMLTICRSILTKH-----------------------GLKGIAMVHR
MOC2B_PHANO           SSLSYTSYAPLAISTLYKIASNILTKH-----------------------ACTKIAIIHK
A8N1D2_COPC7          TKLEYQAYSKLAIKTLAQILQDVQQLSQRSEHQPPSSDK--------PVTALIKCAVYHR
A0A0D1E8A8_USTMA      TKLEYEAYSSLALKTLQSLLDNAHTSAPFAETPTPISANVDPQADHSSEDRVTRCYISHR
                        * *  .   *   .  :                                     . * 

A8XXG7_CAEBR          LGKVDVGESSVVISTSSPHRKTSIQATGRLIDLLKDKAPIFKYEEYSN-GETEGVWKSNV
P91500_CAEEL          LGKVDIGESSVIISTSSPHRKTAIQATEKCIDLLKEHAPIFKYEEYSN-GEVDGVWKSNI
A0A2H2ILJ2_CAEJA      VGEVKVGESSVIICTSSPHRKSAIHATEMCIDLLKEEVPIFKYEEYTD-GEEKGKWKSNE
A7RSI0_NEMVE          IGIVPIGEASVIIAVSSAHRKESLEAVSFIIDTLKATVPIWKKEIYE---QGEAQWKENK
D0NGD0_PHYIT          LGVVEVAEASVIVVVSSPHRREALEACAFAIDTLKATVPIWKCEQYE---GDTRMWKENV
G3QG23_GORGO          LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYE---ESS-TWKGNK
H2QQV7_PANTR          LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYE---ESS-TWKGNK
MOC2B_HUMAN           LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYE---ESS-TWKGNK
G1RJJ3_NOMLE          LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYE---ESS-SWKGNK
F7IBH5_CALJA          LGLVPVSEASIIIAISSAHRAASLEAVSYAIDTLKAKVPIWKKEIYE---ESS-SWKRNK
G1T185_RABIT          LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDNLKARVPIWKKEMYE---ESSSTWKRNK
H0X442_OTOGA          LGLVPVSEASIIIAVSSAHRAASLAAVNYAIDHLKAKVPIWKKEMYE---ESSSSWKRNK
E2RI62_CANLF          LGLVPVSEASVIIAVSSVHRASSLQAVSYAIDTLKAKVPIWKKEMYE---ESSSSWKRNK
M3WV85_FELCA          LGLVPVSEASVIIAVSSAHRTSSLEAVSYAIDTLKAKVPIWKKEMYE---ESSSSWKRNK
G1LMH7_AILME          LGLVPVSEASIIIAVSSAHRASSLQAVSYAIDTLKAKVPIWKKEMYE---ESSSSWKRNK
MOC2B_BOVIN           LGLVPVTEASVIIAVSSAHRAASLEAVSYAIDALKARVPIWKKEIYE---ESSSSWKRNK
F1SMF3_PIG            LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDNLKAKVPIWKKEMYE---ESPSSWKRNK
G5E7D1_LOXAF          LGLVPVSEASIIIAVSSAHRAASLEAVSYAIDNLKAQVPIWKKEMYE---ESSSSWKRNK
MOC2B_MOUSE           LGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEIYE---ESTSSWKRNK
MOC2B_RAT             LGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEIYE---ESTSSWKRNK
L7N1E2_MYOLU          LGLVPVSEASVVIAVSSAHRAASLGAVSYAIDALKAKVPVWKKEIYE---ESSSSWKRNK
F6RWP4_MONDO          LGLVPVTEASVVIAVSSAHRAASLEAVKYIIDTLKAKVPIWKKELYE---EETSSWKRNK
G3VIP0_SARHA          LGLVPVTEASVVIALSSAHRAASLEAVKYVIDTLKAKVPIWKKEIYE---EETSSWKRNK
MOC2B_TAEGU           LGVVPITEASVIIAVSSPHRAESLEAVMYCINTLKASVPIWKKEIYE----DEYSWKENK
M3XJ03_LATCH          LGLVPVTEASVVIAISSPHRNEALESLKYCLDTLKAKVPIWKKEIYE---KEEYSWKENK
E7FEQ3_DANRE          LGLVSVTEASVIIGISSPHRSDSLEALKYCIDTLKATVPIWKKEIYE---SGEPCWKENK
I3K3S6_ORENI          LGWVKVGDASVVMAISSPHRHDGQQAIQHCISQLKANVPIWKKEVYD---TQEANWKENA
Q4TB40_TETNG          LGWVEVGQASVVMAISSPHRHDGQQAVQHCISQLKAKIPIWKKEVYD---TQDSSWKENP
F6ZA98_CIOIN          LGSVPVKESSVLIAISSPHRVDAMAATQYCIDNLKAKVPIWKKEVYD---DGTNEWMENN
H2Z5M7_CIOSA          LGTVPIREGSILIAVSSPFRLSAMHATQYCIDSIKATVPIWKKEVYA---DGTISWKENS
MO2B1_AEDAE           LGTVPVKEASVVIAVSSPHRKSSLEAVHFAIDELKKSVPVWKKEQYAD-GEGCSEWKENK
MO2B2_AEDAE           LGTVPVKEASVVIAVSSPHRKSSLEAVHFAIDELKKSVPVWKKEQYAE-GEGCSEWKENK
MOC2B_ANOGA           LGTVPVKEASVVIAISSPHRKSSLEAVHFTIDELKKSVPVWKKELYD--GEGSSEWKENS
MOC2B_DROME           LGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYD--GDNDSEWKENK
MOC2B_DROPS           LGTVPENEASVVIAASAPHRSAALKAVTFAIDQLKSRVPIWKKEIYE--GNHDAEWKENS
E0VV36_PEDHC          LGDVPIKEASVIIAISAVHRASALKAVPYAIDSLKADVPIWKKEIYE--DGYQSEWKENS
A0A088AB86_APIME      LGEVPVSKASVVIAISSPHREESLKAVEYAINALKSSVPIWKKEIYD---TQEMQWKENK
A0A158NAQ4_ATTCE      IGEVPISKASVVIAVSSPHREQSLRAVEYAINALKASVPIWKKEVYE---TGEPQWKQNK
E9GWU7_DAPPU          LGEVPVGEASVVIAVSSEHRAESLEAVQFGIDALKKSVPIWKKELYS---DGAPEWKANK
B7Q3T4_IXOSC          LGEVPVGEASIVIVVSSAHREESQAAVKWIIDQVKSRLPVWKKEIYD---DGLSEWKENK
F6HAF9_VITVI          LGPVPVGETSIFIAISSVHRADALDACKFVIDEIKASVPIWKKEVYA----NGEVWKENS
F6HAG2_VITVI          LGPVPVGETSIFIAISSVHRADALDACKFVIDEIKASVPIWKKEVYA----NGEVWKENS
