CLUSTAL format seed alignment for MF_03059

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RRF2M_ASPFN       ---------------------------MVAAPLLRAHQAA------RLQSVSTSRLGLNP
RRF2M_ASPNC       ---------------------------MVTALFLRASHQTVRPTGLRQCQAAASRLGCNA
RRF2M_EMENI       ---------------------------MVSALLLRARQNG--RAARCLDYPKVKCWALAS
RRF2M_TALMQ       ---------------------------MVTAPLLGWVAVRPIPRLSKLNTCKYVSSSLQS
RRF2M_TALSN       ---------------------------MVSAPLLGWAAIRPIP-VSRLKTCKYASNSLQS
G2Y660_BOTF4      ------------------------------------------------------------
RRF2M_YARLI       ------------------------------------------------------------
RRF2M_ASHGO       ---------------------MPWCNTRLRTCGASPKIFLRRVRCPVLLHNWTIGRV---
RRF2M_KLULA       ------------------------------------------------------------
RRF2M_VANPO       ------------------------------------------------------------
RRF2M_YEAST       ---------------------------------------MWKWNVRRWAGARVNISK---
RRF2M_YEAS1       ---------------------------------------MWKWNVRRWAGARVNISK---
RRF2M_YEAS7       ---------------------------------------MWKWSVRRWAGARVNISK---
RRF2M_CANGA       ------------------------------------------------------------
RRF2M_CANAL       --------------------------------------MFCRKYV---------------
RRF2M_CANDC       --------------------------------------MFCRKYA---------------
RRF2M_LODEL       --------------------------------------MIVRNLLGKNRLCCLQPKLLLS
RRF2M_DEBHA       --------------------------------MTNTGPIVRRVFRYASVLDTICYK----
RRF2M_PICST       --------------------------------------MIIATSLRSQTFCTWRAW----
RRF2M_PICGU       -------------------------------------MFSINARTKVPIWVPFIAR----
F4P6Y6_BATDJ      MVVYLIKASTMHCSPFKVCALQSWLITRISSKSLSSVSCLAHTSTPWKTARSYPSEFSRP
RRF2M_SCHPO       ------------------------------------------------------------
RRF2M_HUMAN       ----------------------MLTNLRIFAMSHQTIPSV-YINNICCYKIRASLKRLKP
RRF2M_PONAB       ----------------------MLTNLRIFAMSHQTIPSV-CINNICCYKIRASLKRLKP
RRF2M_BOVIN       -----------------------MSNLRIFAVNQKKISSLHYFNNMCSSKIRASLKRLKL
RRF2M_MOUSE       ----------------------MFTKWRIFAVNHQRTFSV-HLNTMCYCKIKANLKRLKT
RRF2M_RAT         ----------------------MFTNWRIFAVNRQKTFSV-HIHTTCYCKIKANLKRSKT
RRF2M_DANRE       -----------------------MLLSLTFPVLRGCTGHL----------VNRSLQAPRW
RRF2M_ANOGA       -------------------------------------------------MLCNRLHKAAF
RRF2M_CULQU       ----------------------------------------------MLLLLCNR-SVVPR
RRF2M_DROME       ------------------------------------------------MLKYAWQSGPKQ
RRF2M_DROYA       ------------------------------------------------MLRCAWQNGPRQ
RRF2M_DROER       ------------------------------------------------MLKCAWQNGPRQ
RRF2M_DROAN       ------------------------------------------------MLKYEFLHGLQK
RRF2M_DROPE       ------------------------------------------------MLKYALHSGGMP
RRF2M_DROPS       ------------------------------------------------MLKYALHSGGMP
RRF2M_DROWI       ------------------------------------------------MLRYVYFNGFGM
RRF2M_DROGR       ------------------------------------------------MLQYCLL----R
                                                                              

RRF2M_ASPFN       HVIKSAGRLQLLRGSSFSTATSKWQAGV-LDRTRNIGIIAHIDAGKTTTTERMLYYSGFT
RRF2M_ASPNC       SLIPGVKKGQFPKIQMLSTSASKLQADT-LDRTRNIGIIAHIDAGKTTTTERMLYYSGFT
RRF2M_EMENI       LPKSSLEKPGFSQVRRFSVFHPQSQVN--LDLTRNIGIIAHIDAGKTTTTERMLYYSGLT
RRF2M_TALMQ       YKRSVGSCLGKQQSRDFSYSATLTDAGINLEKTRNIGIIAHIDAGKTTTTERMLYYSGFT
RRF2M_TALSN       YNGIVASYLRLHYYRSLSSSAVLAEAIVHLEKTRNIGIIAHIDAGKTTTTERMLYYSGFT
G2Y660_BOTF4      ----MAKPSQLNAFIRYSSQQTESHDTL-TETTRNIGIIAHIDAGKTTTTERMLYYSGYT
RRF2M_YARLI       -----------MASRHYSAKNT-------TKKIRNIGIIAHIDAGKTTTTERILYLSGTI
RRF2M_ASHGO       ----------SSVSKMILRFLRSYSKRVDITRVRNIGIIAHIDAGKTTTTERMLYYSGKI
RRF2M_KLULA       ----------MQHTMSFRIFLRRYATKHDLSKVRNIGIIAHIDAGKTTTTERMLYYSGKI
RRF2M_VANPO       ------------MFGFGIRQLRGYASKTDLSKIRNIGIIAHIDAGKTTTTERMLYYSGKT
RRF2M_YEAST       ----------NRLSVINVGSRYLSTARSPLSKVRNIGIIAHIDAGKTTTTERMLYYAGIS
RRF2M_YEAS1       ----------NRLSVINVGSRYLSTARSPLSKVRNIGIIAHIDAGKTTTTERMLYYAGIS
RRF2M_YEAS7       ----------NRLSVINVGSRYLSTARSPLSKVRNIGIIAHIDAGKTTTTERMLYYAGIS
RRF2M_CANGA       ----------MLRFVCGRFQSGIRRYATTIDRFRNIGIIAHIDAGKTTTTERMLYCAGKI
RRF2M_CANAL       -----------FQTWKQLSRSYSTVNSIGAAKTRNIGIIAHIDAGKTTTTERMIYYSGRT
RRF2M_CANDC       -----------FQTWKQFSRFYSAVNNIRASKTRNIGIIAHIDAGKTTTTERMIYYSGKI
RRF2M_LODEL       TLSQRPQLQLSLQLLCRATRLYATVNDIALPKTRNIGIIAHIDAGKTTTTERMIYYSGKS
RRF2M_DEBHA       ----------RGIHSSRALLSESRLNSVPPDRTRNIGIIAHIDAGKTTTTERMLFYSGKT
RRF2M_PICST       ----------RAVHSTAVRL-ESKLNEVPIDRTRNIGIIAHIDAGKTTTTERMLYYSGKT
RRF2M_PICGU       ----------KGFSMSTRQLAEPKLNQVSSLNTRNIGIIAHIDAGKTTTTERMLFYSGKT
F4P6Y6_BATDJ      CPTRIHLKNTNSCLFSASAHSQHSSATIDPQFIRNLGIIAHIDAGKTTTTERMLYYVGYT
RRF2M_SCHPO       -----MLRIVWKPLKIRLPVWRRYQSNISINSIRNVGIIAHIDAGKTTLTEKMLYYGGFT
RRF2M_HUMAN       HVPLGRNCSSLPGLIGNDIKSLHSIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYT
RRF2M_PONAB       HVPLGRNCSSLPGLIGNDIKSLHSIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYT
RRF2M_BOVIN       HVLLGRNYSSLPGLIGNDIKSLHSIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYT
RRF2M_MOUSE       QLPLTRNYSSAPGIAGSDVKSLHSVINPPVAKIRNIGIMAHIDAGKTTTTERILYYSGYT
RRF2M_RAT         QVPLTRSYSSPPGIVGNEVKSLHSIINPPVAKIRNIGIMAHIDAGKTTTTERILYYSGYT
RRF2M_DANRE       RVTWKRSYS----LLQDEVKSLRTVVNPDISKIRNIGIMAHIDAGKTTTTERMLYYSGYT
RRF2M_ANOGA       AARLRPRLPATVASCRQVHN---SDGTISEKRIRNIGILAHIDAGKTTTTERMLYYSGRT
RRF2M_CULQU       GIRRILRTAATVTSLRWNHTGPSASETLLEKNIRNIGILAHIDGGKTTTTERMLFYAGKT
RRF2M_DROME       SNRWLWHLSNQIWKRSYSSK------------IRNIGILAHIDAGKTTTTERMLFYAGKT
RRF2M_DROYA       SNRWLRHLSNQIWKRSYSSK------------IRNIGILAHIDAGKTTTTERMLFYAGKT
RRF2M_DROER       SNRWLWQLSNQIWKRSYSSK------------IRNIGILAHIDAGKTTTTERMLFYAGKT
RRF2M_DROAN       RSHYLRQLSGQFFSRSYSSK------------IRNIGILAHIDAGKTTTTERMLFYAGKT
RRF2M_DROPE       RNRLLRQLSAYIFRRSYSSN------------IRNIGILAHIDAGKTTTTERMLFYSGKT
RRF2M_DROPS       RNRLLRQLSAHIFRRSYSSN------------IRNIGILAHIDAGKTTTTERMLFYSGKT
RRF2M_DROWI       RQGLLKRCSSHILRRSYSSD------------IRNIGILAHIDAGKTTTTERMLFYAGKT
RRF2M_DROGR       RYRFLLRQHAQVIKRCYSGD------------IRNIGILAHIDAGKTTTTERMLFYAGKT
                                                   **:**:****.**** **::::  *  

