CLUSTAL format seed alignment for MF_03100

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SLX1_HUMAN        ------------------------------------------------------MGPAGV
G1QJU5_NOMLE      -----------------------------------------------------<MGPAGV
G1MA10_AILME      ------------------------------------------------------MGPAGD
SLX1_BOVIN        ------------------------------------------------------------
I3MYV3_ICTTR      ------------------------------------------------------MGPTGS
G1Q3M3_MYOLU      ------------------------------------------------------MGPEGG
SLX1_MOUSE        ---------------------------------------------------------MDH
SLX1_RAT          ---------------------------------------------------------MGH
H0XMG2_OTOGA      ------------------------------------------------------MAPAGD
SLX1_XENLA        -----------------------------------------------------------M
F6YWF0_XENTR      -------------------------------------------------------HGAEM
H3A9L3_LATCH      ----------------------------------------------------------TM
H3CIK9_TETNG      ---------------------------------------------------------LVM
B7PW25_IXOSC      -----------------------------------------------------------Y
E9GYI3_DAPPU      ----------------------------------------------------------MS
SLX1_NEMVE        ---------------------------------------------------------MDD
SLX1_DROPE        ---------------------------------------------------MPPPPEDEA
SLX1_DROPS        ---------------------------------------------------MPPPPEDEA
SLX1_DROAN        -------------------------------------------MSFRKFTATADPEKDET
SLX1_DROME        -------------------------------------------MNSYDPQDTAS-QQEES
SLX1_DROSE        -------------------------------------------MNSYDPQDTGS-QQEET
SLX1_DROER        -------------------------------------------MNSYDPQDTASEQQEET
SLX1_DROGR        --------------------------------------------------MSDFCDSGEV
SLX1_DROMO        ----------------------------------------------MLILRLTLAGDREA
SLX1_ANOGA        ---------------------------------------------------------MNS
SLX1_TRYB2        ------------------------------------------------------------
D6XD30_TRYB2      ------------------------------------------------------------
SLX11_TRYCC       ------------------------------------------------------------
SLX12_TRYCC       ------------------------------------------------------------
V5AT06_TRYCR      ------------------------------------------------------------
Q682H4_ARATH      ----------------------MREKRGNRKALDPVGEDG-----------------VTG
F6GUC5_VITVI      ----------------------MTKRKGR----SEISEET-----------------LNS
C5XDH1_SORBI      -----------MARRGAPAKGTWRPRRKPSHAHADVDRDGDGTEGGRAPPKGNGAAAAAG
SLX1_SCHJY        ------------------------------------------------------------