B9GFS6_POPTR          LGTVPVGEMSVFIAVSAVHRADALDACKFLIDELKASVPIWKKEVYS----NGEVWKENS
K4C981_SOLLC          LGTVPVGETSVFVAISSVHRADALDACKFLIDELKASVPIWKKEVYT----NGEVWKENK
M1A5J7_SOLTU          LGTVPVGETSVFVAISSVHRADALDACKFLIDELKASVPIWKKEVYT----NGEVWKENK
MOC2B_ARATH           LGPVPVGETSVLIAVSSVHRADGLDACKFLIDELKASVPIWKKEVYT----NGEIWKENS
I1NX57_ORYGL          LGTVPAGEASVFVAASAVHRADAMEACRYVIDEVKASVPIWKKEVYD----DGEVWKENR
MOC2B_ORYSJ           LGTVPAGEASVFVAASAVHRADAMEACRYVIDEVKASVPIWKKEVYD----DGEVWKENR
I1IPN9_BRADI          LGTVPAGEASVFVAASAVHRADAMEACRYVIDEIKASVPIWKKEVYD----DGEVWKENR
C5XUJ7_SORBI          LGAVPAGEASVFVAASATHRADAMEACRYVIDELKASVPIWKKEVYD----DGEVWKENR
A9S6R9_PHYPA          IGVVGVGEESVLVAVSSVHRKESLHACEFLIDELKASVPIWKKEVYE----TGDAWKQNS
B3RRC7_TRIAD          IGLVPVEEASVIIAISSAHRADSLAAVQFCIDTLKAKVPIWKKEIYE----DGSTWKENR
MOC2B_DICDI           IGNVPVGESSILIVISSGHRKSSLEAVHYAIDTIKSTVPIWKKEFYTD--GSENQWKGNC
D3BU88_POLPP          IGTVPIGEASILIAISSAHRHDSLTAVQYAIDTIKATVPIWKKEYYTD--GTMSVWKDNC
A9UST4_MONBE          LGSVPVSEASVAIYISSAHRRAGLDAVAFAIDELKATVPVFKREVYV---DGQAEWKRNC
C0NQH4_AJECG          LGEVRVAEESIAIAVAAGHRRPAWRAGEEVLEECKAAVEIWKREEFVGAGEEEGEWRANR
C5GCQ5_AJEDR          LGEVGVAEESIAIAVSAGHRAPAWRAGEEVLEQCKAAVEIWKREEFVGAAEGEGEWRMNQ
MOC2B_COCIM           LGDVAVGEESIAIAISAPHRGAAWRAGEEVLEECKRRVEIWKREEFVGEPPGQGEWRANR
MOC2B_EMENI           LGEVPVGEASIVVAVGAGHRGEAWRGAEWVLEVVKERVEVWKREEFV---DGGMEWRENR
MOC2B_ASPFU           LGVVPISEASIVVAVSAGHRGMAWKAAEEVLEEVKEKVEIWKREEFV---DGGMEWRENR
F9XQE9_ZYMTI          LGRVDIGEESILIAVSAPHRREAWRGGEEALERVKGEVEVWKEEWF---EDG-GVWRANR
D5GI04_TUBMM          IGEVPIGEESVLIAVAGKHRGETWRGGEEALEKVKERVEVWKMERF---VGGDGVWRSNR
C7YMB7_NECH7          LGTVPIGEESILIAVSAPHRQAAWRAGEEALEQCKEKVEVWKREEFE--GEEG-VWRANR
MOC2B_SCLS1           LGVVPIGEESILITVSSPHRQAAWRAGEEALEECKEKVEVWKKEEFG--GEEGGIWRANR
MOC2B_NEUCR           LGVVPIGEESILIAVSSPHRQAAWRAGEEALEECKAKVEVWKREEFG--GEGGGVWRANR
MOC2B_PHANO           LGECPIGEESIVIAVSAPHRKAAWLAGEEALEETKDKAEIWKLERFE--GGE-GVWRANR
A8N1D2_COPC7          LGTVPVGEPSIVIAVSSPHRKEAFRACEYILEEVKQKAQIWKREFYEGEDESTAV-----
A0A0D1E8A8_USTMA      LGVVGVGECSILIAVSSPHRKEAFVVAEWLLEEVKKNVAVWKREFYTTGDDLTALDGDAR
                      :*     . *  :  .. .*          :.  *    ::* * :              

A8XXG7_CAEBR          EDCKN-------------------------------------------------------
P91500_CAEEL          EDSKQ-------------------------------------------------------
A0A2H2ILJ2_CAEJA      EDKKEKNVAEQLNL----------------------------------------------
A7RSI0_NEMVE          ECSWRS------------VKMSTV------------------------------------
D0NGD0_PHYIT          EWKDGA------------AARSSCCGNKRVMVPMEHK-----------------------
G3QG23_GORGO          ECFWAS------------NS----------------------------------------
H2QQV7_PANTR          ECFWAS------------NS----------------------------------------
MOC2B_HUMAN           ECFWAS------------NS----------------------------------------
G1RJJ3_NOMLE          ECFWAS------------SN----------------------------------------
F7IBH5_CALJA          ECFWAS------------NN----------------------------------------
G1T185_RABIT          ECFWAN------------ND----------------------------------------
H0X442_OTOGA          ECFWAP------------ND----------------------------------------
E2RI62_CANLF          ECFW--------------------------------------------------------
M3WV85_FELCA          ECFWTA------------SD----------------------------------------
G1LMH7_AILME          ECFWAT------------GD----------------------------------------
MOC2B_BOVIN           ECFWAT------------SD----------------------------------------
F1SMF3_PIG            ECFWAT------------SDSTT-------------------------------------
G5E7D1_LOXAF          ECFWGT------------N-----------------------------------------
MOC2B_MOUSE           ECFWAA------------GD----------------------------------------
MOC2B_RAT             ECFWAA------------DD----------------------------------------
L7N1E2_MYOLU          ECFWAT------------SD----------------------------------------