RRF2M_ASPFN       RRIGDVDEGSTVTDFLPAERARGITIQSAAITFHWPPQTAGDGNTTP-----QEPQTPRS
RRF2M_ASPNC       RRIGDVDEGSTVTDFLPAERARGITIQSAAITFHWPPQAA--------------------
RRF2M_EMENI       RRIGDVDEGSTVTDFLPAERARGITIQSAAITFHWPPAECGNATR-------QDPRSPRS
RRF2M_TALMQ       RRIGDVDDGSTVTDFLPAERARGITIQSAAITFHWPPLAADGTSSGPSLEELESQNLPRS
RRF2M_TALSN       RRIGDVDDGSTVTDFLPAERARGITIQSAAITFHWPPLTGDGTSSSPSLEDLEAQNLPRS
G2Y660_BOTF4      RRIGDVDDGSTVTDFLPAERARGITIQSAAVTMHWPPVTEKAASS-------KASDPSRS
RRF2M_YARLI       KHLGNVDEGDTTMDFLPAERERGITIASAATSFNWN------------------------
RRF2M_ASHGO       KRIGDVDHGDTITDFLPQERSRGITIQSAAISFNWRDNYT--------------------
RRF2M_KLULA       NRIGDVDQGDTITDYLPQERSRGITIQSAAISFNWKKDYK--------------------
RRF2M_VANPO       NRIGNVDQGDTVTDYLPQERSRGITIQSAAISFNWQNDHR--------------------
RRF2M_YEAST       KHIGDVDTGDTITDFLEQERSRGITIQSAAISFPWRNTFA--------------------
RRF2M_YEAS1       KHIGDVDTGDTITDFLEQERSRGITIQSAAISFPWRNTFA--------------------
RRF2M_YEAS7       KHIGDVDTGDTITDFLEQERSRGITIQSAAISFPWRNTFA--------------------
RRF2M_CANGA       KRIGDVDSGDTVTDFLPQERDRGITIQSAAISFQWHDSSRDNSPR---------------
RRF2M_CANAL       KRIGNVDEGDTVTDYLPSERERGITIQSAAITLPWNQHK---------------------
RRF2M_CANDC       KRIGNVDEGDTVTDYLPSERERGITIQSAAITLPWNQHK---------------------
RRF2M_LODEL       KRIGNVDEGDTVTDYLQAERERGITIQLAAITIPWNNHK---------------------
RRF2M_DEBHA       RRIGNVDEGDTVTDYLPSERERGITIQSAAITIPWNKNK---------------------
RRF2M_PICST       KRIGNVDEGDTVTDYLPSERQRGITIQSAAISIPWNNHK---------------------
RRF2M_PICGU       TTMGDVDQGDTVTDYLPSERSRGITIQSAAITIPWNNNK---------------------
F4P6Y6_BATDJ      KRLGNVDEGSTVTDYLKTEKERGITIQSACIPLAWKNHR---------------------
RRF2M_SCHPO       SHFGNVDTGDTVMDYLPAERQRGITINSAAISFTWRNQR---------------------
RRF2M_HUMAN       RSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYR---------------------
RRF2M_PONAB       RSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYR---------------------
RRF2M_BOVIN       RSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYR---------------------
RRF2M_MOUSE       RSLGDVDDGDTVTDFMAQERERGITIQSAAVTLDWKGYR---------------------
RRF2M_RAT         RSLGDVDDGDTVTDFMAQERERGITIQSAAVTLDWKGYR---------------------
RRF2M_DANRE       RALGDVDDGDTVTDYMAQERERGITIQSAAVTFDWKDYR---------------------
RRF2M_ANOGA       DMLGEVKLGNTVTDFLQQERERGITICSAAVSFNWKEYR---------------------
RRF2M_CULQU       NVLGEVHHGNTVTDFLVQERERGITICSAAVSFDWRDHR---------------------
RRF2M_DROME       RALGEVHRGNTVTDYLTQERERGITICSSAVTFSWNDHR---------------------
RRF2M_DROYA       RALGEVHRGNTVTDYLTQERERGITICSSAVTFPWNDHR---------------------
RRF2M_DROER       RALGEVHRGNTVTDYLTQERERGITICSSAVTFPWNDHR---------------------
RRF2M_DROAN       RTLGEVHRGNTVTDYLTQERERGITICSSAVTFAWNGHR---------------------
RRF2M_DROPE       RSLGEVHRGNTVTDYLTQERERGITICSSAVTFPWSGNR---------------------
RRF2M_DROPS       RSLGEVHRGNTVTDYLTQERERGITICSSAVTFPWRGNR---------------------
RRF2M_DROWI       RSLGEVHRGNTVTDYLTQERERGITICSSAVTFPWNGKR---------------------
RRF2M_DROGR       RSLGEVHRGNTVTDYLAQERERGITICSSAVTFNWNGKR---------------------
                    :*:*. *.*  *::  *: *****  :. .: *                         

RRF2M_ASPFN       ASSHTVNLIDTPGHADFTFEVMRSLRILDGAVCILDGVAGVEAQTEQVWHQASTYRIPRI
RRF2M_ASPNC       -----VNLIDTPGHADFTFEVMRSLRILDGAVCILDGVAGVEAQTERVWHQASTYRIPRI
RRF2M_EMENI       ASSHMVNLIDTPGHADFTFEVLRSLRILDGAVCILDGVAGVEAQTEQVWHQASTYNIPRI
RRF2M_TALMQ       RASHTVNLIDTPGHADFTFEVLRSLRILDGAVCILDGVAGVEAQTEKVWHQASVYQIPRV
RRF2M_TALSN       RASHTVNLIDTPGHADFTFEVLRSLRILDGAVCILDGVAGVEAQTEKVWHQASVYQIPRI
G2Y660_BOTF4      LISHTLNLIDTPGHADFTFEVLRSLRILDGAVCILDGVAGVEAQTEKVWKQANNYSIPRI
RRF2M_YARLI       --NHTVNLIDTPGHADFTFEVIRSIRVLDGAVCILDGVAGVEAQTEKVWKQASEMGIPKI
RRF2M_ASHGO       -----VNLIDTPGHADFTFEVIRSLRVLDGCVTILDAVAGVEAQTEKVWKQAAEI--PKV
RRF2M_KLULA       -----INLIDTPGHADFTFEVIRSLKVLDSCVTILDSVAGVEAQTEKVWKQSSGL--PKI
RRF2M_VANPO       -----INLIDTPGHVDFTFEVIKSLKVLDGCVTILDAVAGVEAQTEKVWKQSYGI--PKI
RRF2M_YEAST       -----INLIDTPGHIDFTFEVIRALKVIDSCVVILDAVAGVEAQTEKVWKQSKSK--PKI
RRF2M_YEAS1       -----INLIDTPGHIDFTFEVIRALKVIDSCVVILDAVAGVEAQTEKVWKQSKSK--PKI
RRF2M_YEAS7       -----INLIDTPGHIDFTFEVIRALKVIDSCVVILDAVAGVEAQTEKVWKQSKSK--PKI
RRF2M_CANGA       ----VINLIDTPGHADFIFEVIRSLKVLDGAVLILDGVAGVEAQTEKLWRYSRNI--PKI
RRF2M_CANAL       -----INIIDTPGHADFTFEVIRSLRVLDGAVTILDAVAGVEAQTEKVWKQASALNLPKV
RRF2M_CANDC       -----INIIDTPGHADFTFEVIRSLRVLDGAVTILDAVAGVEAQTEKVWKQASSLNLPKI
RRF2M_LODEL       -----INIIDTPGHADFTFEVIRSLRVLDGAVTILDAVAGVEAQTEKVWKQASALKLPRM
RRF2M_DEBHA       -----INIIDTPGHADFTFEVTRSLRVLDSCVTILDAVAGVEAQTEKVWKQAQALGIPKI
RRF2M_PICST       -----INIIDTPGHADFTFEVTRSLRVLDGAVTILDGVAGVEAQTEKVWKQATSLNIPKI
RRF2M_PICGU       -----INIIDTPGHADFTFEVIRSLRVLDGCVTILDAVAGVEAQTEKVWKQAQALKIPRI
F4P6Y6_BATDJ      -----LNLIDTPGHVDFTIEVERSLRVLDGAVCVLDGVAGVEAQTETVWAQSNRYSIPRI
RRF2M_SCHPO       -----INLIDTPGHADFTFEVERSVAVLDGAVAIIDGSAGVEAQTKVVWKQATKRGIPKV
RRF2M_HUMAN       -----VNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRI
RRF2M_PONAB       -----VNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRI
RRF2M_BOVIN       -----INLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHKVPRI
RRF2M_MOUSE       -----VNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHKIPRI
RRF2M_RAT         -----VNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHKIPRI
RRF2M_DANRE       -----INLIDTPGHVDFTLEVERALRVLDGAVAVFDASAGVEAQTMTVWRQAEKHQIPCV
RRF2M_ANOGA       -----INLLDTPGHIDFTMEVEQSLGAVDGTVIILDGSAGVEAQTVTVWGQADRHRLPRL
RRF2M_CULQU       -----VNLLDTPGHIDFTMEVEQSLAAVDGTVVILDGSAGVEAQTVTVWSQADRHRLPRL
RRF2M_DROME       -----INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWSQADKHKLPRL
RRF2M_DROYA       -----INLLDTPGHIDFTMEVEQSLFAVDGVVVVLDGTAGVEAQTVTVWSQADKHKLPRL
RRF2M_DROER       -----INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWSQADKHKLPRL
RRF2M_DROAN       -----INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWTQADKHKLPRL
RRF2M_DROPE       -----INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWTQADKHKLPRL
RRF2M_DROPS       -----INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWTQADKHKLPRL
RRF2M_DROWI       -----INLLDTPGHIDFTMEVEQSLHAVDGVIVVLDATAGVEAQTMTVWSQADKHRLPRL
RRF2M_DROGR       -----INLLDTPGHIDFTMEVEQSLYAVDGVIVVLDGTAGVEAQTVTVWTQADKHKLPRL
                       :*::***** ** :** :.:  :*. : ::*. *******  :*  :     * :

RRF2M_ASPFN       VYVNKLDRDGAAFGRTVREVASRL----GGWPAVCQIPWFE----------GGNGRFTGI
RRF2M_ASPNC       VYINKLDRDGAAFGRTVREISSRL----AGYPAVCQVPWFE----------GGNGRFVGV
RRF2M_EMENI       VYVNKMDRDGAAFGRTVREVASRL----GGWPAVCQIPWFE----------GGDGRFVGV
RRF2M_TALMQ       VYVNKLDRDGAAFGRTVREVGSRL----QGWPAVCQIPWFE----------GGNGRFTGI
RRF2M_TALSN       VYVNKLDRDGAAFGRTVREVGSRL----QGWPAVCQIPWFE----------GSNGRFTGI
G2Y660_BOTF4      AFVNKLDREGAAFARTVKEIASRL----RGWPAVCQIPWWE----------GGKGKFTGV
RRF2M_YARLI       AFVNKMDRAGAGFGRTVKEIVSKL----RTRVALLTVPVFSK---------SSDQVFEGV
RRF2M_ASHGO       CFINKMDRVGAGYSRAVKELIVKL----KTRVLLLNTPLFAAR------DSSADPVFVGV
RRF2M_KLULA       CFLNKMDRVGAGFSRTVKELVVKM----NTRALLINTPIFQVD------PVTNESKFSGV
RRF2M_VANPO       CYINKMDRVGSGYSRTVKELMIKM----NQRVVLANMPLFKLD------PVTNEQVFEGV
RRF2M_YEAST       CFINKMDRMGASFNHTVNDLINKFMRGTTTKPVLVNIPYYRKQ------PTSNDYVFQGV
RRF2M_YEAS1       CFINKMDRMGASFNHTVNDLINKFMRGTTTKPVLVNIPYYRKQ------PTSNDYVFQGV
RRF2M_YEAS7       CFINKMDRMGASFNHTVNDLINKFMRGTTTKPVLVNIPYYRKQ------PTSNDYVFQGV
RRF2M_CANGA       CFVNKMDRVGAGFSKTLKELTYKT----DRRCVVVNFPYFEQT------NQSEDPVFCGV
RRF2M_CANAL       VYVNKMDRPGAGFSRTVQEVIQKL----ETRVVLCNLPYFET-------NKESDLEFKGV
RRF2M_CANDC       VYVNKMDRPGAGFSRTVQEVIQKL----ETRVVLCNLPYFET-------NKESDLEFKGV
RRF2M_LODEL       IYVNKMDRPGAGFSRTVKEVIQKL----ETRVVLCNTPFFE--------NQELNPEFRGV
RRF2M_DEBHA       AYVNKMDRDGAGFSRTVKEIIQKL----QTRVVLCNIPYWET-------PVNDVPIFKGV
RRF2M_PICST       AYVNKMDRPGAGFSRTVMEIIEKL----QTRVVLCNVPYFEN-------SKDNDPVFCGV
RRF2M_PICGU       AFVNKMDRPGAGFSRTVKEVVQKL----QTKVVLCNIPYFEM-------SKDD-AVFVGV
F4P6Y6_BATDJ      AFVNKLDRDGASFKNTVHAMSKRL--GGWGKPAIIQLPIFRNGHGVLVTDSHGGGKLEGI
RRF2M_SCHPO       IFVNKMDRVGSSLGSTIRSIYTNL---DCPYPLVLQLPVYSDGLQ--------ERKFLGI
RRF2M_HUMAN       CFLNKMDKTGASFKYAVESIREKL----KAKPLLLQLPIGEAK------------TFKGV
RRF2M_PONAB       CFLNKMDKTGASFKYAVESIREKL----KAKPLLLQLPIGEAK------------TFKGV
RRF2M_BOVIN       CFLNKMDKIGASFNYAVESIREKL----KAKPLLLQLPIGEGK------------AFKGV
RRF2M_MOUSE       CFLNKMDKTGASFNYAVESIREKL----KAKPLILQLPIGEAR------------TFQGV
RRF2M_RAT         CFLNKMDKTGASFNYAVESIREKL----KAKPLILQLPIGEAR------------TFQGV
RRF2M_DANRE       CFLNKMDKPAASLRYSLDSIKAKL----KANPVLLQIPIGSGK------------SFTGL
RRF2M_ANOGA       VFVNKMDKESADFDACLEDLEKKL----STVPVPLQMPIKEAG------------KLVGV
RRF2M_CULQU       VFVNKMDKESADFEGCLEELEKKL----GVVAVPLQMPVIKEG------------KLTGV
RRF2M_DROME       IFVNKMDRPDADFEKCVSDLKDKL----ETQPVCLQYPVKNED------------GVLAI
RRF2M_DROYA       IFVNKMDRPDADFDKCVADLKDKL----ETQPVCLQYPVKNED------------GVLAI
RRF2M_DROER       IFVNKMDRPDADFVKCVSDLKDKL----ETQPVCLQYPVKNED------------GQLAI
RRF2M_DROAN       IFVNKMDRPDADFEKCIADLKEKL----EAHPVCLQYPVKNED------------GVLAI
RRF2M_DROPE       AFVNKMDRPDADFDKCVNDLRTKL----ETQPVCIQYPSKNQD------------GLLAI
RRF2M_DROPS       AFVNKMDRPDADFDKCVNDLRTKL----ETQPVCIQYPSKNQD------------GLLTI
RRF2M_DROWI       VFVNKMDRPDADFNKCVEDLKSKL----ETFPVCIQYPAKSNE------------GQLGI
RRF2M_DROGR       VFVNKMDRPDANFEKCIVDLTEKL----DAKPICTQYPTKSAD------------GQLGI
                   ::**:*:  :     :  :  .              *                     :

