CLUSTAL format seed alignment for MF_03055

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

V5B8T4_TRYCR          ------------------------------------------------------------
Q38E77_TRYB2          ------------------------------------------------------------
E9AFZ6_LEIMA          ------------------------------------------------------------
A4IC41_LEIIN          ------------------------------------------------------------
A4HNI5_LEIBR          ------------------------------------------------------------
A8B2F8_GIAIC          --------------------------------------------------------MLGK
Q8II90_PLAF7          ----------------------------------------------------------MK
A0A077XAW6_PLABA      ----------------------------------------------------------MK
B3L580_PLAKH          ----------------------------------------------------------MK
A5K4T3_PLAVS          ----------------------------------------------------------MK
Q4N8T7_THEPA          --------------------------------------------------------MNMS
A2DE67_TRIVA          ----------------------------MA-------------------------ETKAK
A2ESN8_TRIVA          ----------------------------MT-------------------------ENEAK
A0D558_PARTE          ----------------------------MNTTLENKQDNNQIEQI----------EKKVK
A0DHK5_PARTE          ----------------------------MNTTIENNKDN-QIEQI----------EKKVK
Q23MB9_TETTS          ----------------------------MEQESNNKNNNNHIEDEDNEKPDHSELEQSST
K7KTS8_SOYBN          ------------------------------------------------------MSKTEV
I1JUQ6_SOYBN          ------------------------------------------------------MSETEV
F6H3C1_VITVI          ------------------------------------------------------MLEKEG
B9N6B6_POPTR          ------------------------------------------------------MLENEA
B9NA13_POPTR          ------------------------------------------------------MLENEA
K4B7J7_SOLLC          ---------------------------------------------------------MGE
M1AP22_SOLTU          ------------------------------------------MQLEEVKTKSNKEESMGE
TRMB_ARATH            ------------------------------------------------------MDNETK
TRMB_ORYSJ            -----------------------------------------------------MASGDGA
I1Q118_ORYGL          -----------------------------------------------------MASGDGA
I1GZG0_BRADI          -----------------------------------------------------MTRTNGA
C5XTR1_SORBI          ------------------------------------------------------MTTNGV
M0TJ33_MUSAM          ------------------------------------------------------MSSNAD
A9TAW8_PHYPA          ----------MTGEDSADIAHEASEVKEKNEAIEKNGSVSAVGEEPKAFIKGKRRSEQEA
TRMB_DICDI            ------------------------------------------------------------
F0ZDF3_DICPU          ------------------------------------------------------------
D3BLE5_POLPP          ------------------------------------MSESSTTTTTTNSVSNTNSNNNNK
TRMB_NEUCR            -----------------MSEPK--------NKRQK-----REDYRAAL---------RAN
A7F9Z4_SCLS1          -----------------MAGPP--------NKKQK-----REDYRTAR---------ENG
TRMB_PHANO            -----------------MPHAP--------AKRQK-----REEYKNAL---------HED
W7M2L8_GIBM7          -----------------MTTEL--------TSKQR-----ARENDRAK---------RTK
TRMB_ASPFU            -----------------MTPPP--------PKRQK-----RDEYRKATAEATSQ-SGASD
C8V3V0_EMENI          ------------------MGAT--------AKKQK-----REVYRNKVAAVTSAESGEAA
A0A0E1RW79_COCIM      -----------------MTPPP--------PKRQK-----RNEYRDEA-------KAQE-
C0NMT1_AJECG          ----------------MASMQP--------SKRQK-----RREYRETQ-------EQQIR
D5GH96_TUBMM          --------MSTPPTTSTSTSPP--------AKRQKPSNGERTGHRSAY---------RSD
TRMB_YEAST            ------------MKAKPLSQDP--------GSKRYAYRINKEENRKELKHVKINESSLVQ
TRMB_ASHGO            ---------------MSLTDDQ--------ASKRQAYRAAKEANRKELKHVKIDDA-LPN
TRMB_CANAL            -MSEATDKQKQVSAETPLERDLKSKQQSIAATKRKQYRDDKSQIRKQARFEVSTTPEPEQ
TRMB_YARLI            MLKRDQSEMDIEAETANMGKEEKES----FVHKRQKYRQEQEEKRLAAKKGVSFEQ--PE
TRMB_SCHPO            -----------------MSATA--------KKSAAQLQREEEEARKKLKRLSKQGG---V
TRMB_CRYNJ            -----------------MEAGP--------STASPG--VSVSPAPALT----------AG
E3KF66_PUCGT          --------MGANKKKRNFSAVD--------SSNQPNKKSTMTQSAADQ----------AK
F7H363_MACMU          ---------------------------------MAASLTCASGLCLHVDLVEKPRTRIMA
G3QGD9_GORGO          ---------------------------------MAASLTCASGLRLHVDLVEKPRTGIMA
H2Q6C5_PANTR          ----------------------------------------------------------MA
TRMB_HUMAN            ----------------------------------------------------------MA
G1S5U1_NOMLE          ----------------------------------------------------------MA
F7G2G6_CALJA          ----------------------------------------------------------MA
TRMB_BOVIN            ---------------------------------------------------------MAG
I3LY27_ICTTR          ---------------------------------------------------------MAG
G1P5W4_MYOLU          ---------------------------------------------------------MAG
A0A2I2UJG8_FELCA      ---------------------------------------------------------MAG
H0XB44_OTOGA          ---------------------------------------------------------MAG
TRMB_MOUSE            ------------------------------------------------------------
G1KN86_ANOCA          ------------------------------------------------------------
TRMB_DANRE            ------------------------------------------------------------
TRMBB_XENTR           ------------------------------------------------------------
H2MK18_ORYLA          ------------------------------------------------------------
G3N628_GASAC          ------------------------------------------------------------
I3KSR3_ORENI          ------------------------------------------------------------
H2VDV8_TAKRU          ------------------------------------------------------------
TRMBA_XENTR           --------------------------------------------------------MCNT
TRMB_BOMMO            ------------------------------------------------------------
A0A158P479_ATTCE      ------------------------------------------------------------
C3ZAN8_BRAFL          ------------------------------------------------------------
E9FWC0_DAPPU          ------------------------------------------------------------
A0A1X7VDJ5_AMPQE      ------------------------------------------------------------
TRMB_AEDAE            --------------------------------------------MEVE--------ESKN
TRMB_ANOGA            ----------------------------------------------ME--------EAID
TRMB_DROME            --------------------------------------------MVATGGQAQDQGQNQE
TRMB_DROPS            --------------------------------------------MVTT---------TAE
TRMB_CAEBR            --------------------------------------------MDVDPVN-----SEME
TRMB_CAEEL            --------------------------------------------MDITPAL-----TEME
A0A2H2I691_CAEJA      --------------------------------------------MEETAET-----SDVQ
G4VRR7_SCHMA          ------------------------------------------------MSECTMVLDPVD
A0A0D1DS41_USTMA      ---------------------------MAKRKRNALAHAVDASHTSAKTEHDRIALEQSK
H2XYT3_CIOIN          ------------------------------------------------------------
H2YSN6_CIOSA          ------------------------------------------------------------
B5Y3J6_PHATC          -----------------MTTETRVATIATESKGKDGTKRKAAPITLDGE-----------
H3G8D5_PHYRM          ------------------------MAETTTAKPED--------VQALSK-----------
A0A086QP12_TOXGO      ---------------MRLHSLERTATLHSSMEPACLTNSLDSSLSASSSSACSSSCMQDA
C4LUV8_ENTHI          ----------------------------------------------------MSSEHQTT
C4V6P8_NOSCE          ----------------------------------------------------------MN
B7XJS7_ENTBH          ----------------------------------------------------------MN
Q8SU19_ENCCU          ----------------------------------------------------------MQ
                                                                                  

V5B8T4_TRYCR          MTSAVQPKW-----------TRLPIRTRPHRNPLA-ENLDAHPDNP----------LELQ
Q38E77_TRYB2          MTSTTQPKW-----------TRLPIRTRPHRNPLA-ENSDNHPDCP----------AELQ
E9AFZ6_LEIMA          MASEEQPRW-----------TRLPIRTRPHRNPLA-ENDDEHPECP----------AQFE
A4IC41_LEIIN          MASEEQPRW-----------TRLPIRTRPHRNPLA-ENDDEHPECP----------AQFE
A4HNI5_LEIBR          MTSQEQSRW-----------TRLPIRTRPHRNPLA-ENDDEHPECP----------AQFA
A8B2F8_GIAIC          ADRPDASSS-----------KMARFRHRPHANPLA-DNDFQFPCTEPDEFPFD---LYYP
Q8II90_PLAF7          KHKK--------------TPCKRKYRQRAHCNPLS-DSYIKYPRNYTYVDWSL----HFP
A0A077XAW6_PLABA      KHK---------------TPCKKFYRQRAHCNPLS-DSYIKYPLNDKYVDWGI----HYP
B3L580_PLAKH          KHK---------------VPCKKFYRQRAHCNPLS-DSYIRYPLNCSHVDWRV----HYP
A5K4T3_PLAVS          KHK---------------VPCKKFYRQRAHCNPLS-DSYIRYPINCSYVDWRV----HYP