F6RWP4_MONDO          ECFWTK------------ND----------------------------------------
G3VIP0_SARHA          ECFWTK------------N-----------------------------------------
MOC2B_TAEGU           ECFWAN------------SEK---------------------------------------
M3XJ03_LATCH          ECPWAT------------HN----------------------------------------
E7FEQ3_DANRE          ECLWAD------------GGKHPKES----------------------------------
I3K3S6_ORENI          ECSWST------------QKKPPENTLSEGKPE---------------------------
Q4TB40_TETNG          ECSWAA------------HSKGSQ-EASDNV-----------------------------
F6ZA98_CIOIN          ECSWKS------------TS----------------------------------------
H2Z5M7_CIOSA          ECTWKS------------NP----------------------------------------
MO2B1_AEDAE           ECSWSK-----------SHRDNHIL-----------------------------------
MO2B2_AEDAE           ECSWSK-----------SHRDNHIL-----------------------------------
MOC2B_ANOGA           ECTWSK-----------KYKDNHIL-----------------------------------
MOC2B_DROME           ESIRPK-----------KSKSGFNYAACPCKVEESH------------DVPRTLVQIRVN
MOC2B_DROPS           ESIRPK-----------KSLSSFNYSVC--KVDESR------------VVSRNLVQIRAN
E0VV36_PEDHC          ECMWST-----------KNK----------------------------------------
A0A088AB86_APIME      ECAWSNIHNAI---DFEESENIAITNEVIETTVEYDSEEEEEKEESKIIIDPNLVQIRAS
A0A158NAQ4_ATTCE      EY-----------------EEAQMASDINEKIPNKD------------VVDQNLVQIRAN
E9GWU7_DAPPU          ECLWTILSSSQRFPIFALSLYNNIYCVILKMNQEEDASLSKKRKIMVDYAAADCVQIKAS
B7Q3T4_IXOSC          ECFWNAT-----------------------------------------------------
F6HAF9_VITVI          EFLERRSELGNAGLQEGRTCCSRKVKVETQERKSCCGAKVKVEGELKFLERRSELGNAGL
F6HAG2_VITVI          EFLERRSELGNAGLQQGGTCCSRKVKVEAKERKSCCGAKVKVEGELKFLERRSELGNAGL
B9GFS6_POPTR          EFMDRKLELG----KTNGSCCRRNVKVETHGTKSCCGAKVKVADGAAAEISTSDAGTEET
K4C981_SOLLC          EFIERMPELGNASHDQDGACSGKK-KVEAHERKSCCGTKVKVNDESADSSR---------
M1A5J7_SOLTU          EFIERMPDLGKASHDQGGACSGKK-KVEAHERKSCCGTKVKVNDESADSCRF--------
MOC2B_ARATH           EFMEKRLELA-----EKRDSIVKKTVVEEHRRRGCCGSKVRVEEDEEHKDITGDNKSSS-
I1NX57_ORYGL          EFLDRTTTDG------ATASSPAPATRPAKGGG-CCGSKVRVNES---------------
MOC2B_ORYSJ           EFLDRTTTDG------TTASSPAPATRPAKGGG-CCGRKVRVNES---------------
I1IPN9_BRADI          EFLDRTDAAA------GATAPAAKGKGAGGGGGGCCGSKVRVEN----------------
C5XUJ7_SORBI          EFLDRHAGDA------HGNGSAAAAQ--TKAGG-CCGSKVRVQEA---------------
A9S6R9_PHYPA          EFLSRNSLVT------TPAA----------VGG--ASDVARV------------------
B3RRC7_TRIAD          E---------------------------------CSWSQSK-------------------
MOC2B_DICDI           ESCHF-------------NNNNHPH-----------------------------------
D3BU88_POLPP          ESCHYTTTKS------TLNNDGHDHQHSGHNKH---------------------------
A9UST4_MONBE          SGCARP------------HPTH--------------------------------------
C0NQH4_AJECG          DTDSQGN----YRGDKVAEG----------------------------------------
C5GCQ5_AJEDR          NMNAMSQSSEIYQLWFSSQ-----------------------------------------
MOC2B_COCIM           DTDPEGK---------STS-----------------------------------------
MOC2B_EMENI           ERDGFGK------LKTKKEDSR--------------------------------------
MOC2B_ASPFU           ERDAEGR------ILSSTEGGK--------------------------------------
F9XQE9_ZYMTI          DGGVGVEVRRGSGSGSGGTNGSGGSGKGSGGSGARKGSDARKKELPEVGIRKRGTGEFSE
D5GI04_TUBMM          DGKVGVRVDEGDDAGVEGD-----------------------------------------
C7YMB7_NECH7          DGVMGQREGKS-------------------------------------------------
MOC2B_SCLS1           DGAVGERVDEDEEKKKPDMGPHGPILRPSRPGERGHGPVVRNHQLGS-------------
MOC2B_NEUCR           DGAVGVKVDEPRIGK-------GEVDEKEDEGDSGNGGNDRKS-----------------
MOC2B_PHANO           DGKVGERVDGGIAGLLGRIEVFADTNV---------------------------------
A8N1D2_COPC7          --------------------WKENV-----------------------------------
A0A0D1E8A8_USTMA      TYDPRKNEAVVDAADSQSWSWKANFPST--------------------------------
                                                                                  