SLX1_SCHPO        ------------------------------------------------------------
SLX1_PARBP        -------------------------------------------MAPSIQSLSMIHDSQEC
SLX1_PARBD        -------------------------------------------MAPSIQSLSMIHDSQEC
SLX1_PARBA        -------------------------------------------MAPSIQSLSMIHDSQEC
SLX1_AJECG        -----------------------------------------------------MDNIPQS
SLX1_TALMQ        -------------------------------------------------MISTAPADLPS
SLX1_TALSN        -------------------------------------------------MTTTVSEEAVL
SLX1_CHAGB        ---------------------------------------------------MAT-----V
SLX1_PODAN        ---------------------------------------------------MTP-----Q
SLX1_NEUCR        ---------------------------------------------------MSTTTTQIQ
C7YV24_NECH7      ---------------------------------------------------MSQ-----L
SLX1_BOTFB        ---------------------------------------------------MLRQQMP-I
SLX1_PHANO        ---------------------------------------------------MSEALKI-E
SLX1_PYRTR        ---------------------------------------------------MTDGLKI-D
SLX1_ASPFU        ----------------------------------------------------MDDTQIEH
SLX1_ASPFC        ----------------------------------------------------MDDTQIEH
SLX1_NEOFI        ----------------------------------------------------MEDIQIEH
SLX1_ASPCL        ----------------------------------------------------MENIQLEH
SLX1_PENRW        ------------------------------------------------------MEEFEK
SLX1_ASPNC        ----------------------------------------------------MDDAEVDH
SLX1_ASPOR        ----------------------------------------------------MANVDDVH
SLX1_ASPTN        ----------------------------------------------------MDNVDSDQ
SLX1_EMENI        ------------------------------------------------------------
SLX1_ASHGO        ------------------------------------------------------MGDDIG
SLX1_CANGA        ---------------------------------------------------------MEE
SLX1_YEAST        ------------------------------------------------------MSQKIQ
SLX1_YEAS7        ------------------------------------------------------MSQKIQ
SLX1_YEAS6        ------------------------------------------------------MSQKIQ
SLX1_YEAS1        ------------------------------------------------------MSQKIQ
SLX1_VANPO        ----------------------------------------------MMNSSQFSDSQTTS
SLX1_KLULA        --------------------------------------------------------MSNK
SLX1_CANDC        ---------------------------------------------------MSQTNDKPA
Q5A4X4_CANAL      ---------------------------------------------------MSQTNDKPA
SLX1_DEBHA        --------------------------------------------MDDNEEYDTKRKTRCG
SLX1_PICST        --------------------------------------------MPRRPSTGTQSDTPA-
SLX1_YARLI        -----------------------------------------------------------M