RRF2M_ASPFN       ADAINLQGLRWE--EG-DGKSVKMFNLEQLASEEPQLAQELKRARVALVELLSEHDEAMV
RRF2M_ASPNC       GDAINLQGLRWQ--DG-DGKAVKMFNLQELDGEEPGLAQEIKRARTALVELLSEHDETMI
RRF2M_EMENI       ADAINLQGLLWS--GG-DGKSVKRFSLSELDEAESQLAQELRRARVALVELLSEHDEIIV
RRF2M_TALMQ       ADVISLQGLLWK--EGGDGKSVKVFDLAGLENEDKRLAEELKHARVALVELLSEHDEDMV
RRF2M_TALSN       ADVVSLQGLLWK--EGGDGKSVKVFDLNGLENEDKSLAEELKRARVALVELLSEHDEDMV
G2Y660_BOTF4      GDAVNLCALKWE--EGGDGKSIQHFTLDQLRKDNPEFSEEIIKARAALVEALCEFDDGLL
RRF2M_YARLI       VDILNGCVITWT--TGGDGKQTVVVPVSEASAE---VQEEYQKARTALVETLTELDEELV
RRF2M_ASHGO       LDAVNGQLLEWD-PED--PDKISAKAVDK----ECAHYEELVSAREALVETLSEVDEKLV
RRF2M_KLULA       LDLIYGKQLIWD-TND--PDKINVTDVDE----NHDCYEYLVRGREALVETLGETDESIV
RRF2M_VANPO       LDVVNMKALRWD-STD--VNKVDIADIDKF---DSSLLDELTKAREAMVETLSEFDENLV
RRF2M_YEAST       IDVVNGKRLTWN-PEN--PDEIIVDELDG------TSLEQCNRCRESMIETLTEYDEDLV
RRF2M_YEAS1       IDVVNGKRLTWN-PEN--PDEIIVDELDG------TSLEQCNRCRESMIETLTEYDEDLV
RRF2M_YEAS7       IDVVNGKRLTWN-PEN--PDEIIVDELDG------TSLEQCNRCRESMIETLTEYDEDLV
RRF2M_CANGA       IDVINMKLLKWD-TKANSPDAVTVVDLLEL-NDSDNAKVEAIKSRESMVEILGELDDVFV
RRF2M_CANAL       IDVIHQKLLKWN-ETDANGNEISVVNID---ETTPDLLQILEKSRESMVETLGEYDERII
RRF2M_CANDC       IDVIHQKLLKWN-EMDANGNEISVVDID---KTTPELLQILEKSRESMVETLGEYDERII
RRF2M_LODEL       IDVIHGKLLKWK-EADEFGKEIDVEDID---ETKPELYDVYCKAREYMVETLGEYDESII
RRF2M_DEBHA       LDVLNKKLLKWNSDSNANGTDISVTDLEKEMDKYPELYEMVSKSRESMVETLGEFDETII
RRF2M_PICST       ADILHVKLLKWNPEIDPHGKNITVIDIEAERDTYPEVYETVVKSRESMVETLGEFDEAII
RRF2M_PICGU       IDILHNKILKWNIDEDPNGRDITVIDLQEAKESHQEAYMEALKCRESMVETLGGIEETVV
F4P6Y6_BATDJ      VDLLTMERLDWFKDPS-SGGVVTRSQLTLGEKEWALVYEDAVKYRNMLIETLSEMDDGIV
RRF2M_SCHPO       LDILQQKMILWDTSDNKLGTDGTHVQELPI---PESHMERFIEARNALVMSLCDVDETLC
RRF2M_HUMAN       VDVVMKEKLLWNCN---SNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFA
RRF2M_PONAB       VDVVTKEKLLWNCN---SNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFA
RRF2M_BOVIN       VDVVRTEKLLWNPN---SDDGKDFERKPLLEMSDPKLLKETTEARNALIEQVADLDDEFA
RRF2M_MOUSE       VDVVNKEKLLWNSN---SDDGKDFERMPLSEASDRELLKETIEARNSLIEQVADLDDEFA
RRF2M_RAT         VDVVNREKLIWNSD---SDDGKDFERKPLSEASDPTLLKETVEARNSLIEQVADLDDEFA
RRF2M_DANRE       VDLITRQKMMWQGNAL-TNDGRSFEINSLQPSDDPNVLLAVSEARAALIEQVADLDDDFA
RRF2M_ANOGA       IDVLSASQIIWDSK----GKGRSYKAIPIS---DEQLHDQVQEKLYELIDLLSGMDDNLA
RRF2M_CULQU       VDVLSGAQVVWDKQ----NHGRTYKAIPLV---DQQLVE-AQDKLYQIIDVLSGMDDGLA
RRF2M_DROME       NDVITLERLSWQQK----DLGRSYRNVKLE---PSDDLRLLQEKRNELIDQLSGLDDELA
RRF2M_DROYA       NDVITLERLSWHQK----DLGRSYKNVKLE---PSDDLRQLQEKRSELIDQLSGLDDELA
RRF2M_DROER       NDVIHLERLSWQQK----DLGRSYKNVKLE---PSDDLRQLQEKRNELIDQLSGLDDELA
RRF2M_DROAN       NDVITLERLTWQQK----DLGQKYIRMKLE---PSDELRDLQEKRNELIDRLSGVDDELA
RRF2M_DROPE       NDVITLEQLTWQPK----DLGRSYSKTKLE---PSDDLRQLQEKRNELIDQLSGLDDELA
RRF2M_DROPS       NDVITLEQLTWQPK----DLGRSYSKTKLE---PSDDLRQLQEKRNELIDQLSGLDDELA
RRF2M_DROWI       YDVITLEQLNWQQK----DLGRSYSKLKLE---PSDGLRQLQDKRNELIDQLSGLDDELA
RRF2M_DROGR       FDVITMEQMTWQQN----DLGRNYSKVKLE---SST---ELQEKRNELIDQLSGLDDELA
                   * :    : *                                    ::  :   :: . 

RRF2M_ASPFN       EKFFDC--EEDHLAVPPNDILESLRRCLLEEQGRKIIPIFAGASFRNIGVQPLLDAVTNL
RRF2M_ASPNC       EKFFEH--DEDHLAVPPNDILDSLRRCLLQEQGRKIIPIFAGASFRNIGVQPLLDAVTNL
RRF2M_EMENI       EKFFEN--EEDHLSVSPADILDSLRRCLLEGNGRKIIPIFAGASFRNIGVQPLLDSVVDL
RRF2M_TALMQ       ESFFEH--E-DHLKVPPMTILKSLRKCLLGPEAQKIIPVFAGSSFRNMGVQPLLDAVNNL
RRF2M_TALSN       ESFFEH--EEDHLTVPSITILKSLRKCLLGPETQKIIPVFAGSSFRNMGVQPLLDAVNNL
G2Y660_BOTF4      ETWLEC--NDDSLLISSADITKSLRKCVLDGSG-KLIPVFAGASFRNIGVQPLLDAINNL
RRF2M_YARLI       EKFLES--E-DYMQITTEDIKRALRTATI---NNDIVPVLCGASFRNIGVQPLMDAVVDF
RRF2M_ASHGO       EYFLGE-ADGDYMKVPVEVLNESIRRATL---SQYAVPVLCGASFKNIGVQPLLDAVVDY
RRF2M_KLULA       EHFFND-ADGEYLNVSPEVLNASIRKATI---SLSATPVLCGASFRNIGVQPLLDAIANY
RRF2M_VANPO       EHFLED-AEGDYLKVSPTILNSSIRKSTL---SQDITPILCGSSFRNIGVQPLLDAVVNY
RRF2M_YEAST       QHFLEE-AEGDYSKVSAQFLNASIRKLTM---KNMIVPVLCGASFKNIGVQPLLDAIVNY
RRF2M_YEAS1       QHFLEE-AEGDYSKVSAQFLNASIRKLTM---KNMIVPVLCGASFKNIGVQPLLDAIVNY
RRF2M_YEAS7       QHFLEE-AEGDYSKVSAQFLNASIRKLTM---KNMIVPVLCGASFKNIGVQPLLDAIVNY
RRF2M_CANGA       QEFFDGPSEGNSLKVSAQVLNKSIRKLTI---ANELTPVLAGASFKNVGIQPLLDGIIQY
RRF2M_CANAL       DSFLEH--DENYLKIPPMLLDQVIRKATI---DNYLTPVFCGASFRNIGVQPLMDGITKY
RRF2M_CANDC       DSFLEH--DENYLKIPPILLDQVIRKATI---DNYLTPVFCGASFRNIGVQPLMDGITKY
RRF2M_LODEL       DAFLEN--DENYLKISPELLNRAIRKATI---DNYLVPVFCGASFRNIGVQPLMDGITNY
RRF2M_DEBHA       DSFLEN--DEDYMKIPVAVLNSAIKRGTL---ANYVTPVFCGSSFRNIGVQPLMDAVVNF
RRF2M_PICST       DSFLES--NEDYMNIPINVLNEAIRKATL---ENYLTPVYCGSSFRNIGVQPLMDGVVKY
RRF2M_PICGU       DAFLEC--DEDYMKIPSSILKSAIRKACI---SNQVTPVFCGSAFRKIAVQPLLDGVVDY
F4P6Y6_BATDJ      NVFLEC--DGDHAQVPAKEIQNACRRATI---SGQAVPVLCGASFRNIGVQPILDAIVNY
RRF2M_SCHPO       DEYLEN---EDSLAFTNDRLFKIIKQKTI---SGNVVPVLCGSSLKNIAVQPIMDAIIDY
RRF2M_HUMAN       DLVLEE-FSENFDLLPAEKLQTAIHRVTL---AQTAVPVLCGSALKNKGIQPLLDAVTMY
RRF2M_PONAB       DLVLEE-FSENFDLLPAEKLQTAIHRVTL---AQTAVPVLCGSALKNKGIQPLLDAVTMY
RRF2M_BOVIN       DLVLGE-FSENFDLLPAEKLQTAIHRVTL---AQTAVPVLCGSALKNKGVQPLLDAITMY
RRF2M_MOUSE       DLVLGE-FSENFDLVPAEKLQAAVHRVTL---AQAAVPVLCGSALKNKGVQPLLDAVTTY
RRF2M_RAT         DLVLGE-FSEDFDLVPAEKLQAAIHRVTL---AQAAVPVLCGSALKNKGVQPLLDAVTTY
RRF2M_DANRE       ELLLGE-YGENFDAVPAVKLQEAVRRVTL---ARKGVPVLCGSSLKNKGVQPLLDAITAY
RRF2M_ANOGA       QAIIE---ANSLENVKLNLVLDALRNCTL---KQQIVPVLLGSSYKNVGVQLLMDSVLNF
RRF2M_CULQU       QVIIE---SDSMDNVKPELVASAIRACTM---KQQIVPVFLGSAYKNIGVQLLMDAVLKY
RRF2M_DROME       DVVIS---TESFDNVDNALIERALRRATT---QQKVVPVLLGSAYKNVGIQRLMDAVNAY
RRF2M_DROYA       DVVIS---TESFDKVDNALIERALRRATT---QQKVVPVLLGSAYKNVGIQRLMDAVNSY
RRF2M_DROER       DVVIS---TESFDKVDNALIERALRRATT---QQKVVPVLLGSAYKNVGIQRLMDAVNSY
RRF2M_DROAN       DVVIS---TESFDKVDNHLIERALRRATG---QLKVVPVLLGSAYKNVGIQRLMDAVNSY
RRF2M_DROPE       DVVIS---TESFDNVSNALIERALRRATC---QQKVVPVLLGSAYKNVGIQRLMDAVNTY
RRF2M_DROPS       DVVIS---TESFDNVSNALIERALRRATC---QQKVVPVLLGSAYKNVGIQRLMDAVNTY
RRF2M_DROWI       DVVIS---TESFDKVSNELVNKALRRVIC---QQKAVPVLLGSAYKNIGIQCLMDAVNHY
RRF2M_DROGR       DVVIS---TESFDKVSNELIGQALRRATC---QQKVVPVLLGSAYKNIGIQPLMDAVNAY
                  :  :      .   .    :    :            *:  *:: :: .:* ::*.:   