A8XXG7_CAEBR          ------------------------------------------------------------
P91500_CAEEL          ------------------------------------------------------------
A0A2H2ILJ2_CAEJA      ------------------------------------------------------------
A7RSI0_NEMVE          ------------------------------------------------------------
D0NGD0_PHYIT          ------------------------------------------------------------
G3QG23_GORGO          ------------------------------------------------------------
H2QQV7_PANTR          ------------------------------------------------------------
MOC2B_HUMAN           ------------------------------------------------------------
G1RJJ3_NOMLE          ------------------------------------------------------------
F7IBH5_CALJA          ------------------------------------------------------------
G1T185_RABIT          ------------------------------------------------------------
H0X442_OTOGA          ------------------------------------------------------------
E2RI62_CANLF          ------------------------------------------------------------
M3WV85_FELCA          ------------------------------------------------------------
G1LMH7_AILME          ------------------------------------------------------------
MOC2B_BOVIN           ------------------------------------------------------------
F1SMF3_PIG            ------------------------------------------------------------
G5E7D1_LOXAF          ------------------------------------------------------------
MOC2B_MOUSE           ------------------------------------------------------------
MOC2B_RAT             ------------------------------------------------------------
L7N1E2_MYOLU          ------------------------------------------------------------
F6RWP4_MONDO          ------------------------------------------------------------
G3VIP0_SARHA          ------------------------------------------------------------
MOC2B_TAEGU           ------------------------------------------------------------
M3XJ03_LATCH          ------------------------------------------------------------
E7FEQ3_DANRE          ------------------------------------------------------------
I3K3S6_ORENI          ------------------------------------------------------------
Q4TB40_TETNG          ------------------------------------------------------------
F6ZA98_CIOIN          ------------------------------------------------------------
H2Z5M7_CIOSA          ------------------------------------------------------------
MO2B1_AEDAE           ------------------------------------------------------------
MO2B2_AEDAE           ------------------------------------------------------------
MOC2B_ANOGA           ------------------------------------------------------------
MOC2B_DROME           DAELTKRLECFVNRKRDEINSQNVIDFK----SSFVSSDQNLSDSCARTQSTIIKQEQSN
MOC2B_DROPS           DCELKNRVECFFKRKRAEINSCNVIDFKQSNLSSNINSDTEVDVSCARTQSTISKQEQSN
E0VV36_PEDHC          ------------------------------------------------------------
A0A088AB86_APIME      SNELNHRISAFIERKRQQVNIVNVQEFCCHRDQNDENED-----SCARVDAILIRRKDSK
A0A158NAQ4_ATTCE      SEELNRRIESFIERKRQHVNTVNVQEFCRYSENNGNEN------SCARVDAILIRRKDSR
E9GWU7_DAPPU          NLELGKRITAFMERKRSES------DVFNVQEFCHRLPLNELENSCARTEAVLVSRKDSK
B7Q3T4_IXOSC          ------------------------------------------------------------
F6HAF9_VITVI          QEGGTCCSRKVKVEAQERKGCCGAKVKVDVE-----------------------------
F6HAG2_VITVI          QEGGTCCSRKVKVEAQERKGCCGAKVKVDVE-----------------------------
B9GFS6_POPTR          I-----------------------------------------------------------
K4C981_SOLLC          ------------------------------------------------------------
M1A5J7_SOLTU          ------------------------------------------------------------
MOC2B_ARATH           ------------------------------------------------------------
I1NX57_ORYGL          ------------------------------------------------------------
MOC2B_ORYSJ           ------------------------------------------------------------