Q4N8T7_THEPA          DDNLESSKNVEPENQTIEYPKKQLFRQRAHCNPLS-DSFIPYPENPRHVNWFK----RYP
A2DE67_TRIVA          IPN---------------LPKKRDFRQRAHCNPLS-DRDIPYPLNPDVVDWTE----YYP
A2ESN8_TRIVA          IPN---------------LPKKGDYRQRAHSNPLS-DRNIPYPLNPDVIDWSE----LYP
A0D558_PARTE          IQK----------------PKKADFRMHAHVNPLN-ETLFPYPLNYNQVDWSL----HYP
A0DHK5_PARTE          IQK----------------PKKADFRMHAHVNPLN-ETLFPYPLNYNQVDWSS----HYP
Q23MB9_TETTS          IQKKQRL-----------MPKRGEYRMRAHINPLN-DTPFPYPLNPDYVNWKI----HYP
K7KTS8_SOYBN          NPTISKST---------GLPRKRFYRARAHSNPLS-DSHFPVPISPSHVDYSL----HYP
I1JUQ6_SOYBN          NPTISKST---------GLPRKRFYRARAHSNPLS-DSHFPVPISPSHVDYSL----HYP
F6H3C1_VITVI          HSKISKST---------HLPRKRFYRARAHSNPLS-DSHFPVPISPSHVDYSV----HFP
B9N6B6_POPTR          NPTISKST---------GLPRKRFYRARAHSNPLS-DSHFPVPISPSHVDYSL----HYP
B9NA13_POPTR          NPTISKST---------GLPRKRFYRARAHSNPLS-DSHFPVPISPSHVDFSL----HYP
K4B7J7_SOLLC          NHTHNKKT---------GLPRKRFYRARAHSNPLS-DSHFPIPISPCEVDYSL----HYP
M1AP22_SOLTU          NPTHNKKT---------GLPRKRFYRARAHSNPLS-DSHFPIPISPDEVDYSL----HYP
TRMB_ARATH            ATTFSKST---------GLPRKRFYRARAHSNPLS-DSHFPIPISPAHVDYSL----HFP
TRMB_ORYSJ            NGGGGGGQ--------GKLPRKRFYRARAHSNPLS-DSHFPIPISPDEVDLSQ----HYP
I1Q118_ORYGL          NGGGGGGQ--------GKLPRKRFYRARAHSNPLS-DSHFPIPISPDEVDLSQ----HYP
I1GZG0_BRADI          SGGGGGQQA------AGKLPRKRFYRARAHSNPLS-DSHFPIPISPDDVELSQ----HYP
C5XTR1_SORBI          GGGG-------------KLPRKRFYRARAHSNPLS-DSHFPVPISPKEVDLSQ----HYP
M0TJ33_MUSAM          TAQAKSRS--------GRLPRKRFYRARAHSNPLS-DSHFPIPISPADFDCSH----HYP
A9TAW8_PHYPA          QVKAGKQK--------GQLPKKRFYRARAHSNPLS-DCQFSVPTTPSEFDWSE----SFP
TRMB_DICDI            -MVYQKQEP------KKKKAIKPYHRIKAHANPAS-DYNFYYPTGPESYDWTK----NYP
F0ZDF3_DICPU          -MADQN---------KKKRAIKPYHRIKAHANPAS-DYSFYYPISPDQYDWKK----NYP
D3BLE5_POLPP          RANSANTTE------KKKKPIKPYHRIKAHANPQS-DSNFDYPVSPSCYDWSK----HYN
TRMB_NEUCR            GVT--------------ELPRKKFYRQRAHANPFS-DHSLIYPPTPEQMDWAS----LYP
A7F9Z4_SCLS1          EESK-------------ELPKKKFYRQRAHANPFS-DHRLAYPASPAQMDWAS----HYP
TRMB_PHANO            ESNA-------------ALPKKKFYRQRAHANPFS-DHSLTYPKSPADMDWAS----LYP
W7M2L8_GIBM7          DGVT-------------QLPRKKFYRQRAHANPFS-DHMLEYPKSPDDMDWSS----YFP
TRMB_ASPFU            VAEI-------------KLPKKKYYRQRAHANPFS-DHHLKYPLSPAHMDWSS----HYP
C8V3V0_EMENI          LAAL-------------KLPQKKYYRQRAHANPFS-DHLLKYPLSPAHMDWAT----HFP
A0A0E1RW79_COCIM      SGAI-------------QMPRKRLYRQRAHANPFS-DHHLSYPISPDHMDWSV----HFP
C0NMT1_AJECG          SGEV-------------QLPKKRLYRQRAHANPFS-DHRLSYPISPAHMDWST----HYP
D5GH96_TUBMM          LTRQ-------------GLPQKKHYRQRAHANPFS-DHQLVYPPCPADMDWSK----HFS
TRMB_YEAST            EGQ------------KIDLPKKRYYRQRAHSNPFS-DHQLEYPVSPQDMDWSK----LYP
TRMB_ASHGO            KSS------------ELDLPKKKFYRQRAHSNPFS-DHQLEYPLSPAEMDWSK----LYP
TRMB_CANAL            SDSSATTAT------ITELPKKRYYRQRAHSNPFS-DHRLEYPKSPESMDWSN----LYP
TRMB_YARLI            DGE-------------IKLPKKRYYRQRAHSNPFS-DHQLEYPESPADMDWDV----LYP
TRMB_SCHPO            EGR---------------LPMKRLFRQRAHANVLS-DHELEYPRSPSEMDWSP----YYP
TRMB_CRYNJ            EVQL------------LKVPQKRFYRQRAHANVFI-DHELDYPKRPELMDWST----HYP
E3KF66_PUCGT          EKLP------------HIMPRKRFYRQRAHANPFS-DHNLDYPARSEEMDWSK----HYP
F7H363_MACMU          AETWNVAGA------EAPPPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
G3QGD9_GORGO          AETWNVAGA------EAPPPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
H2Q6C5_PANTR          AETWNVAGA------EAPPPQKRYYRQRAHSNPIA-DHTLRYPVKPEEMDWSE----LYP
TRMB_HUMAN            AETRNVAGA------EAPPPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
G1S5U1_NOMLE          AETWSVAGA------EAPTPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
F7G2G6_CALJA          AETWNAAGA------EAPPPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
TRMB_BOVIN            TETGDAAGT------EAPQPQKRYYRQRAHSNPMA-DHTLRYPVKPEDMDWSE----LYP
I3LY27_ICTTR          TETGNPVGA------EAPQPQKRYYRQRAHSNPMA-DHTLRYPVKPEDMDWSE----LYP
G1P5W4_MYOLU          AEAGGAAGA------QAPQPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
A0A2I2UJG8_FELCA      AETGDAAGA------EAPQPQKRYYRQRAHSNPMA-DHTLRYPVKPEDMDWSE----LYP
H0XB44_OTOGA          AESWNAAGT------EAPQPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
TRMB_MOUSE            ----MMAGA------EAPQPQKRYYRQRAHSNPMA-DHTLRYPVKPEEMDWSE----LYP
G1KN86_ANOCA          -------ME------GALPPQKRFYRQRAHSNPLA-DHTLHYPAKPQEMDWSL----LFP
TRMB_DANRE            --------M------SVCMPQKRYYRQRAHSNPMA-DHTFQYPVCPEQMDWSP----LYP
TRMBB_XENTR           --------M------SVCMPQKRYYRQRAHSNPMA-DHTFQYPVCPEQMDWSP----LYP
H2MK18_ORYLA          --------M------SSSMPQKRFYRQRAHSNPMA-HHTFEYPVCPQEMDWSK----LYP
G3N628_GASAC          --------M------TSSMPQKRYYRQRAHSNPMA-HHTFNYPVCPEEMDWSE----LYA
I3KSR3_ORENI          --------M------ASSMPQKRYYRQRAHSNPMA-HHTFDYPVCPDKMDWSK----LYP
H2VDV8_TAKRU          ------------------MPQKKYYRQRAHSNPMA-HHTFDYPVCPEEMDWSQ----LYP
TRMBA_XENTR           QATPSDPGI------TVAHPKKRYYRQRAHSNPMA-DHTFQYPVKPEIMDWSE----YYP
TRMB_BOMMO            ----------------MALPQKKYYRQRAHSNPIA-DHCFDYPSHPDDYDWTP----LYP
A0A158P479_ATTCE      ------MTT------TLALPQKKYYRQRAHSNPIA-DHCIEYPIKPELMDWSI----LYP
C3ZAN8_BRAFL          ---------------MASLPQKKFYRQRAHSNPMA-DHSFDYPVKPDVMDWSP----YYP
E9FWC0_DAPPU          ---------------MASLPQKKYYRQRAHSNPIA-DHCFDYPVSPNDMKWDE----LYP
A0A1X7VDJ5_AMPQE      -MAAESPVA------GEALPQKRYYRQRAHSNPLS-DHCFDYPVSPDDMNWAN----LYP
TRMB_AEDAE            DASVVASPA------PTKLPQKRFYRQRAHSNPIA-DHSFDYPIHPDDYDWSQ----HYP
TRMB_ANOGA            DH--------------VKLPQKRFYRQRAHSNPIA-DHSFDYPLLPELSNWNE----LYP
TRMB_DROME            PDVLNPTSA------VTGLPQKRYYRQRAHSNPIA-DHSFDYPARPEDVDWRS----MYP
TRMB_DROPS            NEVLTSTSA------VTGLPQKRYYRQRAHSNPIA-DHCFDYPARPEDVDWRS----LYP
TRMB_CAEBR            LDNKPTCET------VPGLPQKKHYRQRAHSNPHS-DHDIEYPLTPDHMDWSK----QYG
TRMB_CAEEL            LDHKPTCET------VPGLPQKKHYRQRAHSNPHS-DHDIEYPLTPNHMDWTK----YYG
A0A2H2I691_CAEJA      LDAKPTCET------VPGLPQKKHYRQRAHSNPHS-DHDIEYPLSPLHMDWTE----NYG
G4VRR7_SCHMA          SCEKHSTDE------NIRLPSKRHYRQRAHCNPWS-DHTLDYPLKPELMDWEK----LFG
A0A0D1DS41_USTMA      SHINHLAGG------KIVIPQKRWYRQRAHANPFS-DHSLQYPTQPSEMNWGT----IYP
H2XYT3_CIOIN          MDEIENEII------SKKLPRKKYFRQRAHSNPLG-DHNVEYPISPRTMDWSK----HYP
H2YSN6_CIOSA          MDEM--DIV------LHNLPRKKYFRQRAHSNPLG-DHNVEYPISPSTMDWSK----YYP
B5Y3J6_PHATC          ------------------KPQKKFYRQRAHCNPLSHNDSFDYPVKPLDIDWTE---DHFP
H3G8D5_PHYRM          ------------------LPQKKFYRSRAHCNPLSHNDCFDYPQTPDEMDWS----THYP
A0A086QP12_TOXGO      AAVGGQDSA------GVLKPKKAAYRQRAHCNPLA-DSYIVYPRSPDFVDWSRHFPAFFP
C4LUV8_ENTHI          EHSHNSIIK-------KKKGIKPFHRVHAHRNPLA-DSPSTNPITPQSLDWKL----YFP
C4V6P8_NOSCE          KN-----------------ISKRDYRQRAHSNPFK-DTDITIPTSPDSINWLE----YFK
B7XJS7_ENTBH          KNNCNDKKL---------KLKKSNFRCKAHTSSFK-VIGLFIPPNPDAINWND----YFS
Q8SU19_ENCCU          MGN---------------GIKKSLYRQRAHANPFK-DSNITVPPSPQLIDWSS----YFR
                                               * :.* .          *                 

V5B8T4_TRYCR          ARCADFY-----------------------------------------------------
Q38E77_TRYB2          EQCTTLF-----------------------------------------------------
E9AFZ6_LEIMA          RRFSEFY-----------------------------------------------------
A4IC41_LEIIN          KRFSEFY-----------------------------------------------------
A4HNI5_LEIBR          ERFAEFY-----------------------------------------------------
A8B2F8_GIAIC          TWTSQRS-----------------------------------------------------
Q8II90_PLAF7          LYFEKNQIKDEYITNKENSKDEHIVTDNMKNNVENDNMNNVLYLNTNKYPVNYKMRNIFN
A0A077XAW6_PLABA      LYFRDLGNVGK---NEEEQVSKVEKNDNIQSS-ENNTDADKLFLNTNKYPICYENKIQIK
B3L580_PLAKH          HLPSEGCKTQV---ETINSVE-TKHTTNVTEEGRIDQDSPILQLNTNKYPIDYNQGPPKY
A5K4T3_PLAVS          HLAAHGSDAQA---EPINSVEATKHITNTEVERPPDEDPPTLQLNTNKYPIDYNQGPPKC
Q4N8T7_THEPA          SVY---------------------------------DNDHYLQFNTNDYPEDYTTSLEDE
A2DE67_TRIVA          ILTS----------------------------------------NPDSIPDHY-------
A2ESN8_TRIVA          ILKS----------------------------------------NPDSIPDHY-------
A0D558_PARTE          KKFG--------------------------------KDPLKLYLNTLEYPITYDDQVNPD
A0DHK5_PARTE          KKFG--------------------------------KDPLKLYLNTLEYPITYDDQVKPE
Q23MB9_TETTS          KFFDG-----------------------------TDEENQKVFCNTNEHPQTYDEEVNSL
K7KTS8_SOYBN          QLLPSS------------------------------------------------------
I1JUQ6_SOYBN          QLFPLS------------------------------------------------------
F6H3C1_VITVI          QLFSSS------------------------------------------------------
B9N6B6_POPTR          QFFSSS------------------------------------------------------
B9NA13_POPTR          QFFSLS------------------------------------------------------