RRF2M_ASPFN       LPSPPETPEPEVSIGGVKGGLRRLLSGDLLVEQGEKAASA-KGKHKKKSAIQAES---RN
RRF2M_ASPNC       LPSPLETPDAE-----------------------------------KKSVTQAES---QN
RRF2M_EMENI       LPSPQETPDPEVAIGGVKGSLRRLLSGDLLVEQKEKAAP--KGKQKKKAAVVADS---RN
RRF2M_TALMQ       LPGPSESVDPEISLGNSKGSLGNLLSGELTLQQEPKTANIAKPKQKKKTAVAPTSVDTKH
RRF2M_TALSN       LPGPSESHDPEISLGSDKTSLGNLLSGELALQQDPKTASIEKSKQKKKAVVTRTSVDIKS
G2Y660_BOTF4      LPNPTERPEPEVRLGNVHGSLSQLLDGKLDLSAA------------QPRHLSKKSNARTS
RRF2M_YARLI       LPSPAERPPTDALIAKSYTG-------------------------GKKSKVIPERAITLD
RRF2M_ASHGO       LPSPAEARLPELSNKDLPVQHH----------------------LKNGLLVNKNA-----
RRF2M_KLULA       LPSPSEARPPELNHKNVPITQN----------------------PLTGLVLNKNP-----
RRF2M_VANPO       LPSPLEAKFPEL-NEDIPISYD----------------------KRKGLLFDNNS-----
RRF2M_YEAST       LPSPIEAELPELNDKTVPMKYD----------------------PKVGCLVNNNK-----
RRF2M_YEAS1       LPSPIEAELPELNDKTVPMKYD----------------------PKVGCLVNNNK-----
RRF2M_YEAS7       LPSPIEAELPELNDKTVPMKYD----------------------PKVGCLVNNNK-----
RRF2M_CANGA       LPSPLEARLPEVNPKDIPVVHD----------------------PKVGALINKQN-----
RRF2M_CANAL       LPSPLETSLPQITKNGKDVTKKVDGE--------------------KGLVVANDN-----
RRF2M_CANDC       LPSPLETSLPEITKNGKEVPKKADDE--------------------KGLVVANDN-----
RRF2M_LODEL       LPSPLETPVPDIKSKKKQEISAKMAN--------------------NGLIINNDP-----
RRF2M_DEBHA       LPSPLETKVPDISSNAPKALAKMKGKNRKKKVTSEPTDVPLSMDPKHGLVINKNP-----
RRF2M_PICST       LPSPLQISVPEITSSATKNVKIKHVK--AKQAVKQDMEVTTKMNNRTGLVVNANP-----
RRF2M_PICGU       LPSPLQTPVPEITASTSKVSKKQKQK-----KNSKVSSVPIEMNPKKGLIVNKNP-----
F4P6Y6_BATDJ      LPSPMDAPSAIATLSNGS----------------------------QQHILLKDP-----
RRF2M_SCHPO       LPSPVEFYEKNASKETSS-----------------------------DKIISLDK-----
RRF2M_HUMAN       LPSPEERNYEFL------------------------------------------------
RRF2M_PONAB       LPSPEECNCEFL------------------------------------------------
RRF2M_BOVIN       LPSPEERNYEFL------------------------------------------------
RRF2M_MOUSE       LPSPEEREDRFL------------------------------------------------
RRF2M_RAT         LPSPEEREHGFL------------------------------------------------
RRF2M_DANRE       LPAPNERNHDLV------------------------------------------------
RRF2M_ANOGA       LPAPSERNQIYDLTNSQARIEGDFIN---------------------------------V
RRF2M_CULQU       LPAPNERNEIYN------------------------------------------------
RRF2M_DROME       LPAPEERNQIYD------------------------------------------------
RRF2M_DROYA       LPAPEERNQIYD------------------------------------------------
RRF2M_DROER       LPAPEERNQIYD------------------------------------------------
RRF2M_DROAN       LPAPEERNQIYD------------------------------------------------
RRF2M_DROPE       LPAPEERNQIYD------------------------------------------------
RRF2M_DROPS       LPAPEERNQIYD------------------------------------------------
RRF2M_DROWI       LPAPEERNEIYN------------------------------------------------
RRF2M_DROGR       LPMPEERNQMYD------------------------------------------------
                  ** * :                                                      

RRF2M_ASPFN       AIEKLQGCALAFKVVNDPKRGVLVYVRVYSGSLDR---------NSILYNTNLNVSERAP
RRF2M_ASPNC       AIEKLQSCALAFKVVNDAKRGVLVYVRVYSGSLDR---------NSAIFNTNLKITERAP
RRF2M_EMENI       AIKQLHGCGLAFKVVNDAKRGVLVYVRVYSGSLDR---------GSLLYNTNLNVSERAP
RRF2M_TALMQ       LAANLESCALAFKVVSDAKRGVLVYVRVYSGTLNK---------GCQLYNTNLHVTERAP
RRF2M_TALSN       LTANLESCALAFKVVSDAKRGVLVYVRVYSGSLNR---------NCHLYNTNLHVTERAP
G2Y660_BOTF4      LISQVEACALAFKVVNDARRGVLVYIRVYSGTVKR---------NTTLWNTNLHVSERAQ
RRF2M_YARLI       DSMKNLCCALCFKVVQDPQKGTLVYVRVYKGELKQ---------NSVLYNTTSGTKDRVS
RRF2M_ASHGO       ----NLCLALAFKVTTDPIRGAMVFIRVYSGVLNS---------GHTVYNSSTGVKFKLG
RRF2M_KLULA       ----NLCVALAFKVITDAIRGTMIFIRVYSGVLRS---------NHTVYNTTTGTKFKIG
RRF2M_VANPO       ----EICVAFAFKVITDEIRGQLVFVRVYSGTLKN---------GHSVYNSTNGKTFKIN
RRF2M_YEAST       ----NLCIALAFKVITDPIRGKQIFIRIYSGTLNS---------GNTVYNSTTGEKFKLG
RRF2M_YEAS1       ----NLCIALAFKVITDPIRGKQIFIRIYSGTLNS---------GNTVYNSTTGEKFKLG
RRF2M_YEAS7       ----NLCIALAFKVITDPIRGKQIFIRIYSGTLNS---------GNTVYNSTTGEKFKLG
RRF2M_CANGA       ----NLCVALAFKVTHDQIRGLMVFVRIYSGVLNS---------GNTVMNTTTGEKFRIG
RRF2M_CANAL       ----NLTLALAFKVMTHSTRGPMTFVRVYSGKLNA---------ASNLINTRTGKKLLIR
RRF2M_CANDC       ----NLTLALAFKVMTHSTRGPMTFVRVYSGKLNA---------ASNLINTRTGKKLLIR
RRF2M_LODEL       ----KLTVGLVFKVMNHATRGPMAFVRIYSGKLVA---------NSMVVNSRTGAKHSVR
RRF2M_DEBHA       ----NLTTALAFKVITHPTRGVMTFFRVYSGKLTS---------NTTIMNTRTGKKLNLR
RRF2M_PICST       ----NLTLALAFKVMTHATRGVMTFFRVYSGKLVS---------NSIITNTTTGKKLHVK
RRF2M_PICGU       ----QLTVALAFKVMTHATRGVMTFFRVYSGSLTS---------NTTVVNTRTGKKLHLN
F4P6Y6_BATDJ      -----NMTALAFKVVHDSSRGPLVYVRVYSGTLESRSILHIAGSSTGIGRDCKPIKERAT
RRF2M_SCHPO       ----RPLLAKIFKVIHHASRGILTYVRVNEGTLSR---------GMMMFNPRTKKSERAI
RRF2M_HUMAN       QWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKP---------QLAIHNINGNCTERIS
RRF2M_PONAB       QWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKP---------QLAIHNINGNCTERIS
RRF2M_BOVIN       QWYKGDLCALAFKVLHDKQRGPLVFMRIYSGMLKP---------QTAIHNINGNCTERVS
RRF2M_MOUSE       QWYEGDLCALAFKVLHDKQRGPLVFLRIYSGTLTP---------QLAVHNINRNCTERMS
RRF2M_RAT         QWYKGDLCALAFKVLHDKQRGPLVFLRIYSGTLTP---------QSAVHNVNRNCTERMS
RRF2M_DANRE       RWYKNDLCALAFKVVHDKQRGPLVFVRIYSGSMKA---------QSSVHNINRNETEKMS
RRF2M_ANOGA       STFRNDFVGKVFKVTHDKQRGPITMIRAFRGTVKK---------GSKFITA-TGGSETIQ
RRF2M_CULQU       -CFGSDFVGKISKVTHDKQRGPLSLVRVFRGTLKK---------GAKIITA-KGTSETIQ
RRF2M_DROME       -CFGTEVAGKVFKIVHDKQRGPLTLVRILRGEIKR---------GMRLISA-RGQAEVVS
RRF2M_DROYA       -CFGTEVAGKVFKIVHDKQRGPLTLIRILRGEIKR---------GMRLISA-RGQAEVVS
RRF2M_DROER       -CFGTEVAGKVFKIVHDKQRGPLTLVRILRGEIKR---------GMRLISA-RGQAEVVS
RRF2M_DROAN       -CFGSEVAGKVFKIVHDKQRGALTLVRILRGEIKK---------GMRLISA-RGQAEVVS
RRF2M_DROPE       -CFGNEVAGKVFKIVHDKQRGPLTLVRILRGEIKR---------GMRLICS-RGQAEVVS
RRF2M_DROPS       -CFGNEVAGKVFKIVHDKQRGPLTLVRILRGEIKR---------GMRLICS-RGQAEVVS
RRF2M_DROWI       -CFGNELAGKVFKIVHDKQRGPLTLVRVMRGELKR---------GMRLTCS-SGQAEVIS
RRF2M_DROGR       -CFGNDFAGKVFKIVHDKQRGPLTLVRLLRGELKR---------GMRLLCSARGQAEVVS
                          .   *:  .  :*    .*   * :              .            