I1IPN9_BRADI          ------------------------------------------------------------
C5XUJ7_SORBI          ------------------------------------------------------------
A9S6R9_PHYPA          ------------------------------------------------------------
B3RRC7_TRIAD          ------------------------------------------------------------
MOC2B_DICDI           ------------------------------------------------------------
D3BU88_POLPP          ------------------------------------------------------------
A9UST4_MONBE          ------------------------------------------------------------
C0NQH4_AJECG          ------------------------------------------------------------
C5GCQ5_AJEDR          ------------------------------------------------------------
MOC2B_COCIM           ------------------------------------------------------------
MOC2B_EMENI           ------------------------------------------------------------
MOC2B_ASPFU           ------------------------------------------------------------
F9XQE9_ZYMTI          GGLEF-------------------------------------------------------
D5GI04_TUBMM          ------------------------------------------------------------
C7YMB7_NECH7          ------------------------------------------------------------
MOC2B_SCLS1           ------------------------------------------------------------
MOC2B_NEUCR           ------------------------------------------------------------
MOC2B_PHANO           ------------------------------------------------------------
A8N1D2_COPC7          ------------------------------------------------------------
A0A0D1E8A8_USTMA      ------------------------------------------------------------
                                                                                  

A8XXG7_CAEBR          ------------------------------------------------------------
P91500_CAEEL          ------------------------------------------------------------
A0A2H2ILJ2_CAEJA      ------------------------------------------------------------
A7RSI0_NEMVE          ------------------------------------------------------------
D0NGD0_PHYIT          ------------------------------------------------------------
G3QG23_GORGO          ------------------------------------------------------------
H2QQV7_PANTR          ------------------------------------------------------------
MOC2B_HUMAN           ------------------------------------------------------------
G1RJJ3_NOMLE          ------------------------------------------------------------
F7IBH5_CALJA          ------------------------------------------------------------
G1T185_RABIT          ------------------------------------------------------------
H0X442_OTOGA          ------------------------------------------------------------
E2RI62_CANLF          ------------------------------------------------------------
M3WV85_FELCA          ------------------------------------------------------------
G1LMH7_AILME          ------------------------------------------------------------
MOC2B_BOVIN           ------------------------------------------------------------
F1SMF3_PIG            ------------------------------------------------------------
G5E7D1_LOXAF          ------------------------------------------------------------
MOC2B_MOUSE           ------------------------------------------------------------
MOC2B_RAT             ------------------------------------------------------------
L7N1E2_MYOLU          ------------------------------------------------------------
F6RWP4_MONDO          ------------------------------------------------------------
G3VIP0_SARHA          ------------------------------------------------------------
MOC2B_TAEGU           ------------------------------------------------------------
M3XJ03_LATCH          ------------------------------------------------------------
E7FEQ3_DANRE          ------------------------------------------------------------