A9TJN0_PHYPA      MTVTNQNWSGLLDLFVTPRGSTSEKLCGCSRFDRVLRLLVALESRLRCRTILGSKRMEDS
D5GJR5_TUBMM      ------------------MISVLTTVWHRSLLLLPTPSGSRIRCAARLGPLTRAERVRME
A2F2W8_TRIVA      ------------------------------------------------------------
C4M4C5_ENTHI      ----------------------------------------------------------ME
F4P011_BATDJ      ------------------------------------------------------------
A8IU90_CHLRE      ------------------------------------------------------------
SLX1_PICGU        -------------------------------------------------------MAPTQ
SLX1_GIAIC        ---------------------------------------------------------MTI
SLX1_CRYNJ        ---------------------------------------MSDDAEVTNNKKTTKSTLLDG
E3KL57_PUCGT      -------------------------------------MSSTQPNSSGTKKRTTTSTLHPG
SLX1_MONBE        --------------------------------------------MAGGYIARVNMKGHYL
SLX1_MALGO        -----------------------------------------------------MRISSVV
SLX1_CRYPI        ------------------------------------------------------------
                                                                              

SLX1_HUMAN        AARPGRFFGVYLLYCL---NPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGR--G
G1QJU5_NOMLE      AARPGRFFGVYLLYCL---NPRYRGRVYVGFTVNPARRVQQHNGGRKKGGAWRTSGR--G
G1MA10_AILME      AARPRRFFGVYLLYCL---NPRHRGRVYVGFTVNPARRVQQHNGGRKKGGAWRTSGR--G
SLX1_BOVIN        -MGPGCFFGVYLLYCL---NPRHRGRVYVGFTVNPARRVQQHNGGRKKGGAWRTSGR--G
I3MYV3_ICTTR      EARPERFFGVYLLYCL---NPRHRGRVYVGFTVNPARRVLQHNGGRKKGGAWRTSGR--G
G1Q3M3_MYOLU      AARPGCFFGVYLLYCL---NPRHRGRVYVGFTVNPARRVQQHNGGRRKGGAWRTSGR--G
SLX1_MOUSE        AARPGRFFGVYLLYCQ---NPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGR--G
SLX1_RAT          AARPGRFFGVYLLYCQ---NPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGR--G
H0XMG2_OTOGA      AGRPGRFFGVYVLYCL---NPQHLGRIYVGFTVNPVRRVQQHNGGRKKGGAWRTSGL--G
SLX1_XENLA        VVEVEGFYGVYLLFCT---NPKYKGRIYIGFTVNPERRIQQHNGGKHKGGAWKTSGR--G
F6YWF0_XENTR      VVEVEGFYGVYLLFCT---NPKYKGRIYIGFTVNPERRIQQHNGGKHKGGAWKTSGR--G
H3A9L3_LATCH      VVEVEDFFGVYMLYCT---NPKYKGRIYIGFTVNPERRITQHNAGKQKGGAWRTSGR--G
H3CIK9_TETNG      VVEVEGFFGVYMLYCT---NPKYKGRIYIGFTVNPERRVTQHNAGRHKGGAKRTSGR--G
B7PW25_IXOSC      LMEVQQFYGCYLLYCT---NPKYKGHTYIGFTVDPNRRVKQHNKGLKAGGAWRTSTK--G
E9GYI3_DAPPU      STVIENFYGVYLLFCE---NPKYLGRTYIGYTVNPNRRIQQHNKGVRSGGAYKTSNK--G
SLX1_NEMVE        NIAGSGFHGVYLLYCV---NPKFKGHTYIGYTVNPNRRIKQHNGGVDKGGAYKTSRK--K
SLX1_DROPE        IAHKGHFYGVYLLCSQS-LDSRYRAKCYVGFTVNPKRRIKQHNRGCDFGGAKKTSKK--G
SLX1_DROPS        IAHKGHFYGVYLLCSQS-LDSRYRAKCYVGFTVNPKRRIKQHNRGCDFGGAKKTSKK--G
SLX1_DROAN        IARKGHFYGVYLLCSQS-LDSRYRGKCYVGFTVNPKRRIKQHNRGCDFGGAKKTSRK--G
SLX1_DROME        VALKGHFYGVYLLCSQS-LDPRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRK--G
SLX1_DROSE        VALKGHFYGVYLLCSQS-LDPRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRK--G