K4B7J7_SOLLC          EVV---------------------------------------------------------
M1AP22_SOLTU          EVV---------------------------------------------------------
TRMB_ARATH            KFVEA-------------------------------------------------------
TRMB_ORYSJ            RYFPSGE-------------------------------------------------GEAR
I1Q118_ORYGL          RYFPSGE-------------------------------------------------GEAR
I1GZG0_BRADI          RYFPADK-------------------------------------------------DEHG
C5XTR1_SORBI          RYFPADK-------------------------------------------------GSDG
M0TJ33_MUSAM          YFFPPGS-------------------------------------------------GGRS
A9TAW8_PHYPA          EFFAQ-------------------------------------------------------
TRMB_DICDI            QQAMN-------------------------------------------------------
F0ZDF3_DICPU          NQPMD-------------------------------------------------------
D3BLE5_POLPP          KTLSEQ------------------------------------------------------
TRMB_NEUCR            HYAVEEPIEQK-------------------------TETTESEESTGQELSAPA------
A7F9Z4_SCLS1          AYA------ES-------------------------PTASEGIEETSEVCKSSN------
TRMB_PHANO            AYAVVK--REQ-------------------------KSAGEEESTPLDEEEQRR------
W7M2L8_GIBM7          HYV-------Q-------------------------EGTPEDPSKPP-------------
TRMB_ASPFU            AFVN------P-------------------------DPSHINLAGAR-------------
C8V3V0_EMENI          AFVN------P-------------------------DPSQTNLAGTR-------------
A0A0E1RW79_COCIM      AYVD------P-------------------------DESKTNLAGFR-------------
C0NMT1_AJECG          AFVV------P-------------------------NPNNVNLSGTR-------------
D5GH96_TUBMM          SPIS---------------------------------TSTTTPEEKR-------------
TRMB_YEAST            YYK--------------------------------------NAENGQ-------------
TRMB_ASHGO            HYY--------------------------------------DAATNT-------------
TRMB_CANAL            KQY--------------------------------------DIS----------------
TRMB_YARLI            NRK--------------------------------------EGQ----------------
TRMB_SCHPO            DFD--------------------------------------VESN---------------
TRMB_CRYNJ            AYFS------Q-------------------------PNEDGTITQGE-------------
E3KF66_PUCGT          HFFQ------A-------------------------PNSQTTIDHKEEGGEEEKNGVCTA
F7H363_MACMU          EFFAP--------------------------------LTQNQSHDDPKDKKEK-------
G3QGD9_GORGO          EFFAP--------------------------------LTQNQSHDDPKDKKEK-------
H2Q6C5_PANTR          EFFAP--------------------------------LTQNQSHDDPKDKKEK-------
TRMB_HUMAN            EFFAP--------------------------------LTQNQSHDDPKDKKEK-------
G1S5U1_NOMLE          AFFAP--------------------------------LTQNQSHDDPKDKKEK-------
F7G2G6_CALJA          EFFTP--------------------------------LTQNQSHDDPKDEKEK-------
TRMB_BOVIN            EFFAP--------------------------------LPQNQSHDDPKDKKEK-------
I3LY27_ICTTR          EFFAP--------------------------------LTQNQSHDDPKDKKEN-------
G1P5W4_MYOLU          EFFAP--------------------------------PTQNQSHDDPKDKKEK-------
A0A2I2UJG8_FELCA      EFFAP--------------------------------LTQNKSHDDPKDKNEE-------
H0XB44_OTOGA          EFFAP--------------------------------FTKNQSHDDLKDKKEK-------
TRMB_MOUSE            EFFAP--------------------------------LIQNKSHDDPKDEKEK-------
G1KN86_ANOCA          DFFAP--------------------------------LTKDNQHDDPKDVEERT------
TRMB_DANRE            QYFP---------------------------------QQEEA------------------
TRMBB_XENTR           QYFP---------------------------------QQEEA------------------
H2MK18_ORYLA          DFTTG--------------------------------NTPDK------------------
G3N628_GASAC          DFITG--------------------------------NPSDK------------------
I3KSR3_ORENI          DLFTG--------------------------------SLSET------------------
H2VDV8_TAKRU          HFFPG--------------------------------KSSED------------------
TRMBA_XENTR           DYFKP--------------------------------LVPDSAHDDAKDLQER-------
TRMB_BOMMO            IISEK--------------------------------PNQ--------------------
A0A158P479_ATTCE      QYFQS--------------------------------NDEQTLETQ--------------
C3ZAN8_BRAFL          AFFES--------------------------------PSQAERHDDDKEADER-------
E9FWC0_DAPPU          TFSKD--------------------------------GIMKH------------------
A0A1X7VDJ5_AMPQE      PPLSP--------------------------------PPTKSSGE-----ASSN------
TRMB_AEDAE            TIG---------------------------------------------------------
TRMB_ANOGA            NIG---------------------------------------------------------
TRMB_DROME            GIQQ--------------------------------------------------------
TRMB_DROPS            SIRA--------------------------------------------------------
TRMB_CAEBR            DYAA--------------------------------------------------------
TRMB_CAEEL            DYTK--------------------------------------------------------
A0A2H2I691_CAEJA      DFAN--------------------------------------------------------
G4VRR7_SCHMA          G--EP--------------------------------VSSLSVNNNS-------------
A0A0D1DS41_USTMA      RFFDP--------------------------------KTGEKKQAYE-------------
H2XYT3_CIOIN          AYFVNEK------------------------------SENNEMESDD-------------
H2YSN6_CIOSA          SFFNTQ--------------------------------ENGSMDGQI-------------
B5Y3J6_PHATC          GLEK--------------------------------------------------------
H3G8D5_PHYRM          GIEN--------------------------------------------------------
A0A086QP12_TOXGO      GKADTPASVEL-------------------------ALNTEQYPVSYPSRQPPH------
C4LUV8_ENTHI          NGKP--------------------------------------------------------
C4V6P8_NOSCE          NGQPP-------------------------------------------------------
B7XJS7_ENTBH          NGQPP-------------------------------------------------------
Q8SU19_ENCCU          MNRRP-------------------------------------------------------
                                                                                  

V5B8T4_TRYCR          -PAMRNPVVEFVDVGCAFGGMLFALSQEYPDACMLGLEIRPRVVKFAQEKTLGLRE--AT
Q38E77_TRYB2          -PGMDNPVITLVDVGCAFGGMLFSLAPDFPDMCMLGLEIRPKVVEFAQNKVMKLREGAAT
E9AFZ6_LEIMA          -PGMVNPVVEFVDVGCAFGGMLFSLAAVFPATCMMGLEIRPKVVSFAQEKALALRQ-ENA
A4IC41_LEIIN          -PGMANPVVEFVDVGCAFGGMLFSLAAVFPTTCMMGLEIRPKVVSFAQEKALALRQ-ENA
A4HNI5_LEIBR          -PGVDNPVVEFVDVGCAFGGMLFSLAAVFPTTCMLGLEIRSKVVSFAQEKTLALRQ-ENA
A8B2F8_GIAIC          -TDAREYHFDIVDIGCGYGDFVRNVSLAFPDLLVIGLELRDIPVVLGQQALLNGRS----
Q8II90_PLAF7          ESYENNKNVTILDIGCGYGGLLFSLSKIFNDKLILGLEIRDKITNYVGEKILSYRYNY--
A0A077XAW6_PLABA      P---NNFEVNFLDIGCGYGGLLFELCKVFDNKLILGLEIRDKITNYVGEKINTYRKNN--
B3L580_PLAKH          A---THAQVTILDVGCGYGGLLFELSKAFPDKLILGMEIRDKITNYVGEKIHSYRKNY--
A5K4T3_PLAVS          A---PHAEVTILDIGCGYGGLLFELSKTFPNKLILGMEIRDKITNYVGEKIHSYRKNY--
Q4N8T7_THEPA          N----YPKVDFLDVGCGYGGLLIYLSKLYPSKLSLGMEIRDKRTEPRRGLIVIS---L--
A2DE67_TRIVA          --------PTILDIGCGFGGMSFALSPEFPNNLILALEIRSQVATYVEKKIQAFHAQG--
A2ESN8_TRIVA          --------PTMLDIGCGYGGMTFALSTEFPQNLIFALEIRSQVTTYVEKKIQAYHAQG--
A0D558_PARTE          CSQ---SIVDFLDIGCGFGGLCFALSENYPDKYIFGMEIRGKVVNFVGEKIRALRDEG--
A0DHK5_PARTE          YSE---SIVDFLDIGCGFGGLCFALSENYPDKYTFGMEIRGKVVNFVGEKIRALRDEG--
Q23MB9_TETTS          YNGLQGAQPVFLDIGCGFGGLVFNLAKNFPEKLVLGLEIRDKLVNYVSEKIKALRIESP-
K7KTS8_SOYBN          GQADTFKKIQFADVGCGFGGLLISLSTLFPETLMIGMELRDKVTEYVKERILSLRVANP-
I1JUQ6_SOYBN          GQADSSKKIQFADVGCGFGGLLISLSTLFPETLMIGMELRDKVTEYVKERISSLRVANP-
F6H3C1_VITVI          DEGGDSKKIEFADVGCGFGGLLISLSTLFPETLMIGMEIRDKVTEYVKERILALRVANP-
B9N6B6_POPTR          GEVGSIKKVQFADVGCGFGGLLISLSTLFPETLMIGMELRDKVTEYVKERILALRTTNP-
B9NA13_POPTR          CEVGCIKMVQFADIGCGFGGLLVSLSTLFPETLMIGMELRDKVAEYVKERILALRTTNP-
K4B7J7_SOLLC          -KVDPCKRIEFADVGCGFGGLLIALAPLFPDNLMIGMELRDKVTEYVKERILGLRTTNS-
M1AP22_SOLTU          -KVDPSKRIEFADVGCGFGGLLIALAPLFPDNLMIGMELRDKVTEYVKERILGLRTTNP-
TRMB_ARATH            -DNKFIKKVEFADIGCGFGGLLISLATLFPDTLMIGMELRDKVTEYVKERILALRRTSSE
TRMB_ORYSJ            QGDAAVPRIRFADVGCGFGGLLVGLSTLFPDTLMIGMELRDKVTEYVKERILALRASNP-
I1Q118_ORYGL          QGDAAVPRIRFADVGCGFGGLLVGLSTLFPDTLMIGMELRDKVTEYVKERILALRASNP-
I1GZG0_BRADI          DGEVAAPRIRFADVGCGFGGLLVGLSPIFPDKLMIGMELRDKVTEYVKERVLALRASNP-
C5XTR1_SORBI          EEAAAPQQIRFADVGCGFGGLLVGLSPLFPDTLMIGMELRDKVTEYVKERILALRAANP-
M0TJ33_MUSAM          DGDAPPRKVRFADIGCGFGGLLVGLSPLFPDTLMLGMELRDKVTEYVKERILALRASNP-
A9TAW8_PHYPA          -EETTDLKVRFADIGCGFGGLIVQMSPLFPKTLMVGMELRDKVSEYVKERIVALREQHP-
TRMB_DICDI            -----EKKVEIADVGCGYGGLLISLSSLFPERLSVGMELRDKVVQYVEERIDKLREKHV-
F0ZDF3_DICPU          -----TKKVEIADVGCGYGGLLISLSSLFPDRLSVGMELRDKVVQYVEERIDKLREKTP-
D3BLE5_POLPP          ----PEKRVTIADVGCGYGGLLVGLASTFPDRLALGLEIRDKVVQYVEDRIEKLRKDNEE