I3K3S6_ORENI          ------------------------------------------------------------
Q4TB40_TETNG          ------------------------------------------------------------
F6ZA98_CIOIN          ------------------------------------------------------------
H2Z5M7_CIOSA          ------------------------------------------------------------
MO2B1_AEDAE           ------------------------------------------------------------
MO2B2_AEDAE           ------------------------------------------------------------
MOC2B_ANOGA           ------------------------------------------------------------
MOC2B_DROME           CHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQTDPTKEMRKSLPNSRLQAIESYM
MOC2B_DROPS           CHLKVRRATNRCGPQQMQFRPEYKHELSRLTASRV----STNEVGESLQNSRLHSIETYM
E0VV36_PEDHC          ------------------------------------------------------------
A0A088AB86_APIME      SHVKVHRVLNTWGPQTVDQHVLHKVTMSGANQTNNYS---------SVLDERISTTEKIL
A0A158NAQ4_ATTCE      SHIKVHRVLNEWGPQTIDQSILCKPINTNNTNNMSFDV----SDSFPILDERISVTERMI
E9GWU7_DAPPU          SHLKVSRCVNMWGPQTHSEVPAPSSVNTKLNPTPAIQERLQNMEKHLGFNS---------
B7Q3T4_IXOSC          ------------------------------------------------------------
F6HAF9_VITVI          ------------------------------------------------------------
F6HAG2_VITVI          ------------------------------------------------------------
B9GFS6_POPTR          ------------------------------------------------------------
K4C981_SOLLC          ------------------------------------------------------------
M1A5J7_SOLTU          ------------------------------------------------------------
MOC2B_ARATH           ------------------------------------------------------------
I1NX57_ORYGL          ------------------------------------------------------------
MOC2B_ORYSJ           ------------------------------------------------------------
I1IPN9_BRADI          ------------------------------------------------------------
C5XUJ7_SORBI          ------------------------------------------------------------
A9S6R9_PHYPA          ------------------------------------------------------------
B3RRC7_TRIAD          ------------------------------------------------------------
MOC2B_DICDI           ------------------------------------------------------------
D3BU88_POLPP          ------------------------------------------------------------
A9UST4_MONBE          ------------------------------------------------------------
C0NQH4_AJECG          ------------------------------------------------------------
C5GCQ5_AJEDR          ------------------------------------------------------------
MOC2B_COCIM           ------------------------------------------------------------
MOC2B_EMENI           ------------------------------------------------------------
MOC2B_ASPFU           ------------------------------------------------------------
F9XQE9_ZYMTI          ------------------------------------------------------------
D5GI04_TUBMM          ------------------------------------------------------------
C7YMB7_NECH7          ------------------------------------------------------------
MOC2B_SCLS1           ------------------------------------------------------------
MOC2B_NEUCR           ------------------------------------------------------------
MOC2B_PHANO           ------------------------------------------------------------
A8N1D2_COPC7          ------------------------------------------------------------
A0A0D1E8A8_USTMA      ------------------------------------------------------------
                                                                                  

A8XXG7_CAEBR          ------------------------------------------------------------
P91500_CAEEL          ------------------------------------------------------------
A0A2H2ILJ2_CAEJA      ------------------------------------------------------------
A7RSI0_NEMVE          ------------------------------------------------------------
D0NGD0_PHYIT          ------------------------------------------------------------