SLX1_DROER        VALKGHFYGVYLLCSQS-LDPRFRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRR--G
SLX1_DROGR        LAQKGRFYGVYLLCSQS-LDARYRGKCYVGFTVNPKRRIGQHNRGCDFGGAHKTSRK--G
SLX1_DROMO        LAQKGHFYGVYLLCSQS-VDVRHRGKCYVGFTVNPKRRIRQHNRGSSFGGAKKTSKK--G
SLX1_ANOGA        VEEIEDFYGVYLLVSKS-PNPKFAGRTYIGYTVDPNRRIKQHNRGEDAGGARRTSNR--G
SLX1_TRYB2        --MDTRFHCVYLLTSL---DPQCEGAHYIGYTVNPIRRLRQHNGELVNGARRTKRNG--R
D6XD30_TRYB2      --MDTRFHCVYLLTSL---DPQCEGAHYIGYTVNPIRRLRQHNGELVNGARRTKRNG--R
SLX11_TRYCC       --MDTRFHCVYLLTSL---DPQCAGEYYIGYTVDPIRRLRQHNGEIVSGAWRTKRRG--R
SLX12_TRYCC       --MDTRFHCVYLLTSL---DPQCAGEYYIGYTVDPIRRLRQHNGEIVSGAWRTKRRG--R
V5AT06_TRYCR      --MDTRFHCVYLLTSL---DPQCAGEYYIGYTVDPIRRLRQHNGEIVSGAWRTKRRG--R
Q682H4_ARATH      KD-GKGFFACYLLTSL---SPRHKGQTYIGFTVNPRRRIRQHNGEITSG-AWRTKKK--R
F6GUC5_VITVI      EEKGDDFFACYLLASL---SPRHKGHSYIGFTVNPRRRIRQHNGEITCG-AWKTKRK--R
C5XDH1_SORBI      GGGGGGFFCCYLLRSL---CPRSKSRTYIGFTVNPRRRIRQHNGEIVSG-AWRTRRG--R
SLX1_SCHJY        -----MFYCCYLLVSE---KA-ASRSVYIGSTPDPARRLRQHNGE-IKGGAYKTKRS--R
SLX1_SCHPO        -MDLCNFYCCYLLKSN---RTQSSGAVYIGSTPDPPRRLRQHNGE-IVGGASKTKHG--R
SLX1_PARBP        IKPIPAFYCCYLLRSCV-----RHASLYIGSTPDPARRLAQHNGDRN-GAAKRTLRENLR
SLX1_PARBD        IKPIPAFYCCYLLRSCV-----RHASLYIGSTPDPARRLAQHNGDRN-GAAKRTLRENLR
SLX1_PARBA        IKPIPAFSCCYLLRSCV-----RHASLYIGSTPDPARRLAQHNGDRY-GAAKRTLRENLR
SLX1_AJECG        INPIPAFYCCYLLRSTV-----RHASLYIGSTPEPSRRLAQHNGDRT-GGARKTSSEKLR
SLX1_TALMQ        PKPIPAFYCCYLLRSVK-----KPSSLYIGSTPDPARRLEQHNGFTK-GGAKRTERDTLR
SLX1_TALSN        TKPIPAFYCCYLLRSAK-----RPSALYIGSTPDPARRLEQHNGFAK-GGAKRTERNTLR
SLX1_CHAGB        HSPIPALYTVYILRSTV-----RHASFYVGSTPNPPRRLSQHNGLVR-GGAVRTSRGNLR
SLX1_PODAN        PRPIPALYCVYILRSTV-----RHSSLYIGSTPNPPRRLSQHNGVVK-GGAVRTSRNSLR
SLX1_NEUCR        PKPIPALYTVYILRSQP-----RHASLYIGSTPHPPRRLSQHNGLAK-GGAYRTSKISLR
C7YV24_NECH7      SRPHPALYGVYVLRSTV-----RHASIYIGSTPNPPRRLKQHNGEAR-GGAVRTAREKLR
SLX1_BOTFB        DRPIPSFYGCYLLRSTI-----RHSALYVGSTPNPVRRLRQHNGLVK-GGAVRTSRGNLR
SLX1_PHANO        SRPIPAFYCCYLLRSK------NRKSYYIGSTPNPARRLGQHNGSSK-GGAKRTSMQGKR
SLX1_PYRTR        SRPLPAFYCCYLLRSK------NRKAFYIGSTPNPARRLGQHNGSSK-GGAKRTSMQGKR
SLX1_ASPFU        PRPIPIFYCCYLLRSTV-----RHASLYIGSTPNPARRLIQHNGVVK-GGARRTAAEKLR
SLX1_ASPFC        PRPIPIFYCCYLLRSTV-----RHASLYIGSTPNPARRLIQHNGVVK-GGARRTAAEKLR
SLX1_NEOFI        PRPIPIFYCCYLLRSTV-----RHASLYIGSTPNPARRLVQHNGVVK-GGARRTAAEKLR
SLX1_ASPCL        SKPIPAFYCCYLLRSTV-----RHASLYIGSTPNPARRLTQHNGVVK-GGARRTAAEKLR
SLX1_PENRW        PKPIPAYYCCYLLRSTV-----RHASLYIGSTPNPIRRLPQHNGVAK-GGAKRTARDKLR
SLX1_ASPNC        TKPIPAYYCCYLLRSTK-----QRTSLYIGSTPHPARRLAQHNGESK-GGARKTAKDDKR
SLX1_ASPOR        TKPIPAFYCCYLLRSTV-----RQTSLYIGSTPHPSRRLAQHNGVSR-GGARKTAND-KR
SLX1_ASPTN        TKPIPAYYCCYLLRSTVN----KRAGLYVGSTPNPPRRLPQHNGLSK-GGAKKTATK-NR