RRF2M_ASPFN       RLLKMYANDAVEVDSIPEGHIGVVAGL---KHTRTGDTLVTYSGNKA--TPPEP------
RRF2M_ASPNC       RLLKMYANDAVEVDSIPEGHIGVVAGL---KHARTGDTLVSYAGNKL--TPPEP------
RRF2M_EMENI       RLLKMYANDAVEVDSISEGQIGVVVGL---KHARTGDTLVACTTNKA--TPPEP------
RRF2M_TALMQ       RLFKMYANDAVEVDSIPAGHIGVVSGL---KYARTGDTLISCTGSKM--TPPEP------
RRF2M_TALSN       RLFKMYANDAVEVDSIPAGHIGVVVGL---KYARTGDTLISCTGSKS--VPPEP------
G2Y660_BOTF4      RLLQMYASDAVEIQSIPSGQIGVIAGL---KHARTGDTLLSYTGAHPKNGPPPP------
RRF2M_YARLI       RLLKVHADTTSEVTSITEGNIGVILGS---QGLATGDTIVCHSIKKDGVMKLPPD-----
RRF2M_ASHGO       KLIKMHANVAEDIKSLHPGDIGVLAGANVADHVRTGDTIVAHCTSKDGIRSF-KK-----
RRF2M_KLULA       KLVRMHANVPEEVNELYPGDIGVLTGSNVSEHIRTGDTIVTHVTKKDGLRSFDKN-----
RRF2M_VANPO       KPVIMHANKTEDVQSLSAGEIGVLTGSTVFGRIETGDTLISHSMVKDGLKSIERK-----
RRF2M_YEAST       KLLIPHAGTSQPVNILTAGQIGLLTGSTVENNISTGDTLITHSSKKDGLKSLDKK-----
RRF2M_YEAS1       KLLIPHAGTSQPVNILTAGQIGLLTGSTVENNISTGDTLITHSSKKDGLKSLDKK-----
RRF2M_YEAS7       KLLIPHAGTSQPVNILTAGQIGLLTGSTVENNISTGDTLITHSSKKDGLKSLNKK-----
RRF2M_CANGA       KLVIMQADQAQEVKSLSPGQIGVLTGATITNKVATGDTIISHSIKKDGIRSFGEK-----
RRF2M_CANAL       KLLVMHGDSPEEVKSISAGNIGVIPGY--ETDFQTGDTLVSSAVAKRNFTAK--------
RRF2M_CANDC       KLLVMHGDSPEEVKSISAGNIGVIPGY--ETDFQTGDTLVSSAVAKRNFTAK--------
RRF2M_LODEL       KLLIMHGDQPEEVKFIGAGNIGVISGF--EDEFHTGDTVISHATSKKAVGTM--------
RRF2M_DEBHA       KLLLMHGDEPEVVPSISAGNIGVISGT--DDDIVTGDTIVSHGPVNKPFNDL--------
RRF2M_PICST       KLFMMHGDEPEEVKHISSGNIGVITGH--EDDIQTGDTLVSHSHLKKGFSEM--------
RRF2M_PICGU       KVLLMHGDTPEPVSQISSGNIGVITGT--ENDVITGDTLVSHGPVKRNFTDL--------
F4P6Y6_BATDJ      KLLELYADDYDEIPLISAGNIGAIVGL---KHVKTGDTLLASTDKRA-------------
RRF2M_SCHPO       RLYNVFADQTQEVDCISAGNIGVISGI---KQFHTGDIIINKENSKNFHEYLSG------
RRF2M_HUMAN       RLLLPFADQHVEIPSLTAGNIALTVGL---KHTATGDTIVSSKSSALAAARRAEREGEKK
RRF2M_PONAB       RLLLPFADQHVEIPSLTAGNIALTVGL---KHTATGDTIVSSKSSALAAARRAEREGEKK
RRF2M_BOVIN       RLLLPFADQHIEIPLLTAGNIALTVGL---KHTATGDTIVSSRSSALAASRRAKREGEKK
RRF2M_MOUSE       RLLLPFADQHVEIPSLTAGNIALTVGL---KQTATGDTIVSSKSSALAAARRAGR-GERE
RRF2M_RAT         RLLLPFADQHVEIPSLTAGNIALTVGL---KQTATGDTIVSSKSSALAAARRAGK-GERK
RRF2M_DANRE       RLLLPFADQQIEIPSLSAGNIALTVGL---KQTVTGDTIVSSKASAAAAIRRAQAEAESR
RRF2M_ANOGA       RIYEPLADEYREIESFGAGNIGLCAGP---KSTVTGDLL---------------------
RRF2M_CULQU       RIYAPWADEYREISSISAGNVGLCAGP---KSTVTGDLVVANASVLRNALKKLSPTNDGV
RRF2M_DROME       KLYEPLADEYREVSAVQSGDVVICAGL---KSTVTGDLLTSSQSALKNAQKRYKQSLGNT
RRF2M_DROYA       KLYEPLADEYREVSAVQSGDVVICAGL---KSTVTD------------------------
RRF2M_DROER       KLYEPLADEYREVSAVQSGDVVICAGL---KSTVTGDLLTSS------------------
RRF2M_DROAN       KLYEPLADEYREVNAVQSGDVVICAGL---KSTVTGDLLTSSQSTLKNAQKRLKQSLGTT
RRF2M_DROPE       KLYEPLADEYREVGAVQSGDVVICAGL---KSTVTGDLLTSSQTALRNAQKRLKQSQGTV
RRF2M_DROPS       KLYEPLADEYREVGAVQSGDVVICAGL---KSTVTGDLLTSSQTALRNAQKRLKQSQGTV
RRF2M_DROWI       KLYEPLADEYREVSVVSSGDVALCAGL---KSTVTGDLLTSSQSSLKNAEKRFKQQRHSD
RRF2M_DROGR       KIYEPLADEYREVGSMQAGDVAICAGL---KSTVTGDLLTSSHTSLKNAQKRLLQSRGAA
                  :     ..    :  .  *.:    *        *.                        

RRF2M_ASPFN       -------------LNTLQLRPITVPPPVFFASVEPHSLSEEKRLQESLAMLLREDPSLHV
RRF2M_ASPNC       -------------LDTLQLRPIQVPPPVFFASIEPHSLSEEKKIHECLALLLREDPSLHV
RRF2M_EMENI       -------------LDTLQLRPIDVPPPVFFASVEPHSLAEEKRMHESLALLLREDPSLHV
RRF2M_TALMQ       -------------LNTLQLRPIDVPPPVFFASIEPHSLSEEKNMQEALALLLREDPSLHV
RRF2M_TALSN       -------------LNTLQLRPIDVPPPVFFASIEPHSLSEEKNMQEALALLLREDPSLHV
G2Y660_BOTF4      -------------LNTLQLRPINVPPPVFFAAIEPHSLSEEKNVADILQLLLREDPSLHV
RRF2M_YARLI       -------------NRLIQLKPIAVPPPVFFVRIDPASIGDTRPMNEALELLLREDPSLNV
RRF2M_ASHGO       ------------AELALRIHPIDIPPPVFSAAVEPRTLGNKKAMDESLTQLTREDPSLVI
RRF2M_KLULA       ------------VELTLKINPIEIPPPVFNAAIEPKTLGNKKPMEQALSQLTREDPSLVV
RRF2M_VANPO       ------------GNLNLKINPIIIPPPVFSVYIEPKTLGNRKAMEAALKILVTEDPSLHV
RRF2M_YEAST       ------------KELTLKINSIFIPPPVFGVSIEPRTLSNKKSMEEALNTLITEDPSLSI
RRF2M_YEAS1       ------------KELTLKINSIFIPPPVFGVSIEPRTLSNKKSMEEALNTLITEDPSLSI
RRF2M_YEAS7       ------------KELTLKINSIFIPPPVFGVSIEPRTLSNKKSMEEALNTLITEDPSLSI
RRF2M_CANGA       ------------ES-QLKVNAIQIPPPVFSVIVEPKSLGNKKLIEDALKEITMEDPSLHV
RRF2M_CANAL       -------------DSAYRLLPIDIPPPLFNAAIEPHTAGDEAYMKQCVETLIREDPSLKV
RRF2M_CANDC       -------------DSAYRLLPIDIPPPLFNAAIEPHTAGDEAYMKQCVETLIREDPSLKV
RRF2M_LODEL       -------------ESTIKLMPIDIPPPLFNSSIEPFTAGDEAHMKKCIDILIREDPSLKV
RRF2M_DEBHA       -------------ESSLKMLPIEIPPPLFNSSIEPLTAGDTRHLNSCIQILLREDPSLKV
RRF2M_PICST       -------------ESNLKLLPIEIPPPLFNSAIEPQTAGDEAYMKECVRILTREDPSLKV
RRF2M_PICGU       -------------ETSIKLLPIEIPPPLFNSSIEPLTAGDARYMNECINTLIREDPSLNV
F4P6Y6_BATDJ      ----------------IQLHSIPIPPPVFVRSCEAESISSEKAMAAALESLCREDPSLTV
RRF2M_SCHPO       -----------------NQSVISIPEPVCIASIEPYSLKDEPALLEALANMNREDPSFRY
RRF2M_HUMAN       H-------RQNNEAERLLLAGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKV
RRF2M_PONAB       H-------RQNSEAERLVLAGVEIPEPVFFCTIEPPSVSKQPDLEHALKCLQREDPSLKV
RRF2M_BOVIN       Q-------KENNEAERLLLAGVEIPEPVFFCTIEPPSMAKQPDLDHALKCLQREDPSLKV
RRF2M_MOUSE       H-------GKKREAESLLLAGVEVPEPVFFCTIEPPSVAKQPDLDHALERLQREDPSLKV
RRF2M_RAT         P-------GRISEAESVLLAGVEIPEPVFFCTIEPPSAAKQPDLDHALEHLQREDPSLKV
RRF2M_DANRE       -----------SNSHSAALAGVEVPEPVFFCSIEPPTMAKQADLEHALNCLQREDPSLKV
RRF2M_ANOGA       ------------LLASKLGLQTTIPDAVYFCSIEPPSSGQQSALDNALREIQREDPSLRV
RRF2M_CULQU       -----EEDDINELLASKLSFHTVVPDAVYFCSIEPPSSSYQAALDAALREIQREDPSLRV
RRF2M_DROME       AAKV-EEDDELDESDELFAIDPQIPDAVYFCSIEPPSVSSQTAMEQALKQLQREDPSLRV
RRF2M_DROYA       -----EEDDELDESDELFAIDPQIPDAVYFCSIEPPSVSSQTAMEQALKQLQREDPSLRV
RRF2M_DROER       -----EEDDEFDESHELFAIDPQIPDAVYFCSIEPPSVSSQTAMEQALKQLQREDPSLRV
RRF2M_DROAN       ESVIPELDDESEESEDMFGLDPQIPDAVYFCSIEPPSISSQTAMEQALRQLQREDPSLRV
RRF2M_DROPE       S----ADEDEELDTDELFGIDRQIPDAVYFCSIEPPSVSSQTAMEQALRQLQREDPSLRV
RRF2M_DROPS       S----PDEDEELDTDELFGIDRQIPDAVYFCSIEPPSVSSQTAMEQALRQLQREDPSLRV
RRF2M_DROWI       GMSEEEDDDEDHHLDGLFDLAPQIPDAVYFCSIEPPSISSQTAMEQALRQLQREDPSLRV
RRF2M_DROGR       MPQD-EDEVLDDASHELFSIEPKIPDAVYFCSIEPPSISSQTAMEQALKQLQREDPSLRV
                                         :* .:     :. :      :   :  :  ****:  