G3QG23_GORGO          ------------------------------------------------------------
H2QQV7_PANTR          ------------------------------------------------------------
MOC2B_HUMAN           ------------------------------------------------------------
G1RJJ3_NOMLE          ------------------------------------------------------------
F7IBH5_CALJA          ------------------------------------------------------------
G1T185_RABIT          ------------------------------------------------------------
H0X442_OTOGA          ------------------------------------------------------------
E2RI62_CANLF          ------------------------------------------------------------
M3WV85_FELCA          ------------------------------------------------------------
G1LMH7_AILME          ------------------------------------------------------------
MOC2B_BOVIN           ------------------------------------------------------------
F1SMF3_PIG            ------------------------------------------------------------
G5E7D1_LOXAF          ------------------------------------------------------------
MOC2B_MOUSE           ------------------------------------------------------------
MOC2B_RAT             ------------------------------------------------------------
L7N1E2_MYOLU          ------------------------------------------------------------
F6RWP4_MONDO          ------------------------------------------------------------
G3VIP0_SARHA          ------------------------------------------------------------
MOC2B_TAEGU           ------------------------------------------------------------
M3XJ03_LATCH          ------------------------------------------------------------
E7FEQ3_DANRE          ------------------------------------------------------------
I3K3S6_ORENI          ------------------------------------------------------------
Q4TB40_TETNG          ------------------------------------------------------------
F6ZA98_CIOIN          ------------------------------------------------------------
H2Z5M7_CIOSA          ------------------------------------------------------------
MO2B1_AEDAE           ------------------------------------------------------------
MO2B2_AEDAE           ------------------------------------------------------------
MOC2B_ANOGA           ------------------------------------------------------------
MOC2B_DROME           GLTTDNEENIFSRIKRVENRLLQLESISPEYRHFTKREPSSMEAAPPKKSRKKSYSAQEL
MOC2B_DROPS           GLTSKNNENIINRIKNVENRILLLESTSPEYQHFF--EQSCMDQPEKKIKTNKTYSAHEL
E0VV36_PEDHC          ------------------------------------------------------------
A0A088AB86_APIME      GINRPVPKDVYERLKNIEDRILYLEGISPEYKNLWKAEDMNNLKGTFKPIRKRTYSMAEL
A0A158NAQ4_ATTCE      GINKPVPKDIYERLKNIEDRILYLESISPEYKDFWTQ-----------------------
E9GWU7_DAPPU          -REQPIPLDVYGRLKALEDRILHLESISPEYFDGPFNLQNNKEDEDMISKIEQKMDELRR
B7Q3T4_IXOSC          ------------------------------------------------------------
F6HAF9_VITVI          ------------------------------------------------------------
F6HAG2_VITVI          ------------------------------------------------------------
B9GFS6_POPTR          ------------------------------------------------------------
K4C981_SOLLC          ------------------------------------------------------------
M1A5J7_SOLTU          ------------------------------------------------------------
MOC2B_ARATH           ------------------------------------------------------------
I1NX57_ORYGL          ------------------------------------------------------------
MOC2B_ORYSJ           ------------------------------------------------------------
I1IPN9_BRADI          ------------------------------------------------------------
C5XUJ7_SORBI          ------------------------------------------------------------
A9S6R9_PHYPA          ------------------------------------------------------------
B3RRC7_TRIAD          ------------------------------------------------------------
MOC2B_DICDI           ------------------------------------------------------------