TRMB_NEUCR            -IRKLTKQVEVADIGCGFGGLLIALAPVLPETLVLGLEIRVSVTQFVEDRIKALRVQNE-
A7F9Z4_SCLS1          -VKKMKQDVEVADIGCGFGGLTVALAPKLPNSLILGTSAFCPI-----ERIKALRVQEK-
TRMB_PHANO            -LKAITKNVEIADIGCGFGGLLFALAPKFPDTLMLEYVQ---------EKVRALRLQNA-
W7M2L8_GIBM7          ---KLTKDVEIVDIGCGFGGLLVALAPKLPDTLTLGLEIRTQVAGYVQERIKALRSQNS-
TRMB_ASPFU            ---RLLKDVEVVDIGCGFGGLLIGLAPLLPESLIVGMEIRVSVLEYVTTRIQALRAQQQK
C8V3V0_EMENI          ---KLIKDVEVVDIGCGFGGLLVGLAPVLPDTLMVGMEIRVQVTEYLTNRIKALRHQQA-
A0A0E1RW79_COCIM      ---KLLKDVEVADIGCGFGGLLVALAPVMPDTLMVGMEIRIQVLEYVTARIQALRSQRP-
C0NMT1_AJECG          ---RLTKDVEIADIGCGFGGLLVALAPLMPDTLMVGMELRAQVLEYVTDRIRALRAQRP-
D5GH96_TUBMM          --------VEVADIGCGFGGLIISLPKVLPGVRMLGMEIRTQVTEYVDERIRALRRLAG-
TRMB_YEAST            ----MTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNT--
TRMB_ASHGO            ----MTKKVTVADIGCGYGGLMVELSRELPENLILGMEIRVQVTNYVEDRIIALRTNH--
TRMB_CANAL            -------KVEIADIGCGYGGLMIKLGPQFPKSLILGLEIRVQVTQYVEDRIIALRKNQEI
TRMB_YARLI            -------KVEVADIGCGFGGLLVALSPQLPNQLILGMEIRVQVTNYVEDRIVALRHQN--
TRMB_SCHPO            ------KKVEIVDIGCGYGGLTVALGPQFPDTLVLGMEIRMQVSDYLKEKIQALRYRAD-
TRMB_CRYNJ            ------KKVEWADVGCGFGGLLMALAPLFPEKLMLGMEIRTSVTKYVTDRIAATRQAQSL
E3KF66_PUCGT          LADSSKKVVEFADVGCGFGGLLVAMAPLFPEKLMLGLEIRPHVCQYVEDKILALRAQQKI
F7H363_MACMU          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
G3QGD9_GORGO          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
H2Q6C5_PANTR          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
TRMB_HUMAN            ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
G1S5U1_NOMLE          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
F7G2G6_CALJA          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
TRMB_BOVIN            ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
I3LY27_ICTTR          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRTAP--
G1P5W4_MYOLU          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
A0A2I2UJG8_FELCA      ---RAPAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
H0XB44_OTOGA          ---RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
TRMB_MOUSE            ---HSGAQVEFADIGCGYGGLLVALSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAP--
G1KN86_ANOCA          ---KPTSQVEFADIGCGYGGLLVALSPLFPNTLMLGLEIRVKVSDYVQDRIRSLRASH--
TRMB_DANRE            ----GGAQVEFADIGCGYGGLLVQLSQLFPQQLILGLEIRVKVSDYVQDRIRSLRVAE--
TRMBB_XENTR           ----GGAQVEFADIGCGYGGLLVQLSLLFPQQLILGLEIRVKVSDYVQDRIRSLRVAE--
H2MK18_ORYLA          ----ATPRVEFADIGCGYGGLLVELSPLFPDKLILGMEIRVKVSDYVQDRIRSLRASN--
G3N628_GASAC          ----DTPRVEFADIGCGYGGLLVELSPLFPDKLILGMEIRVKVSDYVQDRIRSLRASE--
I3KSR3_ORENI          ----EPPRVEFADIGCGYGGLLVELSPLFPDKLILGMEIRVKVSDYVQDRIQSLRASN--
H2VDV8_TAKRU          ----KTHQVEFADIGCGYGGLLVELSTLFPDKLMLGLEIRVKVSDYVRDRIQSLRASE--
TRMBA_XENTR           ---KEQHQVEFADIGCGYGGLLVELSPLFPNTLMLGLEIRVKVSDYVQDRIKSLRASH--
TRMB_BOMMO            --------VEFLDVGCGYGGLLVALSPMFPSNLMLGSEIRVKVSDYVNDRIKALRVQY--
A0A158P479_ATTCE      ------KCVEFADVGCGYGGLLVTLSPMFPDNLILGMEIRVKVSDYVMDRIAALRSQN--
C3ZAN8_BRAFL          ----PPSRVEFADIGCGYGGLLVALSPMFPDTLMLGMEIRVKVSDYVTDRIKALRDKH--
E9FWC0_DAPPU          -------KVQFADIGCGYGGLLISLSTVFPETLMLGMEIRLKVSEYVQDRIKALRILH--
A0A1X7VDJ5_AMPQE      ---LDPFPPEFLDIGCGYGGLLVELSPLFPRTRILGLEIRVKVCDYVQDRISALRQKA--
TRMB_AEDAE            -----DKRVEFADIGCGYGGFLVTLGEMFPDKFAVGMEIRVKVSDYVMDRIQALRKLN--
TRMB_ANOGA            -----NRQVVFADIGCGYGGFLVTLGETFPDKLAIGMEIRVKVSDYVMDRIKALRQRH--
TRMB_DROME            -----GQQVSFADIGCGYGGFLVTLGEMFPEKLSIGMEIRVKVSDYVVDRIAALRRRCAD
TRMB_DROPS            -----DQEVSFADIGCGYGGFLVTLGELFPEKISIGMEIRVKVSDYVLDRITALRQKSSG
TRMB_CAEBR            -----GRQVEFADIGCGYGGLLMRLSPMFPETLMIGMEIRVKVSDYVNEKIQALRKHHEG
TRMB_CAEEL            -----GRQVDFADIGCGYGGLLMRLSPKYPDNLMIGMEIRVKVSDYVNEKIQALRKHHAE
A0A2H2I691_CAEJA      -----GRLVEFADIGCGYGGLLMRLSPMFPDTLMIGMEIRVKVSDYVNEKIQALRKHHEK
G4VRR7_SCHMA          ----FDPVVRFLDVGCGYGGLLFNLSTSYPFTRSVGLEIRLKVFDFVQEKIKALRVKH--
A0A0D1DS41_USTMA      ----HANGVEFADVGCGFGGLLMQLAPLYPETLMLGLEIRVHVTQYVHDKIVALRLAAQQ
H2XYT3_CIOIN          ---MTVRKVEVLDIGCGYGGLLIALSKLLPDTLITGMEIRVKVSDYVQERIQALRMAHVG
H2YSN6_CIOSA          ---ETIRKVEVLDIGCGYGGLLIALSKLLPETLILGLEIRVKVSEYVQERIQALRKADTE
B5Y3J6_PHATC          -----GSVPTVLDIGCGFGGLTMALAPLLPSQIVLGMEIRAKVTEYVRLRIVAARKEQE-
H3G8D5_PHYRM          -----PSV-DFLDVGCGFGGLTVKLAELFPDKLTLAMEIRAKVTEYVHLRIEALRAENS-
A0A086QP12_TOXGO      LNGTVGSRVEFLDVGCGFGGLLVSLAPKFPTTLMMGMEIREKVTNYVGERIAALRKEHAS
C4LUV8_ENTHI          --------AEMLDIGCGWGGLVREVGMIQ-EKNVLGMEIRDPAVQYGLEKIQAAREKN--
C4V6P8_NOSCE          ---------SFLDVGCGYGKFLMLENQ----NNILGLEIRDKVYRYVRDRINKD------
B7XJS7_ENTBH          ---------NSIDIGCGYGRFLFKASKI-LDHNILGIEIRKKVYEYSMLKKQKE------
Q8SU19_ENCCU          ---------DFVDIGCGYGKFLMKVAEKNPEHSILGLEIRDKVCEYVKARIEAA------
                                  *:**.:* :                                       

V5B8T4_TRYCR          ------------------------------------------------------------
Q38E77_TRYB2          ------------------------------------------------------------
E9AFZ6_LEIMA          ------------------------------------------------------------
A4IC41_LEIIN          ------------------------------------------------------------
A4HNI5_LEIBR          ------------------------------------------------------------
A8B2F8_GIAIC          ------------------------------------------------------------
Q8II90_PLAF7          ------------------------------------------------------------
A0A077XAW6_PLABA      ------------------------------------------------------------
B3L580_PLAKH          ------------------------------------------------------------
A5K4T3_PLAVS          ------------------------------------------------------------
Q4N8T7_THEPA          ------------------------------------------------------------
A2DE67_TRIVA          ------------------------------------------------------------
A2ESN8_TRIVA          ------------------------------------------------------------
A0D558_PARTE          ------------------------------------------------------------
A0DHK5_PARTE          ------------------------------------------------------------
Q23MB9_TETTS          ------------------------------------------------------------
K7KTS8_SOYBN          ------------------------------------------------------------
I1JUQ6_SOYBN          ------------------------------------------------------------
F6H3C1_VITVI          ------------------------------------------------------------
B9N6B6_POPTR          ------------------------------------------------------------
B9NA13_POPTR          ------------------------------------------------------------
K4B7J7_SOLLC          ------------------------------------------------------------
M1AP22_SOLTU          ------------------------------------------------------------
TRMB_ARATH            ------------------------------------------------------------
TRMB_ORYSJ            ------------------------------------------------------------
I1Q118_ORYGL          ------------------------------------------------------------
I1GZG0_BRADI          ------------------------------------------------------------
C5XTR1_SORBI          ------------------------------------------------------------
M0TJ33_MUSAM          ------------------------------------------------------------
A9TAW8_PHYPA          ------------------------------------------------------------
TRMB_DICDI            ------------------------------------------------------------
F0ZDF3_DICPU          ------------------------------------------------------------
D3BLE5_POLPP          ------------------------------------------------------------
TRMB_NEUCR            ------------------------------------------------------------
A7F9Z4_SCLS1          ------------------------------------------------------------
TRMB_PHANO            ------------------------------------------------------------
W7M2L8_GIBM7          ------------------------------------------------------------
TRMB_ASPFU            LRAATATATA----------------------------ASETPSQQQAQIDGKQANANAA
C8V3V0_EMENI          LKLQLQQSSA----------------------------ASTPAAAP-----SPSPAPVPE
A0A0E1RW79_COCIM      -PPEAPQE-------------------------------SSSPDKSESQLQNQSSIQSSP
C0NMT1_AJECG          -APPLPTEHT----------------------------PSTPPAQLPSNSPPTAAVPADP
D5GH96_TUBMM          ------------------------------------------------------------
TRMB_YEAST            ------------------------------------------------------------
TRMB_ASHGO            ------------------------------------------------------------
TRMB_CANAL            ------------------------------------------------------------