RRF2M_ASPFN       TVDEDSGQTLLSGMGELHLEIARDRLLNDLKAKASMGRIEIGYRECPLGASGPITK-IFD
RRF2M_ASPNC       TVDEDSGQTLLSGMGELHLEIARDRLINDLKAKATMGRIEIGYRECPLGESPVVTK-MFD
RRF2M_EMENI       SIDEDSGQTLLSGMGELHLEIARDRLINDLKAKATMGPIEIGYRECPLGASGPVTK-IFD
RRF2M_TALMQ       TVDEDSGQTLLSGMGELHLEIARDRLVNDFKAKATMGRIEIGYRECVLGQSNPVTK-IFD
RRF2M_TALSN       TIDEDSGQTLLSGMGELHLEIARDRLVNDFKAKASMGRIEIGYRECVLDQSNPVTK-IFD
G2Y660_BOTF4      NIDEESGQMQLSGMGELHLEIAKDRLVNDFKAKATMGNIEIGYRECVLSPTLPHKY-IFD
RRF2M_YARLI       SFDDETNQTTLSGMGELHLEIAQNRLIEDFKANIVIGPIIISYKETLNEPTKSITK-TVE
RRF2M_ASHGO       VRDEETGQTVMNGMGELHLEIAADRLLNEFKAPVRVGKVAVSYKETINTAT--------E
RRF2M_KLULA       THDEETGQTLLSGMGELHLDIARDRLLNELNAQVDVERVIVSYKETLNHST--------Q
RRF2M_VANPO       SQDEETSQTLLSGMGELHLEIARDKLLNDLKAEVGIGKLMISYKETINSTT--------N
RRF2M_YEAST       SQNDETGQTVLNGMGELHLEIAKDRLVNDLKADVEFGQLMVSYKETINSET--------N
RRF2M_YEAS1       SQNDETGQTVLNGMGELHLEIAKDRLVNDLKADVEFGQLMVSYKETINSET--------N
RRF2M_YEAS7       SQNDETGQTVLNGMGELHLEIAKDRLVNDLKADVEFGQLMVSYKETINSET--------N
RRF2M_CANGA       IIDEETGQTVLNGMGQLHLEIAKFRLVNEMKVPVDFGKIAVSYKETLELPT--------E
RRF2M_CANAL       HLDKEMGQVVLSGMGELHLDIVRERLVNDMKAKVNLKDVVVSYKESFVGKR--------E
RRF2M_CANDC       HLDEEMGQVVLSGMGELHLDIVRERLVNDMKAKVNLKDVVVSYKESYVGKK--------E
RRF2M_LODEL       HTEEDMGQTILSGMGELHLEIVRDRLINDMKVKANLRDIAVAYKESYIGKT--------P
RRF2M_DEBHA       SVDEDLGQIILSGMGELHLEIIKERLVTDMKANARLRDVAVSYKETLGKPNY-----KSV
RRF2M_PICST       SVDEEMGQTIISGMGELHLDIVKERLVRDMKAKVTLRDVAVSYKETLLNP-------GSS
RRF2M_PICGU       NVDEELGQTILSGMGELHLEIVRDRLINDMKAKIRLRNVAVSFKETVSKPS------LEV
F4P6Y6_BATDJ      TVNDETGQTLLSGMGELHLEIAGERLQEVYNVKCNLGKVEISYRETLQAGQTYSHEMVYD
RRF2M_SCHPO       TQDLENGQLLIQGMGIMHLQVSYERLVSEFGARASLGKVQVGYRETLIDVSF-----NSV
RRF2M_HUMAN       RLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSV--RATDTLD
RRF2M_PONAB       RLDPDSGQTVLCGMGELHIEIIHDRIKREYGLEAYLGPLQVAYRETILNSV--RATDTLD
RRF2M_BOVIN       KLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYREAILNSI--RATDTLD
RRF2M_MOUSE       KLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSV--RATDTLD
RRF2M_RAT         KLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSV--RATDTLD
RRF2M_DANRE       RIDPDSGQTVLCGMGELHIEIIHDRIKREYKIETHLGPLQVAYRETILQSA--TAKDLLD
RRF2M_ANOGA       RYDEVTGQTVLGGMGQLHLEIVKSRILTEYRIDADLGPLQIAYKETLDEPC--RGEWRAE
RRF2M_CULQU       SYDETTMQTVLGGMGKLHLEIIKSRILSEYKIDVDLGPLQIAYKETLEEPA--RGSWTAE
RRF2M_DROME       SYDSVTGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKETIEAPA--LTTLSVE
RRF2M_DROYA       SYDSVTGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKETIESPA--LTTLSVE
RRF2M_DROER       SYDSVTGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKEAIESPA--LTTLSVE
RRF2M_DROAN       SYDSVTGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKETIESPA--LTTLSVE
RRF2M_DROPE       SYDSVTGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKETIESPS--LTTLSVE
RRF2M_DROPS       SYDSVTGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKETIESPS--LTTLSVE
RRF2M_DROWI       SYDSITGQTVLGGMGELHMDIIKSRILSEYKIDVDLGPLQIAYKETIEAPS--LTTLSVE
RRF2M_DROGR       SYDSVTGQTVLGGMGELHMDIIKSRMLSEYKIDVDLGPLQIAYKETLGSSA--ITTLSVD
                    :    *  : *** :*:::   ::         .  : :.::*               

RRF2M_ASPFN       KEIAGRKGKAGCTATVEPFDPEE----TTTEPDPSTLSIQTTDGNQIIIQAPGLEVEVNK
RRF2M_ASPNC       KEIAGRKGKAGCTAVVEPFDPDN----APPVPE-DALSVETKEGNQIIIIAPELQVETNR
RRF2M_EMENI       REIAGRKGKAGCTAEIEPFDPE-----TSPAPDPAALSVEIANGNQIVILAPELQIETNK
RRF2M_TALMQ       REVAGRKGKAGCTAVVEPYDPES---GEPSSGGEDIIFAEIVEGNRIIISAPGINISTDK
RRF2M_TALSN       REVAGRKGKAGCTAVVEPYGQELESDGNDTSGSDDIIFTETVDGNKIIISAPGVNITTDK
G2Y660_BOTF4      REVAGKKGKAGCEASISP----------DTQPLEDSDHTMNIDGNTITIRIPK---PSNN
RRF2M_YARLI       PEPG---AVSTVRLRLEPITEMD----EACENENVIDHEQNTVSFPYELSDADLESVGEG
RRF2M_ASHGO       TKHSETDDGYSFELEVRQYNEE--------DKVLFSNGWYPLGSDNNYLVIDPNPRF---
RRF2M_KLULA       EKTLETDDGYKITAVIEPLDEEMK------AKAKKDEEWFSLANDNNFMIMEKHTKY---
RRF2M_VANPO       PVIYQDDIGYKFTIQIEPLEGEEVRV----DKDTATEAWYPLGVDNNYLIFEKSNKP---
RRF2M_YEAST       IETYESDDGYRFSLSLLPNSDA-----------LPNCLAYPLGVNENFLIMEKNG-----
RRF2M_YEAS1       IETYESDDGYRFSLSLLPNSDA-----------LPNCLAYPLGVNENFLIMEKNG-----
RRF2M_YEAS7       IETYESDDGYRFSLSLLPNSDA-----------LPNCLAYPLGVNENFLIMEKNG-----
RRF2M_CANGA       VVTFKDERGFHFSLSVESFEKDTINI----EE-RSGASCFSVDNDENYLIIEGFQDR---
RRF2M_CANAL       KEAVITNEEIEVAVTLSHIEDARD--------YVGQEGALVIEEDNNVILLSETASSEHV
RRF2M_CANDC       KEAVITDEEIEVVVTLSHTEDARD--------YIGQEGALVIEGDNNVILLSQTALSEHV
RRF2M_LODEL       TNGLFETESIQVKLSIEHVDDCKS--------FEDVDGAIIFEDQNNVIIVPESLASETV
RRF2M_DEBHA       TQSTGDNGCVSIEISMDSFEGLAEE-----SSFADEDGAIVLEHENNIVILEPSATPEYM
RRF2M_PICST       YKQTSESGSVSIEIEMDSFEGAAEE-----SSFFEENGAMIIAEDNNIIIIEPSAISQNM
RRF2M_PICGU       VKASKNDGLVKVEVSLEAIDGPAEE-----STHADENGSVLLETDNNVVKLPPEAAASHI
F4P6Y6_BATDJ      SQVFGKHFKCTVELEMESIDNT--------------DAGESISLATDGIIVDARLKEHQI
RRF2M_SCHPO       TLSTENKENLIINVYLIPISDEGD--------ETLKKYFSEGEIQKVRSKGQEDGVLFYG
RRF2M_HUMAN       RTLGDKRHLVTVEVEARPIET----------------------------------SSVMP
RRF2M_PONAB       RTLGDKRHLVTVEVEARPTET----------------------------------TSVMP
RRF2M_BOVIN       RTLGDKRHLVTVELEAKPVET----------------------------------SSLLP
RRF2M_MOUSE       RVLGDKRHLVSAELEVRPAEE----------------------------------PCAVA
RRF2M_RAT         RVLGDKRHFARAELEVRPAEE----------------------------------PCGVA
RRF2M_DANRE       RILGEKRHVVSVELTVHPLKE----------------------------------NSS-A
RRF2M_ANOGA       KEIAGSKQSVYMDMTIHPSTASESN------------------------------EERIV
RRF2M_CULQU       KEIAGSKQLVRMEVTVHAKRK----------------------------------DERFL
RRF2M_DROME       KEIAGSKQSVSITLEVVKNQA-----------------------------------ELFS
RRF2M_DROYA       KEIAGSKQSVSITLEVVKNQA-----------------------------------EMFS
RRF2M_DROER       KEIAGSKQSVSITLEVVKNQA-----------------------------------ELFS
RRF2M_DROAN       KEIAGAKQNVSITLELVKDKS-----------------------------------EIFS
RRF2M_DROPE       KEIAGSKQNVSLTLEVVKDHD-----------------------------------ELFS
RRF2M_DROPS       KEIAGSKQNVSLTLEVVKDQG-----------------------------------ELFS
RRF2M_DROWI       KEIAGTKQNVSITLELVKNQS-----------------------------------EIFS
RRF2M_DROGR       KDIAGSKQSVSITLQLVSDQR-----------------------------------ELFS
                                                                              