D3BU88_POLPP          ------------------------------------------------------------
A9UST4_MONBE          ------------------------------------------------------------
C0NQH4_AJECG          ------------------------------------------------------------
C5GCQ5_AJEDR          ------------------------------------------------------------
MOC2B_COCIM           ------------------------------------------------------------
MOC2B_EMENI           ------------------------------------------------------------
MOC2B_ASPFU           ------------------------------------------------------------
F9XQE9_ZYMTI          ------------------------------------------------------------
D5GI04_TUBMM          ------------------------------------------------------------
C7YMB7_NECH7          ------------------------------------------------------------
MOC2B_SCLS1           ------------------------------------------------------------
MOC2B_NEUCR           ------------------------------------------------------------
MOC2B_PHANO           ------------------------------------------------------------
A8N1D2_COPC7          ------------------------------------------------------------
A0A0D1E8A8_USTMA      ------------------------------------------------------------
                                                                                  

A8XXG7_CAEBR          ----------------
P91500_CAEEL          ----------------
A0A2H2ILJ2_CAEJA      ----------------
A7RSI0_NEMVE          ----------------
D0NGD0_PHYIT          ----------------
G3QG23_GORGO          ----------------
H2QQV7_PANTR          ----------------
MOC2B_HUMAN           ----------------
G1RJJ3_NOMLE          ----------------
F7IBH5_CALJA          ----------------
G1T185_RABIT          ----------------
H0X442_OTOGA          ----------------
E2RI62_CANLF          ----------------
M3WV85_FELCA          ----------------
G1LMH7_AILME          ----------------
MOC2B_BOVIN           ----------------
F1SMF3_PIG            ----------------
G5E7D1_LOXAF          ----------------
MOC2B_MOUSE           ----------------
MOC2B_RAT             ----------------
L7N1E2_MYOLU          ----------------
F6RWP4_MONDO          ----------------
G3VIP0_SARHA          ----------------
MOC2B_TAEGU           ----------------
M3XJ03_LATCH          ----------------
E7FEQ3_DANRE          ----------------
I3K3S6_ORENI          ----------------
Q4TB40_TETNG          ----------------
F6ZA98_CIOIN          ----------------
H2Z5M7_CIOSA          ----------------
MO2B1_AEDAE           ----------------
MO2B2_AEDAE           ----------------
MOC2B_ANOGA           ----------------
MOC2B_DROME           SAFIQKIKDGSELS--
MOC2B_DROPS           RVYIHRKNKECP----
E0VV36_PEDHC          ----------------
A0A088AB86_APIME      DSKLHELEDKYAKRAK
A0A158NAQ4_ATTCE      ----------------
E9GWU7_DAPPU          KLV-------------
B7Q3T4_IXOSC          ----------------
F6HAF9_VITVI          ----------------
F6HAG2_VITVI          ----------------
B9GFS6_POPTR          ----------------
K4C981_SOLLC          ----------------
M1A5J7_SOLTU          ----------------
MOC2B_ARATH           ----------------
I1NX57_ORYGL          ----------------
MOC2B_ORYSJ           ----------------
I1IPN9_BRADI          ----------------
C5XUJ7_SORBI          ----------------
A9S6R9_PHYPA          ----------------
B3RRC7_TRIAD          ----------------
MOC2B_DICDI           ----------------
D3BU88_POLPP          ----------------
A9UST4_MONBE          ----------------
C0NQH4_AJECG          ----------------
C5GCQ5_AJEDR          ----------------
MOC2B_COCIM           ----------------
MOC2B_EMENI           ----------------
MOC2B_ASPFU           ----------------
F9XQE9_ZYMTI          ----------------
D5GI04_TUBMM          ----------------
C7YMB7_NECH7          ----------------
MOC2B_SCLS1           ----------------
MOC2B_NEUCR           ----------------
MOC2B_PHANO           ----------------
A8N1D2_COPC7          ----------------
A0A0D1E8A8_USTMA      ----------------