SLX1_EMENI        -------------MGTGY----RTQALYIGSTPDPARRLAQHNGLCK-GGARRTADEKRR
SLX1_ASHGO        TAGVPAFYCCYLLRSIP-----KRLSYYIGSTPNPVRRLRQHNGLLTKGGAYRTKRQGTR
SLX1_CANGA        FQQIPDFYGCYLLQSIS-----KRQSFYIGSTPNPVRRLRQHNGSLSRGGAYRTKRDGTR
SLX1_YEAST        QHQFPDFYCCYLLQSIN-----KRQSFYVGSTPNPVRRLRQHNGKLAVGGAYRTKRDGSR
SLX1_YEAS7        QHQFPDFYCCYLLQSIN-----KRQSFYVGSTPNPVRRLRQHNGKLAVGGAYRTKRDGSR
SLX1_YEAS6        QHQFPDFYCCYLLQSIN-----KRQSFYVGSTPNPVRRLRQHNGKLAVGGAYRTKRDGSR
SLX1_YEAS1        QHQFPDFYCCYLLQSIN-----KRQSFYVGSTPNPVRRLRQHNGKLAVGGAYRTKRDGSR
SLX1_VANPO        LHRIPTFYCCYLLQSIN-----KKQSFYIGSTPNPVRRLRQHNGNLSNGGAYRTKREGTR
SLX1_KLULA        QHRVPDFYCSYLLRSIP-----KPNSFYIGSSPDPVRRLRQHNGAVRRGGAYRTKRNGTR
SLX1_CANDC        LHLVPSFYGVYILKSIP-----KPRRTYIGSTPDPKRRLRQHNGDLKVGGAYRTKKDGSR
Q5A4X4_CANAL      LHLVPSFYGVYILKSIP-----KPRSTYIGSTPDPKRRLRQHNGDLKVGGAYRTKKDGSR
SLX1_DEBHA        LHVHPDFYGVYLLRSVP-----KPKSFYIGSTPNPQRRLRQHNGELKNGGAYRTKKSGFR
SLX1_PICST        LHVVPSFYGVYLLQSEP-----KPSSFYIGSTPDPPRRLRQHNGDLKAGGAYRTKRAGFR
SLX1_YARLI        THQYPPFYGVYLLQSTK-----KPLSCYVGSTPNPFRRIRQHNGDLKAGGAWRTKRAHLR
A9TJN0_PHYPA      GNGKGSFFACYLLTSLN---PRYKGCHYIGFTVNPRRRIRQHNGELT-SGAWRTHRK--R
D5GJR5_TUBMM      PLEMPVFYCVYLLRSTV-----RPKSFYIGSTPDPRRRLAQHNGQTK-GGAERTSRENLR
A2F2W8_TRIVA      ---METFAGCYILRSQN---PQYKTHCYIGFTVNPPRRIKQHNGARV-GGAFKTHTM--R
C4M4C5_ENTHI      KNISSMKFCVYLLTSIN---PGFKYHTYIGKTTCPPRRIKQHNGIIS-GGAFKTEAK--R
F4P011_BATDJ      MTDKPFFYSCYLLRSCQ---PGRRIPAYIGSTLDPSRRLRQHNGLIKGGAQQTIKWR---
A8IU90_CHLRE      ---MREFFGCYLLASQS---PKHKGRTYIGFTVNPRRRIRQHNGLIK-NGAWKTHKG--R
SLX1_PICGU        IFVSPEFYGVYILQSEP-----SPRSFYIGSTPDPIRRLRQHNGDLK-QGAFRTRRTSRR
SLX1_GIAIC        FSGPRGLFACYCLVAES---SESPKRCYIGFTNNPLRRIRQHNRKIA-GGARKTSRY--G
SLX1_CRYNJ        NHIFPPFYACYLLRSKA---TANSNRTYVGSTPDPPRRIRQHNGELKQGAWSTSRHR---
E3KL57_PUCGT      LHQYPAFYACYLLRSYYK--GKRNERTYVGSTPNPPRRIRQHNGELKGGAVRTKYYR---
SLX1_MONBE        SWSSDNTYPWQNIQPTQ--NTKLLGLQDIGFTTDPVRRLRQHNSEIGGGAVRTTRAK--G
SLX1_MALGO        EHRTPRVYVCYCLRSLS-----RPNQTYIGSTPDPIRRLRQHNGLVKQGAFYTRMAR---
SLX1_CRYPI        MKSNIQLHYCYFLLSEA-----KKKASYIGYSVNPCRRLRQHNGEIKKGAKKTKSGV---
                                              :* :  . **: ***                 

SLX1_HUMAN        PW-EMVLVVHGFPSSVAALRFE----------------------------------WAWQ
G1QJU5_NOMLE      PW-EMVLVVHGFPSSVAALRFE----------------------------------WAWQ
G1MA10_AILME      PW-EMVLIVHGFPSAVAALRFE----------------------------------WAWQ
SLX1_BOVIN        PW-EMVLIVHGFPSAVAALRFE----------------------------------WAWQ
I3MYV3_ICTTR      PW-EMVLIVHGFPSAVAALRFE----------------------------------WAWQ
G1Q3M3_MYOLU      PW-EMVLIVHGFPSAVAALRFE----------------------------------WAWQ
SLX1_MOUSE        PW-DMVLIIHGFPSAVAALRFE----------------------------------WAWQ
SLX1_RAT          PW-DMVLILHGFPSAVAALRFE----------------------------------WAWQ