TRMB_YARLI            ------------------------------------------------------------
TRMB_SCHPO            ------------------------------------------------------------
TRMB_CRYNJ            LPADSVDT----------------------------------------------------
E3KF66_PUCGT          IQQQSSSTGEGTESVFEL-----------------PSLPKSVPQNDKQIEQDADPVTNQA
F7H363_MACMU          ------------------------------------------------------------
G3QGD9_GORGO          ------------------------------------------------------------
H2Q6C5_PANTR          ------------------------------------------------------------
TRMB_HUMAN            ------------------------------------------------------------
G1S5U1_NOMLE          ------------------------------------------------------------
F7G2G6_CALJA          ------------------------------------------------------------
TRMB_BOVIN            ------------------------------------------------------------
I3LY27_ICTTR          ------------------------------------------------------------
G1P5W4_MYOLU          ------------------------------------------------------------
A0A2I2UJG8_FELCA      ------------------------------------------------------------
H0XB44_OTOGA          ------------------------------------------------------------
TRMB_MOUSE            ------------------------------------------------------------
G1KN86_ANOCA          ------------------------------------------------------------
TRMB_DANRE            ------------------------------------------------------------
TRMBB_XENTR           ------------------------------------------------------------
H2MK18_ORYLA          ------------------------------------------------------------
G3N628_GASAC          ------------------------------------------------------------
I3KSR3_ORENI          ------------------------------------------------------------
H2VDV8_TAKRU          ------------------------------------------------------------
TRMBA_XENTR           ------------------------------------------------------------
TRMB_BOMMO            ------------------------------------------------------------
A0A158P479_ATTCE      ------------------------------------------------------------
C3ZAN8_BRAFL          ------------------------------------------------------------
E9FWC0_DAPPU          ------------------------------------------------------------
A0A1X7VDJ5_AMPQE      ------------------------------------------------------------
TRMB_AEDAE            ------------------------------------------------------------
TRMB_ANOGA            ------------------------------------------------------------
TRMB_DROME            ------------------------------------------------------------
TRMB_DROPS            ------------------------------------------------------------
TRMB_CAEBR            ------------------------------------------------------------
TRMB_CAEEL            ------------------------------------------------------------
A0A2H2I691_CAEJA      ------------------------------------------------------------
G4VRR7_SCHMA          ------------------------------------------------------------
A0A0D1DS41_USTMA      GRLEHASTSTGTSTGTSTGTSASRELNCKTDQASTCTAQDDAASCAGGSAIASTTSAAAD
H2XYT3_CIOIN          ------------------------------------------------------------
H2YSN6_CIOSA          ------------------------------------------------------------
B5Y3J6_PHATC          ------------------------------------------------------------
H3G8D5_PHYRM          ------------------------------------------------------------
A0A086QP12_TOXGO      ------------------------------------------------------------
C4LUV8_ENTHI          ------------------------------------------------------------
C4V6P8_NOSCE          ------------------------------------------------------------
B7XJS7_ENTBH          ------------------------------------------------------------
Q8SU19_ENCCU          ------------------------------------------------------------
                                                                                  

V5B8T4_TRYCR          -----------------SDSFHHFCNLWFEQMNVMKFGSNCFRKGQLRVLFFCYPDPHWK
Q38E77_TRYB2          -----------------DGTSHHYRNVWFEQLNVMKFGSNCFNKGQLQALFFCYPDPHWK
E9AFZ6_LEIMA          -----------------ASLTQHYRNVWFEQMNVMKFGSNCFTKGQLSRLFFCYPDPHWK
A4IC41_LEIIN          -----------------ASLTQHYRNVWFEQMNVMKFGSNCFTKGQLSRLFFCYPDPHWK
A4HNI5_LEIBR          -----------------ASSTLHYRNIWFEQMNVMKFGSNCFKKGQLSRLFFCYPDPHWK
A8B2F8_GIAIC          --------------------AGQNENAAIIRCNIMKHLPRLLARQSVRYLTVMFPDPQFK
Q8II90_PLAF7          --------------------HPYYQNISVIRTNVIKFLPNYIKKNQIEKIFFCFPDPHFK
A0A077XAW6_PLABA      --------------------FPNYNNISVIRTNAMKFLPNYIKKNQIEKMFFCFPDPHFK
B3L580_PLAKH          --------------------PPQYKNISVIRTNAMKFLPNYIKKNQIEKLFFCFPDPHFK
A5K4T3_PLAVS          --------------------PPQYKNISVVRTNAMKFLPNYIKKNQIEKLFFCFPDPHFK
Q4N8T7_THEPA          --------------------CVQYLNISVVRTNSMKFLPNYLGKNQLEKIFFCFPDPHFK
A2DE67_TRIVA          ----------------------LSLNIQVQWTNTMRTLMRYIRAHTIEKIFILFPDPHFK
A2ESN8_TRIVA          ----------------------LALNIQVQWANTMRTLMRYLRAHTIEKIFILFPDPHFK
A0D558_PARTE          ----------------------QAHNVSVIRTNTMRHLPQYIRKNSLEKIFICFPDPHFK
A0DHK5_PARTE          ----------------------QAHDVSVIRTNTMRHLPQYFRKNSLEKIFICFPDPHFK
Q23MB9_TETTS          --------------------DHKYNNAACIRTNAMRHIIQYFRKGTIEKMFFCFADPHFK
K7KTS8_SOYBN          ---------------------GQYQNVSVVRTNSMKYIPNYFEKGTLSKMFFLFPDPHFK
I1JUQ6_SOYBN          ---------------------GQYQNVSVVRTNSMKYIPNYFEKGTLSKMFFLFPDPHFK
F6H3C1_VITVI          ---------------------GQYQNVSVVRTNSMKYIPNYFGKGQLSKMFFLFPDPHFK
B9N6B6_POPTR          ---------------------GQYQNVSVVRTNSMKYIPNYFEKGQLTKMFFLFPDPHFK
B9NA13_POPTR          ---------------------GQYQNVSVVRTNSMKYLPNYFEKGQLTKMFFLFPDPHFK
K4B7J7_SOLLC          ---------------------GQYQNISVVRTNSMKYIPNYFEKGQLKKMFFLFPDPHFK
M1AP22_SOLTU          ---------------------GQYQNISVVRTNSMKYIPNYFGKGQLKKMFFLFPDPHFK
TRMB_ARATH            ---------------------GQYENISVVRTNSMKYIPNYFEKGQLSKMFFLFPDPHFK
TRMB_ORYSJ            ---------------------GKYDNISVVRTNSMKYIPNYFRKAQLSKMFFLFPDPHFK
I1Q118_ORYGL          ---------------------GKYDNISVVRTNSMKYIPNYFRKAQLSKMFFLFPDPHFK
I1GZG0_BRADI          ---------------------GQYDNISVVRTNSMKYIPNYFRKAQLSKMFFLFPDPHFK
C5XTR1_SORBI          ---------------------GQYDNISVVRTNSMKYIPNYFRKAQLTKMFFLFPDPHFK
M0TJ33_MUSAM          ---------------------GHYENISVVRTNSMKYLPNYFEKGQLSKMFFLFPDPHFK
A9TAW8_PHYPA          ---------------------GQYENISVLRTNAMKYLPNYFEKGQLTKMFFLFPDPHFK
TRMB_DICDI            ---------------------GQFQNISVIRTNAMKYLPNYFEKGQLQKIFFLFPDPHFK
F0ZDF3_DICPU          ---------------------GEFQNVSVIRTNGMKYLPNYFEKGQLQKIFFLFPDPHFK
D3BLE5_POLPP          --------------------KNQYQNISVLKTNAMKYLPNLFYKGQLEKIFFLFPDPHFK
TRMB_NEUCR            -------------------EQKLYRNIAVLRANTMKFMPNFFNKGQLNKIFICFPDPHFK
A7F9Z4_SCLS1          -------------------ETGLFQNASCIRANTMKFMPNFFKKHQLAKIFLCFPDPHFK
TRMB_PHANO            -------------------SIQLYQNASCLRANTMKFLPNFFSKAQLSKIFLCFPDPHFK
W7M2L8_GIBM7          -------------------D-NMYQNVGCIRANTMKFLPNFFKKAQLSKIFICFPDPHFK
TRMB_ASPFU            ADAASPAPSTDTEHMPTTLVPGSYENISAIRSNTMKFFPNFFARHQLSKIFICFPDPHFK
C8V3V0_EMENI          TPTANDPSVDDSEIFPSTLIPGGYQNITAIRANTMKFLPNFFARGQLSKIFICFPDPHFK
A0A0E1RW79_COCIM      S---------------AAVSSASYQNISAIRSNTMKFLPNFFSRHQLSSIFICFPDPHFK
C0NMT1_AJECG          SPQSQSQPLSPDPPSLSPSSQASYQNISAIRTNTMKFLPNFFTRHQLSAIFICFPDPHFK
D5GH96_TUBMM          --------------------GEAYADVGVIRANAMKFLPNFFERSQLQKVFLCFPDPHFK
TRMB_YEAST            ------------------ASKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHFK
TRMB_ASHGO            ------------------AAQKEYQNINVLRGNAMKFLPNFFEKSQLEKMFFCFPDPHFK
TRMB_CANAL            -INDKKKKESGGGTGDGDDNDYSYQNIAVLRGNAMKFLPNFFVKGQLSKMFFCFPDPHFK
TRMB_YARLI            ------------------KETDGYQNISVLRGNAMKFLPNFFEKGQLSKIFFCFPDPHFK
TRMB_SCHPO            ---------------HEEPVPGGYKNISVLRMNCQKFLPNFFEKGQLSKMFFCFPDPHFK
TRMB_CRYNJ            -------------------KPGGYQNVSVIKANSMKHMPNFFAKGQLEKIFFLFPDPHFK
E3KF66_PUCGT          SNEVTPDEELDDEAPIWVPKPGRFENVSVIRANAMKFSPNFFRKHQLSKMFFLFPDPHFK
F7H363_MACMU          --------------------GGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
G3QGD9_GORGO          --------------------AGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
H2Q6C5_PANTR          --------------------AGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
TRMB_HUMAN            --------------------AGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
G1S5U1_NOMLE          --------------------AGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
F7G2G6_CALJA          --------------------GGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