RRF2M_ASPFN       KGIEESPLLPPGLDVHALRTALQNGCLAALAR-GPQFTFPMHGTRVTLTFNPAEHLFGNE
RRF2M_ASPNC       KGIEESPVLPPGLDMQSFRASLHNGCLAALAR-GPQFTFPMHHTRVTLTINPTEHLFGTD
RRF2M_EMENI       KGLEESPILPPGLDVDAVRSALSNGCLAALAR-GPQFTFPMHSTRVTLTLSPTAHIFGNE
RRF2M_TALMQ       RGKEESSSLPSQFDVNSFRTSLYNGALSALAR-GPQFAFPMHNTKVTLTCNVVEHLFGSD
RRF2M_TALSN       KGKEESTSLPPQLDLNSFRTSLYNGALSALAR-GPQFAFPMHNTKVTLTCNAAEHLFGSE
G2Y660_BOTF4      DGVDGTMTLPSDMTLSEVHTALINGAVAGLAR-GPRRAFPLHSAHVLLKFDTVEDVFGSD
RRF2M_YARLI       NQRISFERDTKELTPEIMEECFRVGSIPPLVSCGPVCRLPLRSVRVVIEAWHIAQHINN-
RRF2M_ASHGO       ---NED-NWPFPLKYEAFVNSIISCCIVALQRGGKTAGFPLHSCVIHVKR-WRLPLDCAA
RRF2M_KLULA       ---DPDKNWPFQVPYVAVVNALLPSSLVALQRGGKIGGFPLSSCVIRIKNDWDLPIDAPS
RRF2M_VANPO       ---GLGAVWKHQIPYDVVINTIKSSCLASFQRGGKIGGYALHSCAVRIKGDFEVPYDATS
RRF2M_YEAST       ---NWDKEWKYQVSFESILNSIIASCIVGLQRGGKIANFPLYACSIKINSDWSVPPDIET
RRF2M_YEAS1       ---NWDKEWKYQVSFESILNSIIASCIVGLQRGGKIANFPLYACSIKINSDWSVPPDIET
RRF2M_YEAS7       ---NWDKEWKYQVSFESILNSIIASCIVGLQRGGKIANFPLYACSIKINSDWSVPPDIET
RRF2M_CANGA       ---LQKSNWAYQIPIRNFVTTILSSAMASLQSAGKVGHLPLYSCAVRLKKDWDFPLDLQS
RRF2M_CANAL       RATIDERRWKCENNLEELKEAILNGCLTALQMGGPILGFPLHSTLVTVNR-WNVPVEVAQ
RRF2M_CANDC       QATIDERRWKCENNLEELKEAILNGCLTALQMGGPILGFPLHSTLVTVKR-WNAPVEQAQ
RRF2M_LODEL       QSATEGRRWKCPSSYEELHEAVVNGCSMALQTGGPHLGLSLHSTLVKVEF-WNAPVEVNE
RRF2M_DEBHA       QTAIDERRWKSDHSLEDLQESLVHGCITALQLGGPVFGFALHSTVIRIKN-WHFPVDSKD
RRF2M_PICST       LKALEERRWKSTYSLEDLQEIVIQGCLTALQMGGPIFGLSLHSTVIRVKS-WDFPVADSS
RRF2M_PICGU       NESLSERRWKSEHSLEELNDIILQGITTGLQLGGPILGLPLHSVVVRVIH-WDFPVEGKE
F4P6Y6_BATDJ      TLAEDGRQLTAFAPLSELSEAAEMGIRGALSR-GPILGLPVSQVSVRVKQVSLFNPEIST
RRF2M_SCHPO       WKPENSCTLPDHLSFQRIQENIYFGIVAGLSH-GPLHGFPLTNLQSFCTISSFLSNDFPL
RRF2M_HUMAN       VIEFEYAESINEGLLKVSQEAIENGIHSACLQ-GPLLGSPIQDVAITLHSLTIHPGTSTT
RRF2M_PONAB       VIE--YAESIHEGLLKVSQEAIENGIYSACLQ-GPLLGSPIQDVAITLHSLTIHPGTSTT
RRF2M_BOVIN       VIE--YAASVAGDLSQASREAFENGVHSACLQ-GPLLGSPVQDVAVTLHSLVIHPGTSTT
RRF2M_MOUSE       KIE--YADCVGEDLLQASREAIESAVHSACLQ-GPLLGSPVQDVAMTLHSLMIHPGTSTT
RRF2M_RAT         TIE--YADSVGEDMLQAPREDIENAIHSACLQ-GPLLGSPIQDVAVTLHSLMIHPGTSTT
RRF2M_DANRE       SCDITFEEDVKAMLPADVREAVENGVQSAYLQ-GPVLGFPVQGVQTVIQNVRLESGTSAA
RRF2M_ANOGA       LDNSAEAQETLKLVRPRQMTFFRKGALAALQR-GPKLGGQLANCTIKLHALTIGKGTADP
RRF2M_CULQU       LDSSPEAQENLRMIRPRQMSYVRKGSLAALER-GPKLGGQLMDVAVTLHQLTIGKGTADT
RRF2M_DROME       LDKSPDNLPNLNTLRPRILQVLRKGSISALER-GPRVGGQVVETQIRLHNATIGRGTADS
RRF2M_DROYA       LDKSPENLPNLNTLRPRILQVLRKGSISALER-GPRVGGQVVETQIRLHNATIGRGTADS
RRF2M_DROER       LDKSPENLPNLNTLRPRILQVLRKGSISALER-GPRVGGQVVETQIRLHNATIGRGTADS
RRF2M_DROAN       LDKSPENMPNLNTLRPRILQVLKKGAIGALER-GPRVGGQVVDTQIRLHNATIGRGTADS
RRF2M_DROPE       LDKSPENLSNLNTLRPRTLQVIRKGSVSALER-GPRVGGQVVDTQIRLHNAIIGRGTADS
RRF2M_DROPS       LDKSPENLSNLNTLRPRTLQVIRKGSVSALER-GPRVGGQVVDTQIRLHNAIIGRGTADS
RRF2M_DROWI       LDKSPENLQNLNKLRPRIVQVLRKGSISALER-GPRVGGQVVDTQIRLHNAIIGRGTADA
RRF2M_DROGR       LDKSPENVQHLNALRPRILGVLRKGAVSALER-GPRVGGQVVDTQIRLHNVTVGRGTADS
                                                   *      :                   

RRF2M_ASPFN       STPSALSAAARLATSSALRDLPS-------GAGTSLMEPVMNVIISVDEASLGAVVHDIS
RRF2M_ASPNC       TTPAALSSAARLATSAALRDLLSS------GPGTSLMEPVMNVIISIDEASLGAVVHDIS
RRF2M_EMENI       TTSASLSAATRLATSTALSNLISNPASASATPGTCLMEPLMNVIISVDEASLGAVVHDIS
RRF2M_TALMQ       SSASALSAAARLATQGALRDLATG----QNS-GTGIMEPVMNVIISIDEASLGAVVHDIS
RRF2M_TALSN       SSASALSAAARLATQGALRNLTTT----AASTGTGMMEPVMNVIISVDEASLGAVVHDIS
G2Y660_BOTF4      TTSAALSSASRNAVQAALKEAFQA-------NSIGLMEPVMNVVISCDESSLGAIVHDLS
RRF2M_YARLI       --TASLKTATRLAIMEALSTANAT-----------LMEPIMNVYVSVNEADIGLVVKDLS
RRF2M_ASHGO       AAS--ILLTVRPLIISALTS--------LPTSAFSILEPIMNVEVTVQQQDLGSVVQDLT
RRF2M_KLULA       ISP--LLTLSRQLFTQILLG--------EDQSNYSVLEPVMNVDVTVQQQDMGPVIQDLS
RRF2M_VANPO       SNE--ILNITRKLIIKSLQA--------LHESSYSLLEPIMDVEIVVNQKFMGEVIQDLT
RRF2M_YEAST       PQE--ILKITRNLIFKALND--------LKPEKYNLLEPIMNLDLTIPQSDVGTVLQDLT
RRF2M_YEAS1       PQE--ILKITRNLIFKALND--------LKPEKYNLLEPIMNLDLTIPQSDVGTVLQDLT
RRF2M_YEAS7       PQE--ILKITRNLIFKALND--------LKPEKYNLLEPIMNLDLTIPQSDVGTVLQDLT
RRF2M_CANGA       PAE--LLSITRSLITEALQT--------VDVSNYTLLEPVMDAHISVPQNDIGTVMQDLC
RRF2M_CANAL       EQALNLMNASRQAVQSLK----------DEKKDFSILEPIMSTKVYVDSNDLGEVSHDLT
RRF2M_CANDC       EQALNLMNASRQAVQSLK----------NEEKDFSILEPIMSIKVYVDSNDLGEVSHDLT
RRF2M_LODEL       ELIPPLMNAAREAVQSVK----------ASENKFGFLEPLMNVRVFVDSADMGEVSHDLS
RRF2M_DEBHA       YNSSSLLDISRRAVTKNIKDLGE-----SEKDLFSLLEPIMQTKVYINSDSLGEVVHDLT
RRF2M_PICST       VASTVLLDVSRSAVTSYI----A-----TNRDWFGILEPIMETRVYIDSDIMGEVSHDLT
RRF2M_PICGU       VSASMLLDASRQVVREALSKLPE-----SS---FCILEPIMSTRVYVDSGSMGEVVHDLS
F4P6Y6_BATDJ      PSSVRTAAYNCVRAIFQTAD-------------KRIIEPVMDLSVRVANQYVGSITKDLT
RRF2M_SCHPO       SLLTQASMKATKNAVFSLYK--------RSPKSFRILEPYMDVTITTPEEYVGIVSKDLV
RRF2M_HUMAN       MISACVSRCVQKALKKAD---------------KQVLEPLMNLEVTVARDYLSPVLADLA
RRF2M_PONAB       MISACVSRCVQKALKKAD---------------KQVLEPLMNLEVTVARDYLSPVLADLA
RRF2M_BOVIN       MISACVSRCLQKALKKAD---------------KQILEPLMNLEVTVSREYLSPVLADLA
RRF2M_MOUSE       MVTACISRCMQKALKKAD---------------KQVLEPLMSLEVTVSREYLSPVLADLA
RRF2M_RAT         MVTACISRCVQKALKKAD---------------KQVLEPLMSLEVTVSREYLSPVLADLA
RRF2M_DANRE       MVSACVSRCMLKALKQAG---------------GQVLEPVMALEVTVGEEHLSSVLADLS
RRF2M_ANOGA       FIMAASAQCIGNILANAR---------------CRLLEPDMFLEIVTPSEYLPPILADLS
RRF2M_CULQU       FIMAATAQCVRHVLSSAK---------------CRLMEPIMLLEMVMPAEHLNPILADLG
RRF2M_DROME       FVMATAAQCVQKLLSTSG---------------TRLLEPIMALQIVAPSERISGIMADLS
RRF2M_DROYA       FVMATAAQCVQKLLSTSG---------------TRLLEPIMALQIVAPSERISGIMADLS
RRF2M_DROER       FVMATASQCVQKLLSTSG---------------TRLLEPIMALQIVAPSERISGIMADLS
RRF2M_DROAN       FVMATAAQCVQKVLSTSG---------------TRLLEPIMSLQIVAPSERISGIMADLS
RRF2M_DROPE       FVMATAAQCVQKLLSTSG---------------TRLLEPIMALQIVAPSERISGIMADLS
RRF2M_DROPS       FVMATAAQCVQKLLSTSG---------------TRLLEPIMALQIVAPSERISGIMADLS
RRF2M_DROWI       FIMATAAQCVQKLLSENG---------------TRLLEPIMALQIVAPSERVSSIMADLS
RRF2M_DROGR       FVMAAAAQCVQKLLITSG---------------TRLLEPIMAIQIVAPNERISGIMADLS
                                                     .:** *   :      :  :  *: 

RRF2M_ASPFN       SSRGGHIISLDEET----PLQTTGI----TSNPT-DDLLPPIDPNKVYAPPD--PFQSST
RRF2M_ASPNC       SSRGGHIVSLDEEI----PLTSTDL----SASPQPVEDLPPIDPKKVYAPAD--PFESGS
RRF2M_EMENI       SSRGGHIVSLDEDV----PIASTDLSIPNTETPDPELDLPPIDPAKVYAPPD--PFQSST
RRF2M_TALMQ       SARGGHIISLDEEM----PISTSIG-----GNDSPESEQVVIDVNKIYAPPD--PFETPS
RRF2M_TALSN       SARGGHIVSLDEEM----PISTSLS-----QSPESQDQPVAVDINKIYAPPD--PFETPS
G2Y660_BOTF4      SARGGHVLSLENDS----DVEDTEN------------ELAPVDVSRVYTPPD--PFASGT
RRF2M_YARLI       GSRNGQIVSIMDPS----QLNEGDI----------HSEEYVAMATNTYVPAD--YTMYLS
RRF2M_ASHGO       GARKANILSIDDEHHWADAAVTDKD-----------VHLFHDIAEKQYLPPD--STVFQA
RRF2M_KLULA       SARKANILSIEDE----NTNTVSES-----------NIRFQHIADKMWLPED--PTLEFA
RRF2M_VANPO       GHHKANILSIEDEH--GLDYNNERS-----------TLNFKDIVDSQYLPPD--ITLNLA
RRF2M_YEAST       GARKAQILSIEDES---SVSNSGAS-----------TCNSPENSNRIYIPSDAVTTLHAT
RRF2M_YEAS1       GARKAQILSIEDES---SVSNSGAS-----------TCNSPENSNRIYIPSDAVTTLHAT
RRF2M_YEAS7       GARKAQILSIEDES---SVSNSGAS-----------TCNSSENSNRIYIPSDAVTTIHAT
RRF2M_CANGA       SARTATISSLDDEN-----VSSSDK-----------LMELESQSKHLYYPTD--STLGTA
RRF2M_CANAL       QRCKAMIVEIQDQS-----TQNLET-----------AAWAKDEAAKVYVPPD--YTIKKN
RRF2M_CANDC       QRCKAMIVEIQDQS-----TQNLET-----------AAWAKDEATKVYVPPD--YTIKKN
RRF2M_LODEL       QRCQALIHSVEDES-----LLNLET-----------ANWAKDEAERAYLPPD--YTMSKT
RRF2M_DEBHA       HRCQATITSIDDE------SENMDA-----------LNWANEESERVYVPPD--YTMKNT
RRF2M_PICST       QRCQAVIKSIEDES-----TQDVDA-----------LAWAKDEAEKTFLPPD--YTMKAG
RRF2M_PICGU       HRCSAHITSIEDE------SENMDS-----------NAWANEEAENLYLPQD--YTMKSG
F4P6Y6_BATDJ      GTRKGQVLGVNAMD-----LDGADS-----------------------------------
RRF2M_SCHPO       GKRGATIKEITEIG---KNAASKDS------------QIAIGILGERYLPAD--EPSSVK
RRF2M_HUMAN       -QRRGNIQEIQTR-----------------------------------------------
RRF2M_PONAB       -QRRGNIQEIQTR-----------------------------------------------
RRF2M_BOVIN       -QRRGNIQEIQSR-----------------------------------------------
RRF2M_MOUSE       -QRRGNIQEIQTR-----------------------------------------------
RRF2M_RAT         -QRRGNIQEIQTR-----------------------------------------------
RRF2M_DANRE       -QRRGTICDIQSR-----------------------------------------------
RRF2M_ANOGA       -RRRARIEDVAPRG----------------------------------------------
RRF2M_CULQU       -KRRCEILDVTARG----------------------------------------------
RRF2M_DROME       -RRRALINDVLPKG----------------------------------------------
RRF2M_DROYA       -RRRALINDVLPKG----------------------------------------------
RRF2M_DROER       -RRRALINDVLPKG----------------------------------------------
RRF2M_DROAN       -RRRAQINDVLPKG----------------------------------------------
RRF2M_DROPE       -RRRALINDVLPKG----------------------------------------------
RRF2M_DROPS       -RRRALINDVLPKG----------------------------------------------
RRF2M_DROWI       -RRRAIINDVLPKG----------------------------------------------
RRF2M_DROGR       -RRRALIRDVTSKG----------------------------------------------
                        :  :                                                  

RRF2M_ASPFN       -VGIDLPSSA-NRPRTITAKVPLKEMVGYLKHLRSLSAGRGTFVMSVDRFEKMSAPRQKA
RRF2M_ASPNC       -VGASLPDTA-NRPRTITAKVPLKEMVGYLKHLRSLSAGHGTFVMSVDRFEKMSTPRQKA
RRF2M_EMENI       VVGGSMASDARNRPRTITAKVPLKEMVGYLKHLRSLSAGRGTFVMSVDRFEKMSPPRQKA
RRF2M_TALMQ       VAGGLPIQASANQTRTITAKVPLKEMVGYLKHLRSLSAGRGTFVMHVDRFERMSAQRQKA
RRF2M_TALSN       VAGGLPIQAPANQPRTITAKVPLKEMVGYLKHLRSLSAGRGTFVMHVDRFERMSAQRQKA
G2Y660_BOTF4      ----STDSSGPGQQRQITARVPLKEMVGYLKHLRSMTGGRGTFVMSVDRFERLSGPREKA
RRF2M_YARLI       ----KHQDQTRTQQSVVHARVPLREMVGYLKTLRSMTQGRGSFTMEVDQYEAVTPDKIQP
RRF2M_ASHGO       KLNK-----EGQTGKIVKAHVPLKEMVSYMNKLRMLTKGRGSFHMSYLGMERASSDRVDG
RRF2M_KLULA       KLGK-----EGQAPKMVKAQAPLKEMVAYNNKIRSITQGRGSFNMYYHGMQPVTHDRLQS
RRF2M_VANPO       KLDN-----GGDRCKVIKAEAPLKEMVSYSNKLRSLTEGRGMVYMNYHGMKKVTPERLDD
RRF2M_YEAST       KDKKNTQETSSNVKKIIKAKVPLREITTYTNKLRSLSQGRGEFNIEYSDMEKVTNDRLQS
RRF2M_YEAS1       KDKKNTQETSSNVKKIIKAKVPLREITTYTNKLRSLSQGRGEFNIEYSDMEKVTNDRLQS
RRF2M_YEAS7       KDKKNTQETSSNVKKIIKAKVPLREITTYTNKLRSLSQGRGEFNIEYSDMEKVTNDRLQS
RRF2M_CANGA       KIQD-------DKLKTIHAICPLKEMVTYSSKLRSLTKGRGELHMDYKGMSKVSQERIPD
RRF2M_CANAL       VSKF----DDIANKKIIVAETPLREMIGYLSKLRALTRGRATFDMTLIGMRRAVGNRVDS
RRF2M_CANDC       VSKF----DDIANKKIIVAETPLREMIGYLSKLRALTQGRATFDMTLIGMRRAVGNRVDS
RRF2M_LODEL       ALA-----DNYKTRKVIHAETPLKEMIGYLSKLRSLTGGKATFDMSFLGMRRVTQSRLNQ
RRF2M_DEBHA       NNLQ----VELRNKKVIVAETPLREMIGYLSRLRSITQGRGVFDMSYLGMKRVIKSRLAS
RRF2M_PICST       KD-A----ISYKNKKIIIAETPLREMIGYLSRLRSITQGRGTFDMTYIGMRRAIKSRFDA
RRF2M_PICGU       KN-A----VNFTNKKVVVAETPLRDMVGYLSKLRSITQGRGVFDMTYLGMRRAIRPVLLD
F4P6Y6_BATDJ      --------NNSSEKHVIHARVPLAGLVGYSSQLRALTAGTGEFLMALHGYEPMSHDKEEL
RRF2M_SCHPO       ANNASSLLQSSSVIKCIRAQVPLEQILDYNSVISSLTKGNAKFLMSHPMESQTPKLVNYG
RRF2M_HUMAN       -----------QDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNT
RRF2M_PONAB       -----------QDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTNQAMNPQDQNT
RRF2M_BOVIN       -----------QDNKVVIGYVPLAEIMGYSTVLRTLTSGSATFALELSNYQAMNPQDQST
RRF2M_MOUSE       -----------QDNRVVLGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMSPQDQSA
RRF2M_RAT         -----------QDNKVVLGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMSPQDQRT
RRF2M_DANRE       -----------QDNKILLADVPLAEMMGYSTVLRTLTSGNATFSLELSSYEPMNSQDQNI
RRF2M_ANOGA       -----------SANKVVTVIAPLAELGDYSTVLRTISSGTASVSMEPNGHSPLNESDEAQ
RRF2M_CULQU       -----------QQHKVLRANAPLAELEDYSSEVRCISSGTASVSMEPNGYALLSEMDEAS
RRF2M_DROME       -----------ERNKMILVNAPLAELSGYSSALRTISSGTASMTMQPCGFSSMNSVDESL
RRF2M_DROYA       -----------ERNKMILVNAPLAELSGYSSALRTISSGTASMTMQPCGFSSMNSVDESL
RRF2M_DROER       -----------ERNKMILVNAPLAELSGYSSALRTISSGTASMTMQPCGFSSMNSVDESL
RRF2M_DROAN       -----------ERNKMILVNAPLAELSGYSSALRTISSGTASMTMQPCGFSAMNSVDESQ
RRF2M_DROPE       -----------ERNKMILVNAPLAELSGYSSALRTISSGTASMTMQPSGFSGMNAVDESL
RRF2M_DROPS       -----------ERNKMILVNAPLAELSGYSSALRTISSGTASMTMQPSGFSGMNAVDESL
RRF2M_DROWI       -----------DRNKLILINAPLAELPGYASTLRTISSGTASMTMQPCGFSNMNSSDESL
RRF2M_DROGR       -----------DRNKIILVNAPLAELSGYSSALRTISSGTASMTMQPCGFSEMNTADESL
                                  :    **  :  * . :  :: * . . :               

RRF2M_ASPFN       VLAELRGDFF------
RRF2M_ASPNC       VLTELRGGF-------
RRF2M_EMENI       VLTELRGVY-------
RRF2M_TALMQ       VLAELHR---------
RRF2M_TALSN       VLAELNR---------
G2Y660_BOTF4      L---------------
RRF2M_YARLI       IVDSIFA---------
RRF2M_ASHGO       ILEDADL---------
RRF2M_KLULA       VLADYHQ---------
RRF2M_VANPO       VLQG------------
RRF2M_YEAST       ILHDL-----------
RRF2M_YEAS1       ILHDL-----------
RRF2M_YEAS7       ILHDL-----------
RRF2M_CANGA       ILQEL-----------
RRF2M_CANAL       IVEEYKF---------
RRF2M_CANDC       IVEEYKF---------
RRF2M_LODEL       IF--------------
RRF2M_DEBHA       ISNEFNFM--------
RRF2M_PICST       ISKEFNFM--------
RRF2M_PICGU       S---------------
F4P6Y6_BATDJ      LIRTMRGY--------
RRF2M_SCHPO       SSFHPMSMQRQKRIFP
RRF2M_HUMAN       LLNRRSGLT-------
RRF2M_PONAB       LLNRRSGLT-------
RRF2M_BOVIN       LLSQRHGLS-------
RRF2M_MOUSE       LLNQRSGLAHVL----
RRF2M_RAT         LLSQRSGLARVL----
RRF2M_DANRE       LLNKMAGLT-------
RRF2M_ANOGA       AMRRALGLE-------
RRF2M_CULQU       AIRRAHGLE-------
RRF2M_DROME       AERRAQGLE-------
RRF2M_DROYA       AERRAQGLE-------
RRF2M_DROER       AERRAQGLE-------
RRF2M_DROAN       AERRAQGLE-------
RRF2M_DROPE       AERRVQGLE-------
RRF2M_DROPS       AERRVQGLE-------
RRF2M_DROWI       AIRRAQGLE-------
RRF2M_DROGR       AVRRAQGLD-------