TRMB_BOVIN            --------------------GGGFQNIACLRSNAMKHLPNFFHKGQLTKMFFLFPDPHFK
I3LY27_ICTTR          --------------------GGGFQNIACLRSNAMKHLPNFFRKGQLTKMFFLFPDPHFK
G1P5W4_MYOLU          --------------------GGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFK
A0A2I2UJG8_FELCA      --------------------GGGFQNIACLRSNAMKHLPNFFRKGQLTKMFFLFPDPHFK
H0XB44_OTOGA          --------------------GGGFQNIACLRSNAMKHLPNFFRKGQLTKMFFLFPDPHFK
TRMB_MOUSE            --------------------GGGFQNIACLRSNAMKHLPNFFRKGQLAKMFFLFPDPHFK
G1KN86_ANOCA          --------------------AGQFQNVACIRSNAMKHLPNFFHKGQLCKMFFLFPDPHFK
TRMB_DANRE            --------------------PGRYQNIACLRSNAMKYLPNFFRKGQLSKMFFLFPDPHFK
TRMBB_XENTR           --------------------PGRYQNIACLRSNAMKYLPNFFRKGQLSKMFFLFPDPHFK
H2MK18_ORYLA          --------------------PGSYGNIACLRSNAMKYLPNFFFKGQLSKMFFLFPDPHFK
G3N628_GASAC          --------------------PGLYQNIACIRSNAMKYLPNFFFKGQLSKMFFLFPDPHFK
I3KSR3_ORENI          --------------------PGSYQNIACIRSNAMKYLPNFFCKGQLTKMFFLFPDPHFK
H2VDV8_TAKRU          --------------------SEKYQNIACIRSNAMKYLPNFFCKGQLSKMFFLFPDPHFK
TRMBA_XENTR           --------------------LGQYQNIACIRSNAMKYIPNFFKKGQLSKMFFLFPDPHFK
TRMB_BOMMO            --------------------PDQYQNVAVLRTNAMKYLPNFFHKGQLKKMFFLYPDPHFK
A0A158P479_ATTCE      --------------------PGQYQNIACLRTNAMKYLPNYFYKGQLKKMFFLYPDPHFK
C3ZAN8_BRAFL          --------------------PGEYQNVSCIRTNAMKYLPNFFRKGQLKKMFFLFPDPHFK
E9FWC0_DAPPU          --------------------PGDYGNVACLRSNAMKYLPCFFDKGQLTKMFFLFPDPHFK
A0A1X7VDJ5_AMPQE      --------------------PGTYDNIAVLRTNAMKYLPNYFKKGQLSKMFFLFPDPHFK
TRMB_AEDAE            --------------------EGQYENIACIRTNAMKYLTNFFHKGQLEKMFFLYPDPHFK
TRMB_ANOGA            --------------------KGKYENIACIRTNAMKYLPNYFRKHQLEKLFFLYPDPHFK
TRMB_DROME            --------------------TGAYQNIACLRTNAMKYLPNYFVKGQLEKMFFLYPDPHFK
TRMB_DROPS            --------------------TGAYQNIACLRTNAMKYLPNYFRKGQLEKMFFLYPDPHFK
TRMB_CAEBR            --------------------AGHYRNIAVLRSNAMKYMPNYFRKGQLSKMFFLFPDPHFK
TRMB_CAEEL            --------------------AGHYRNVAVLRSNAMKYMPNYFHKGQLSKMFFLFPDPHFK
A0A2H2I691_CAEJA      --------------------EGHYRNIAVLRTNAMKYLPNYFNKGQLSKMFFLFPDPHFK
G4VRR7_SCHMA          --------------------SGQYNNIACIRTNAMKFLPNFFHKEQLHKIFFLYPDPHFK
A0A0D1DS41_USTMA      DDEMDELTANAELVSSAHLTPGSYDNVGVLRANGMKFLPNFFHKHQLSKLFFLFPDPHFK
H2XYT3_CIOIN          --------------------TKEFQNVACIRTNAMKYLPNFFSKGQLKKTFILFPDPHFK
H2YSN6_CIOSA          --------------------NKNFQNVACIRTNAMKYLPNFFSKGQLKKMFILFPDPHFK
B5Y3J6_PHATC          ---------------------GRYKNASVLRTNSMKFLPNFFGRSSLEKLFFCFPDPHFK
H3G8D5_PHYRM          ---------------------GQFQNVSALRTNAMRYLPHYFRKGQITKMFFCFPDPQFK
A0A086QP12_TOXGO      --------------------TGQFANVSIIRTNVMKFLVNYFRKGQLTKMFFCFPDPHFK
C4LUV8_ENTHI          ----------------------ELKNVWIIQCNCMKYVDNYFVKGQLLKIFITFPDPHFK
C4V6P8_NOSCE          ----------------------SLDNCAIMKTNALLFLPNICHKLSIEKIFILFPDPHFK
B7XJS7_ENTBH          ----------------------NIGNVGLMNTNALLFLQNIVKKNSLNNIFILFPDPHFK
Q8SU19_ENCCU          ----------------------GIPNAGVMRTNALIFLPNIFSRGQLTKIFILFPDPHFK
                                               :      *             :    . :.**::*

V5B8T4_TRYCR          KKNIRRRIISPGLVHEYAYWLKIG-GLLFTVSDVEELEQWMVSCLDG-------------
Q38E77_TRYB2          RKNVRRRIISPGLVQEYAYWLKVG-GFLFTVSDVEELERWMVTCLDG-------------
E9AFZ6_LEIMA          RKNIRRRIISPGLVQEYAYWLRHG-GLVYTVSDVAELEEWMVQCLDD-------------
A4IC41_LEIIN          RKNIRRRIISPGLVQEYAYWLRHG-GLVYTVSDVAELEEWMVRCLDD-------------
A4HNI5_LEIBR          RKNIRRRVISPGLVQEYAYWLRHG-GLLYTVSDVAELEEWMKQCLDD-------------
A8B2F8_GIAIC          ASHARRRVISPQLLSEYAYYLKSG-GFLFVCSDLQDLYLYMCSTIAG-------------
Q8II90_PLAF7          RHNWRRRIITIENLSLYYHLLKNN-GYIYFITDVYTLYLWVIFCFSK-------------
A0A077XAW6_PLABA      KPNWRRRIITIESLSLYYHLLQKN-GLIYFITDVFTLYLWVKFCLNK-------------
B3L580_PLAKH          KQNWRRRTITIENLSLYYYLLKTG-GLIYFITDVYTLYLWVKFCFSK-------------
A5K4T3_PLAVS          KQNWRRRTITIESLSLYYYLLKRD-GLIYFITDVYTLFLWVRFCFSK-------------
Q4N8T7_THEPA          RSNWRRRIVNYPLLSLYAYFLKPE-GRLYIVTDVYELYAWMENALED-------------
A2DE67_TRIVA          KKKSKWRIISQQLLDEYAFIMKGG-ARMYLVTDVRQYFEYAVPLLEA-------------
A2ESN8_TRIVA          KKKAKWRIISEQLLDEYAYIMKGG-ARFYLVTDVRQYFEYAVPILEA-------------
A0D558_PARTE          KKNFRRRIVNPGLLSEYAYLLKPS-GRIYCITDVEELHNWHVQHLEK-------------
A0DHK5_PARTE          KKNFRRRIVNPGLLSEYAYLLKPS-GRIYCITDVEELHNWHVQHLEK-------------
Q23MB9_TETTS          KSNHRRRIINTGFLSEYAFLLKPK-GRIYCITDVEDLHNWQEEHLAK-------------
K7KTS8_SOYBN          EKNHRRRVISPFLLDEYAYVLEVG-GIIYTITDVEELGYWMKSCLEN-------------
I1JUQ6_SOYBN          EKNHRRRVISPFLLDEYAYVLEVG-GIIYTISDVEELGDWMKSCLEN-------------
F6H3C1_VITVI          EKNHRRRVISTHLLDEYAYVLGIG-GIIYTITDVEELGDWMKDCLEG-------------
B9N6B6_POPTR          EKNHRRRVISPHLLDEYAYVLEVG-GIIYSITDVEELGDWMKTCLEN-------------
B9NA13_POPTR          EKNHRRRVISPHLLDEYAYVLEVG-GIIYTITDVEELGEWMKTCLDN-------------
K4B7J7_SOLLC          EKNHRRRVISPFLLDEYAYVLAVG-GIIYTITDVEELGEWMKSCLEE-------------
M1AP22_SOLTU          EKNHRRRVISPFLLDEYAYVLAVG-GIIYTITDVEELGEWMKSCLEE-------------
TRMB_ARATH            EKNHRRRVISTHLLDEYAYVLRAG-GIIYTITDVEELGEWMKSCLEK-------------
TRMB_ORYSJ            EKNHRRRVISMQLLDEYAYVMEVG-GIIYTITDVEELGEWMRSCLEK-------------
I1Q118_ORYGL          EKNHRRRVISMQLLDEYAYVMEVG-GIIYTITDVEELGEWMRSCLEK-------------
I1GZG0_BRADI          EKNHRRRVISMQLLDEYAYVMEVG-GIIYTITDVEELGIWMRSCLEK-------------
C5XTR1_SORBI          EKNHRRRVISMQLLDEYAYVMEVG-GIIYTITDVEELGEWMRSCLEK-------------
M0TJ33_MUSAM          EKNHRRRVISPQLLDEYAYALEVG-GIIYTITDVEELGDWMRSCLED-------------
A9TAW8_PHYPA          EKNHRRRIISTALLAEYAYIMAVG-GILYTITDVQELGEWMKAHLDA-------------
TRMB_DICDI            KATHKRRIISPTLLSEYAYILAPG-AYAYFISDVEELYLWMFEHFKN-------------
F0ZDF3_DICPU          KANHKRRIISPTLLSEYAYILAPG-AFAYFISDVEELFQWMYEHFKN-------------
D3BLE5_POLPP          KANHKRRIISPALLAEYAYVIKVG-GLAYFISDVEELYLWMHEHFKG-------------
TRMB_NEUCR            ARKHKQRIVSTTLNSEYAYVLRPG-GIVYTITDVPDLHEWMVGHFNA-------------
A7F9Z4_SCLS1          ARKHKARIVSTTLAAEYAYVVRPG-GIIYTITDVEDLHNWMVTHFNA-------------
TRMB_PHANO            QRKHKARIVSYTLNSEYAYVLRPG-GVVYTITDVKDLHEWMVGHFEK-------------
W7M2L8_GIBM7          ARKHKARIVSTTLNSEYAYALRPG-GIVYTITDVEDLHLWMVQHLEA-------------
TRMB_ASPFU            ARKHKARIISETLNAEYAYALRPG-GLLYTITDVEEYHHWILRHFGVELGAEEESEE---
C8V3V0_EMENI          ARKHKARIVSETLNAEYAYALRPG-GLLYTITDVEEYHYWILRHFGYDVEAEQAQKQGEG
A0A0E1RW79_COCIM      ARKHKARIVSTSLNAEYAYVLRPG-GKLYTITDVEDLHLWMVSHFEGTADEVP-------
C0NMT1_AJECG          TRKHKARIVSSSLNAEYAYVLRPG-GKLYTITDVEELHRWMVSHFDVGDGDEE-------
D5GH96_TUBMM          ARKHKARIVSPTLASEYAYVLAPA-GVLYTITDVEDLHHWMAKHFDE-------------
TRMB_YEAST            QRKHKARIITNTLLSEYAYVLKEG-GVVYTITDVKDLHEWMVKHLEE-------------
TRMB_ASHGO            QRKHKARIITNTLLSEYAYVLKEG-GVIYTITDVLDLHNWMVEHLNM-------------
TRMB_CANAL            QRKHKARIITNTLLSEYAYVLREG-GVVYTITDVEDLHNWMVKHLDE-------------
TRMB_YARLI            QRKHKARIVTTTLCSEYAYVVRPG-GIVYTITDVKDLHEWMVKHLAA-------------
TRMB_SCHPO            ARKHKNRIITSTLASEYAYFIRPH-GTLYTITDVEELHVWMAQHLDA-------------
TRMB_CRYNJ            NRKHKARIITPALLAEYAYVLRPG-GILYTVTDVKDLHEWMAHHLHA-------------
E3KF66_PUCGT          ARKHKARIISPTLLSEYGYILRPN-GIIYTITDVKDLNVWMVKHLSE-------------
F7H363_MACMU          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFEE-------------
G3QGD9_GORGO          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFEE-------------
H2Q6C5_PANTR          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFEE-------------
TRMB_HUMAN            RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFEE-------------
G1S5U1_NOMLE          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFEK-------------
F7G2G6_CALJA          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFEE-------------
TRMB_BOVIN            RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHEWMCTHFEG-------------
I3LY27_ICTTR          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHHWMCTHFEG-------------
G1P5W4_MYOLU          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHEWMCTHFEG-------------
A0A2I2UJG8_FELCA      RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHDWMCTHFER-------------
H0XB44_OTOGA          RTKHKWRIISPTLLAEYAYVLRVG-GLVYTITDVLELHNWMCTHFEG-------------
TRMB_MOUSE            RTKHKWRIISPTLLAEYAYVLRVG-GLVYTVTDVPELHEWMCTHFEE-------------
G1KN86_ANOCA          KTKHKWRIISSTLLAEYAYVLREE-GLVYTITDVEEVHKWMVTHFEE-------------
TRMB_DANRE            KTKHKWRIISPTLLAEYAYTLRIG-GLVYTNTDVEEVHEWIVQHFSD-------------
TRMBB_XENTR           KTKHKWRIISPTLLAEYAYTLRIG-GLVYTNTDVEEVHEWIVQHFSD-------------
H2MK18_ORYLA          KTKHKWRIISPTLLAEYAYTLRVG-GLVYTITDVEEVHLWMVKHFTE-------------
G3N628_GASAC          KTKHKWRIISPTLLAEYAYTLRLG-GLVYTITDVEEVHVWMVKHFTE-------------
I3KSR3_ORENI          KTKHKWRIISPTLLAEYAYTLRVG-GLVYTITDVEEVHLWMVKHFSE-------------
H2VDV8_TAKRU          KTKHKWRIISPTLLAEYAYTLRVG-GLVYTMTDVEEVHIWMVKHFAE-------------
TRMBA_XENTR           KTKHKWRIISPTLLAEYAYVLRIG-GMVYTITDVEEVHTWMVKHFTE-------------
TRMB_BOMMO            KAKHKWRIINKWLLSEYAYVLCEQ-GIVYTITDVKDLNEWMVAHFEE-------------
A0A158P479_ATTCE      KSKHKWRIINKSLLAEYAYVLAEG-AIVYTVTDVEDLHKWILQHFQE-------------
C3ZAN8_BRAFL          KTKHKWRIISSTLLAEYAYVLAVG-AIVYTITDVEEVHEWMKQHFVQ-------------
E9FWC0_DAPPU          KAKHKWRIINDTLLAEYAYVLAEG-GLVYTITDVKDLHEWMVMHLDQ-------------
A0A1X7VDJ5_AMPQE      KTKHKRRIINECLLAEYAYVLREG-GLVYTATDVKDLHEWIEMHFME-------------
TRMB_AEDAE            KAKHKWRIINSALLSEYSYVLRQG-GLIYTITDVKDLHEWMCKHIEQ-------------
TRMB_ANOGA            KAKHKWRIINPTLLSEYAYVLRPG-GKIYTVTDVRELHEWMCKHIEE-------------
TRMB_DROME            RAKHKWRIINQALLSEYAYILRKG-GLLYTMTDVEDLHKWIVTHMEE-------------
TRMB_DROPS            RAKHKWRIINQALLSEYAYVLRKG-GLVYTMTDVEDLHNWIVTHMDE-------------
TRMB_CAEBR            NKKHKWRIITPTLVSEYAYVLREQ-GLIYTITDVKDLHDWMVKHLNE-------------
TRMB_CAEEL            NKKHKWRIITPTLLSEYAYVLREG-GIIYTITDVKDLHEWMVKHLSE-------------
A0A2H2I691_CAEJA      NKKHKWRIITRSLLSEYAYVLREG-GLIYTITDVKDLHDWMVLHLTD-------------
G4VRR7_SCHMA          RVKHKWRIISPTLLDIYAYLLTPG-GKIYSTTDVPDLGKWIVDCLCA-------------
A0A0D1DS41_USTMA      SRKHKARIISPTLLAEYAYVLRPG-GIVYIITDVKQLYDWMDQHLGQ-------------
H2XYT3_CIOIN          KQKHKWRIVSSTLLAEYAYILCQG-GLLYTITDVLEVHEWMVKHFSE-------------
H2YSN6_CIOSA          KQKHKWRIVSPTLLAEYAYILCQG-GSLYTITDVLEVHEWMVRHITE-------------
B5Y3J6_PHATC          RKNHPRRIVSERLLSEYAYVLKPSVGRLYCITDVKELHEWHVEKCER-------------
H3G8D5_PHYRM          ARLHRRRIVHTPLLTEYAYLLAPG-GILYTITDVEELHEWHVEKCSS-------------
A0A086QP12_TOXGO      RSNWRRRIINTPVLSLYAYVLRPG-GLLYTVTDVEDLHRWMRKSCLL-------------
C4LUV8_ENTHI          NSVKRRRIINPHFAAMYVYLLKPGEGMLYTASDVKELFDWNTQSLDQ-------------
C4V6P8_NOSCE          KRKQKGRVICKQMMHIYAYILRER-GRLYISTDVIALFNDMKDVIKK-------------
B7XJS7_ENTBH          KSKQKGRIICKQSIKIFAYLLKLD-GKLYISTDIKELYVYMKNIILE-------------
Q8SU19_ENCCU          KRKQKGRIVCRQMMEMYEYLLADG-GKLYISTDVKELFNCMMEAVLG-------------
                            * :       : . :    .  :  :*:                          

V5B8T4_TRYCR          --------------CPLFRRLN-------EEELQSDAMT-----RKVLGYAMNASEDAQR
Q38E77_TRYB2          --------------CPLFRQLS-------QEELAGNEMV-----RKMLDYAANSSEDAQR
E9AFZ6_LEIMA          --------------SPLFRRLA-------EAELCTPEH------KQVLEIVTGASEDAQR
A4IC41_LEIIN          --------------SPLFRRLA-------EAELRTPEH------KQVLDIVTGASEDAQR
A4HNI5_LEIBR          --------------SPLFRRLT-------EAELSTSAH------QQVLEIVTGTSEDAQR
A8B2F8_GIAIC          --------------HPFFCELQ-------HEEGADDNDGDTRVVKTILKLMDKTADAERH
Q8II90_PLAF7          --------------CPYFKVLT-------NKDCE---------NDICVKLIHESSEESKK
A0A077XAW6_PLABA      --------------YQKFKILS-------EEEYK---------NDICIKLIHEKSEESKR
B3L580_PLAKH          --------------YPSFQLLS-------PEECQ---------DDICVQLIHGSSEESKR
A5K4T3_PLAVS          --------------YPGFRLLS-------PEECQ---------GDICVRLIHHSSEESKR
Q4N8T7_THEPA          --------------HPLFEPLN-------DIDKG---------KDECYLTFDKETEEGKK
A2DE67_TRIVA          --------------HPLFKRIT-------DLDS-----------DKCVELSKTSTEESNK
A2ESN8_TRIVA          --------------HPLFKRVT-------DIDS-----------DKCVNLAKTSTEESNK
A0D558_PARTE          --------------HKMFKRIQ-------DVEQ-----------DSAAKLIWNSTEEGQK
A0DHK5_PARTE          --------------HKMFKRVQ-------DVEQ-----------DSAAKLIWNSTEEGQK
Q23MB9_TETTS          --------------HRMFRKLS-------EEELV---------GDICVQLIQDSTEEGQK
K7KTS8_SOYBN          --------------HRMFEALT-------DKELE---------ADAVVKLLSSATEEGQK
I1JUQ6_SOYBN          --------------HPMFEALT-------EKELE---------ADPVVKLLSSATEEGQK
F6H3C1_VITVI          --------------HPMFEAIT-------EAELE---------GDPVVKLLSSATEEGQK
B9N6B6_POPTR          --------------HPMFEALT-------EEELE---------ADPAVKLLRTATEEGQK
B9NA13_POPTR          --------------HPMFEALT-------EEELQ---------ADPAVKLLCTATEEGQK
K4B7J7_SOLLC          --------------HPMFEALT-------SEELE---------ADQVVKLLSAATEEGQK
M1AP22_SOLTU          --------------HPMFEALT-------TEELE---------ADQVVKLLTAATEEGQK
TRMB_ARATH            --------------HPMFESLT-------QEELV---------SDPVVELLCSATEEGQK
TRMB_ORYSJ            --------------HPLFEAIP-------EEETK---------ADPVVKLLSTATEEGQK
I1Q118_ORYGL          --------------HPLFEAIP-------EEETK---------ADPVVKLLSTATEEGQK
I1GZG0_BRADI          --------------HSLFEAVP-------DEEIK---------VDPVVKLLSTATEEGQK
C5XTR1_SORBI          --------------HPLFETVP-------EEEIK---------ADPVFKLLSTATEESQK
M0TJ33_MUSAM          --------------HPLFGAVP-------EEELV---------LDPVVKLLSSATEEGQK
A9TAW8_PHYPA          --------------HPLFHPLT-------DEELE---------KDVCVPLLINATEEGQK
TRMB_DICDI            --------------HPLFEQVE-------RDIAEN---------DSCIPLIVNSTEEGRK
F0ZDF3_DICPU          --------------HPLFEQVE-------REVAEN---------DSCVPLIINSTEEARK
D3BLE5_POLPP          --------------HPLFEEVK-------LEPTD----------DPCIPLILNATEEGRK
TRMB_NEUCR            --------------HPAFERVS-------VEEQE---------ADPLVEIMRNETEEGKK
A7F9Z4_SCLS1          --------------HPTFERVL-------EEEQE---------ADECVNIMRTETEEGKK
TRMB_PHANO            --------------HPSFERCE-------KEFEEEGEA-----MDEGVGIMRTETEEGKK
W7M2L8_GIBM7          --------------HPAFERIS-------KEEEE---------ADECVQVMSTETEESKK
TRMB_ASPFU            -KSTSPNANANAGVRELFERVS-------EEELE---------KDECVRVMKEATEEGKK
C8V3V0_EMENI          QEEVQESVGKREGSAELFERVS-------EEDIE---------KDECVRVMKEATEEGKK
A0A0E1RW79_COCIM      ---GNDAAG----VSELWERVD-------DEELD---------KDECVRIMRDETEEGKK
C0NMT1_AJECG          ---GAGEEGQINTVKELFERVG-------DDELE---------QDPCVRIMMEETEEGKK
D5GH96_TUBMM          --------------HPLFERLI-------GEEVD---------GDVCIAVMRTDTEEGKK
TRMB_YEAST            --------------HPLFERLS-------KEWEE---------NDECVKIMRNATEEGKK
TRMB_ASHGO            --------------HPLFDRLG-------DEWLD---------QDPCVRIMRHATEEGKK
TRMB_CANAL            --------------HPLFERLS-------KEWED---------QDKCVEIMYNATEEGQK
TRMB_YARLI            --------------HPLFERLT-------KEEED---------ADPCVATMLVETEEGKK
TRMB_SCHPO            --------------HPLFRRFT-------KEEEE---------NDICVTLMTNETEEGKK
TRMB_CRYNJ            --------------HPLFEYIP-------TETLS---------DDPILEAARTATEEGQK
E3KF66_PUCGT          --------------HPLFKPIA-------VDELIQADPL----EDQLIKAIYNLTEEGKK
F7H363_MACMU          --------------HPLFERVP-------LEDLS---------EDPIVGHLGTSTEEGKK
G3QGD9_GORGO          --------------HPLFERVP-------LEDLS---------EDPIVGHLGTSTEEGKK
H2Q6C5_PANTR          --------------HPLFERVP-------LEDLS---------EDPIVGHLGTSTEEGKK
TRMB_HUMAN            --------------HPLFERVP-------LEDLS---------EDPVVGHLGTSTEEGKK
G1S5U1_NOMLE          --------------HPLFERVP-------LEDLS---------EDPIVGHLGTSTEEGKK
F7G2G6_CALJA          --------------HPLFERVP-------LEDLS---------EDPIVGHLGTSTEEGKK
TRMB_BOVIN            --------------HPLFERVP-------LEELS---------EDPIVGHLGTSTEEGKK
I3LY27_ICTTR          --------------HPLFERVP-------LEELS---------EDPIIRHLGTSTEEGKK
G1P5W4_MYOLU          --------------HPLFERVP-------LEELS---------EDPIVGHLGTSTEEGKK
A0A2I2UJG8_FELCA      --------------HPLFERVP-------LEELT---------EDPIVGHLGTSTEEGKK
H0XB44_OTOGA          --------------HPLFERVS-------LEELS---------EDPIVRHLGTSTEEGKK
TRMB_MOUSE            --------------HPLFERVP-------LEELS---------EDPIVEHLGSSTEEGKK
G1KN86_ANOCA          --------------HPLFEQVP-------LKELS---------SDPIIDLLGTSTEEGKK
TRMB_DANRE            --------------HPLFSRVT-------EEQLA---------DDIIVGHLGTCTEEGKK
TRMBB_XENTR           --------------HPLFSRVT-------EEQLA---------DDIIVGHLGTCTEEGKK
H2MK18_ORYLA          --------------HPLFARVT-------EEELV---------DDLIVSRLGTCTEEGKK
G3N628_GASAC          --------------HPLFTRVL-------DEELV---------GDVIVDRLGTCTEEGKK
I3KSR3_ORENI          --------------HPLFTRVL-------DEELA---------DDVIISRLGTCTEEGKK
H2VDV8_TAKRU          --------------HPLFTRVP-------EEELV---------SDVIISRLGTCTEEGKK
TRMBA_XENTR           --------------HPLFERVA-------KEELV---------NDIVVGKLGTSTEEGKK
TRMB_BOMMO            --------------HPLFESVP-------EEELK---------EDPIIEKLYESTEEGQK
A0A158P479_ATTCE      --------------HSLFEEVT-------KQDLA---------ADPVVEKLYESTEEGKK
C3ZAN8_BRAFL          --------------HPLFQQMT-------AEEYK---------DDLIVEKLYESTEEGQK
E9FWC0_DAPPU          --------------HPLFKRLT-------QEELD---------QDIVVPKLYESTEEGKK
A0A1X7VDJ5_AMPQE      --------------HPLFERG----------EGD---------ADPILALLDTCTEEGKK
TRMB_AEDAE            --------------HPAFERLT-------DDEVK---------ADVLSEKLLDSSEEGKK
TRMB_ANOGA            --------------HPCFKRLP-------DTEAQ---------EDILAPKLLDSSEEGQK
TRMB_DROME            --------------HPLYERLT-------EEEAN---------ADPITPKLYQSSEEGAK
TRMB_DROPS            --------------HPLYERLD-------EEEAN---------TDPITPKLYQSSEEGAK
TRMB_CAEBR            --------------HPLFERLS-------DDEMK---------ADPVVAMLYESTEEGQK
TRMB_CAEEL            --------------HPLFERLT-------EEEMK---------KDPIVEMLFESTEEGQK
A0A2H2I691_CAEJA      --------------HPLFVRLT-------DEELK---------ADPVVGMLYESTEEGQK
G4VRR7_SCHMA          --------------HPLFRPVCHV-----HLSPA---------DPVLKLLEQGCTEEAHK
A0A0D1DS41_USTMA      --------------HPLFKRLDPH-----QDKLK---------HDICVNAVFTATEEGKK
H2XYT3_CIOIN          --------------HPLFDRVD-------DHELK---------DDACYKAMFVSTEEGKK
H2YSN6_CIOSA          --------------HPLFERVS-------ESDLS---------DDVCYKAMFVSTEEGRK
B5Y3J6_PHATC          --------------HPLFRRVE-------DEIAE---------IDPCVQAMKIETEESKK
H3G8D5_PHYRM          --------------HPCFTRIP-------DCELE---------SDPCVKAMTEETEEGKK
A0A086QP12_TOXGO      --------------HPLFEEVP-------LADLK---------DDPCIAAIESDTEEGMK
C4LUV8_ENTHI          --------------QPLLERMP--------DDYT----------DDYLNIVMFKTEEAKK
C4V6P8_NOSCE          --------------SGLFKEIE------DPEDIY-------------FERTLKETDEALR
B7XJS7_ENTBH          --------------SNSFIENDQAYEKINDNIIYN--------NNDLFELTYKGTNEASR
Q8SU19_ENCCU          --------------HGAFRALS-------ENEVDG--------D-ELFHMISRDTDEALR
                                                                            ::   :

V5B8T4_TRYCR          TARKGLQKHYAVYVRL----------------------------------------
Q38E77_TRYB2          TTRKGLQKHYAVHVRVP---------------------------------------
E9AFZ6_LEIMA          TARKGLQKHFAVHMRI----------------------------------------
A4IC41_LEIIN          TARKGLQKHFAVHMRI----------------------------------------
A4HNI5_LEIBR          TARKGLQKYFAVHMRI----------------------------------------
A8B2F8_GIAIC          MRKDADKTVYKAVFRCTKPHCM----------------------------------
Q8II90_PLAF7          VKKNKQNMYYCVAQKI----------------------------------------
A0A077XAW6_PLABA      VKTQNKNMYFCVAQKI----------------------------------------
B3L580_PLAKH          VRRNQQAMYFCVARKV----------------------------------------
A5K4T3_PLAVS          VSKNKQAMYFCVARKE----------------------------------------
Q4N8T7_THEPA          NHKLQSTTYKNSGNSKSLSDLRW---------------------------------
A2DE67_TRIVA          VSENGGQKFACVFERIPL--------------------------------------
A2ESN8_TRIVA          VTENGGQKFACVFERIPL--------------------------------------
A0D558_PARTE          VERNKGSKFIIVCEKV----------------------------------------
A0DHK5_PARTE          VERNKGSKFIIVCEKV----------------------------------------
Q23MB9_TETTS          VTRNGGKKWTCVFERV----------------------------------------
K7KTS8_SOYBN          VARNGGQTFQAIFRRIVPSDQAS---------------------------------
I1JUQ6_SOYBN          VARNEGQTFQAVFRRIVPSDQAS---------------------------------
F6H3C1_VITVI          VARNGGQTFQAVYRRIAPSL------------------------------------
B9N6B6_POPTR          VARNGGQTFQAVYRRIAPSL------------------------------------
B9NA13_POPTR          VARNGGQTFQAVYRRIALSL------------------------------------
K4B7J7_SOLLC          VARNGGQTFRAVFRRIVTH-------------------------------------
M1AP22_SOLTU          VARNGGQTFRAVFRRIAIH-------------------------------------
TRMB_ARATH            VARNGGQTFRAVFRRIAYVS------------------------------------
TRMB_ORYSJ            VARNGGQTFQAIFRRISLQE------------------------------------
I1Q118_ORYGL          VARNGGQTFQAIFRRISLQE------------------------------------
I1GZG0_BRADI          VARNGGQTFQAIFRRISLQEE-----------------------------------
C5XTR1_SORBI          VARNGGQTFHAIFRRISLKEE-----------------------------------
M0TJ33_MUSAM          VARNGGQTFRAVYRRIKLEEE-----------------------------------
A9TAW8_PHYPA          VERNGGSTYKAIYRRIAGLGNIGA--------------------------------
TRMB_DICDI            VNRIDGKKWFAVFRRITDPSKKDLTFKNYTLTSPKEIDSTTTTTTSTATITEVESK
F0ZDF3_DICPU          VNRIDGKKWYAVFRRIEDPAKKDHSFKNYILTSPPE--------------------
D3BLE5_POLPP          VNRIDGKKWYGVFRRIEAPTSNNTSQ------------------------------
TRMB_NEUCR            VTRHNGQKHVALFRRLEDPQWPEDVSA-----------------------------
A7F9Z4_SCLS1          VTRNNGPKFVALFKRLEDPPW-----------------------------------
TRMB_PHANO            VSRNGGMKYVACFRRVEDPEWP----------------------------------
W7M2L8_GIBM7          VTRNNGQKFVALFRRLEDPPW-----------------------------------
TRMB_ASPFU            VARNKGNKYVAVFRRKTDPEWPA---------------------------------
C8V3V0_EMENI          VARNGGNKYVAVFRRKSNPEWV----------------------------------
A0A0E1RW79_COCIM      VTRNGGQKFVAVWRRKEDPEWTP---------------------------------
C0NMT1_AJECG          VTRNNGKKYVAVWRRMEDPQWP----------------------------------
D5GH96_TUBMM          VERNGGRKFVACWRRREDPEWVE---------------------------------
TRMB_YEAST            VERKKGDKFVACFTRLPTPAIL----------------------------------
TRMB_ASHGO            VARKQGDKFVACFRRLPNPELV----------------------------------
TRMB_CANAL            VTRNKGSKWVACYKRLPSPDDCE---------------------------------
TRMB_YARLI            VARNEGDKFVACFRRKENPEW-----------------------------------
TRMB_SCHPO            VARNGGKKFVACYERIPNPK------------------------------------
TRMB_CRYNJ            VERNKGDKWVACFRRKEDPKEEDED-------------------------------
E3KF66_PUCGT          VARNKGDKFLAIFRRISQEEEDALLLS-----------------------------
F7H363_MACMU          VLRNGGKNFPAIFRRIQDPVLQAVTPQTSLPGH-----------------------
G3QGD9_GORGO          VLRNGGKNFPAIFRRIQDPVLQAVTPQTSLPGH-----------------------
H2Q6C5_PANTR          VLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH-----------------------
TRMB_HUMAN            VLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH-----------------------
G1S5U1_NOMLE          VLRNGGKNFPAIFRRIQDPVLQAVTPQTSLPGH-----------------------
F7G2G6_CALJA          VLRNGGKNFPAIFRRIQDPILQAVNPQSSLPGH-----------------------
TRMB_BOVIN            VLRNGGKNFPAIFRRIQDPALPAVTPTPTPPGH-----------------------
I3LY27_ICTTR          VLRNGGKNFPAIFRRIQDPAL-----------------------------------
G1P5W4_MYOLU          VLRNGGKNFPAIFRRIQDPTLQVVTPNPTPPGH-----------------------
A0A2I2UJG8_FELCA      VLRNGGKNFPAIFRRIQDPTLQAVTPNPPSLGH-----------------------
H0XB44_OTOGA          VLRNGGKNFPAIFRRIQDPVLQTVSPSPTLPGH-----------------------
TRMB_MOUSE            VLRNGGKNFPAVFRRIQDPLLQAVTPNPTLP-------------------------
G1KN86_ANOCA          VQRNGGKTFPAVFRRISDTTQEVAAT------------------------------
TRMB_DANRE            VQRNGGKNFLAVFRRVEDPQT-----------------------------------
TRMBB_XENTR           VQRNGGKNFLAVFRRVEDPQT-----------------------------------
H2MK18_ORYLA          VQRNGGKNFLAVFRRIDDSP------------------------------------
G3N628_GASAC          VQRNGGKNFLAVFRRIEDSNSHLTKDKKE---------------------------
I3KSR3_ORENI          VQRNGGKNFLAVFRRIEDSHE-----------------------------------
H2VDV8_TAKRU          VQRNGGKNFLAVFRRVEETSLQQMDSLVAFPAT-----------------------
TRMBA_XENTR           VQRNKGLNLLAVFRRIENSTFIQRDSQQ----------------------------
TRMB_BOMMO            VTRNNGEKFLAVFRRIADKTKTN---------------------------------
A0A158P479_ATTCE      VTRNEGDKFLAVFRRIADPYIATNS-------------------------------
C3ZAN8_BRAFL          VTRNKGDKFLAIFRRIKDPLLPN---------------------------------
E9FWC0_DAPPU          VTRNSGDKFLAVFRRIPDPFVLEENKC-----------------------------
A0A1X7VDJ5_AMPQE      VARNGGMVYKSVYRRVHDPYNIERDAPATR--------------------------
TRMB_AEDAE            VTRNKGDKFVAIFRKI----------------------------------------
TRMB_ANOGA            VTRMSGEKFMAIFTRL----------------------------------------
TRMB_DROME            VVRNKGDHFLAIFRRL----------------------------------------
TRMB_DROPS            VVRNKGDHFLAIFRRL----------------------------------------
TRMB_CAEBR            VTRNDGEKWPAVFRRLPNPPL-----------------------------------
TRMB_CAEEL            VTRNDGGKWPAIFRRLPNPAL-----------------------------------
A0A2H2I691_CAEJA      VTRNDGEKWPAVFRRLPNPPL-----------------------------------
G4VRR7_SCHMA          ACREGRETFLIVYERIPNP-------------------------------------
A0A0D1DS41_USTMA      VERNRGDKWFSAFERLPDPQEHD---------------------------------
H2XYT3_CIOIN          VARNNGEKYPAVFRRNDFGFAGKSS-------------------------------
H2YSN6_CIOSA          VTRNSGDKYPAVFRRNDFGFSAKAS-------------------------------
B5Y3J6_PHATC          VARAGGEKYYAVFERISIDQATEITSTNFFH-------------------------
H3G8D5_PHYRM          VARGGGKKYVAVFRRKANE---DVAVDNLFW-------------------------
A0A086QP12_TOXGO      VKRMGQPCYTCVFRRKSDL-----PVD-----------------------------
C4LUV8_ENTHI          VDREQRQKWGACYRRRIEEPF-----------------------------------
C4V6P8_NOSCE          AGIKTGQIFACIFEKIN---------------------------------------
B7XJS7_ENTBH          AGVKTGEVYASIFSKIK---------------------------------------
Q8SU19_ENCCU          AGAKAGKVFSKVFEIKKDWHYSFHLRLQRSIGQSSSF-------------------