H0XMG2_OTOGA      PW-EMVLVVHGFPSAVAALRFE----------------------------------WAWQ
SLX1_XENLA        PW-DMVLIVHGFPNDIAALRFE----------------------------------WAWQ
F6YWF0_XENTR      PW-DMVLIVHGFPNDIAALRFE----------------------------------WAWQ
H3A9L3_LATCH      PW-DMVLITHGFPSDIAALRFE----------------------------------WAWQ
H3CIK9_TETNG      PWSEMLLIIHGFPSDIAALRFE----------------------------------WAWQ
B7PW25_IXOSC      QW-DMPLIIHGFPNEISALRFE----------------------------------WAWQ
E9GYI3_DAPPU      PW-EMCLIIHGFPNDISGLRFE----------------------------------WAWQ
SLX1_NEMVE        PW-NMILIVHGFPNDIIALQFE----------------------------------WAWQ
SLX1_DROPE        PW-QMVMIVHGFPNNISALQFE----------------------------------WAWQ
SLX1_DROPS        PW-QMVMIVHGFPNNISALQFE----------------------------------WAWQ
SLX1_DROAN        PW-QMVMIVHGFPNNIVALQFE----------------------------------WAWQ
SLX1_DROME        PW-LMVMIVHGFPNNTVALQFE----------------------------------WAWQ
SLX1_DROSE        PW-LMVMIVHGFPNNTVALQFE----------------------------------WAWQ
SLX1_DROER        PW-LMVMIVHGFPNNTVALQFE----------------------------------WAWQ
SLX1_DROGR        PW-QMVMIVHGFPNNIAALQFE----------------------------------WAWQ
SLX1_DROMO        PW-QMVMIVHGFPNKIVALQFE----------------------------------WAWQ
SLX1_ANOGA        PW-TMVLIVHGFPNNISALRFE----------------------------------WAWQ
SLX1_TRYB2        PW-LLLMCVSGFGEDRIALKFE----------------------------------WCWQ
D6XD30_TRYB2      PW-LLLMCVSGFGEDRIALKFE----------------------------------WCWQ
SLX11_TRYCC       PW-ELLCCVSGFGEDRIALKFE----------------------------------WCWQ
SLX12_TRYCC       PW-ELLCCVSGFGEDRIALKFE----------------------------------WCWQ
V5AT06_TRYCR      PW-ELLCCVSGFGEDRIALKFE----------------------------------WCWQ
Q682H4_ARATH      PW-EMVLCIYGFPTNVSALQFE----------------------------------WAWQ
F6GUC5_VITVI      PW-EMVLCIYGFPTNVSALQFE----------------------------------WAWQ
C5XDH1_SORBI      PW-EMVLCIYGFPSNVAALQFE----------------------------------WAWQ
SLX1_SCHJY        PW-KVACFVHGFPTKIAALQFE----------------------------------WVWQ
SLX1_SCHPO        PW-SISCLVYGFPNKVSALKFE----------------------------------WNWQ
SLX1_PARBP        PW-EMVAIVSGFTSRVAALQFE----------------------------------WAWQ
SLX1_PARBD        PW-EMVAIVSGFTSRVAALQFE----------------------------------WAWQ
SLX1_PARBA        PW-EMVAIVSGFTSRVAALQFE----------------------------------WAWQ
SLX1_AJECG        PW-EMVAIVSGFTNRAGALQFE----------------------------------WAWQ
SLX1_TALMQ        PW-EMITIIEGFTSRTGALQFE----------------------------------WSWQ
SLX1_TALSN        PW-EMVAIVEGFPSRTGALQFE----------------------------------WSWQ
SLX1_CHAGB        PW-EMIILVSGFPSATAALKFE----------------------------------WALN
SLX1_PODAN        PW-EMVALVSGFASSTAALKFE----------------------------------WALT
SLX1_NEUCR        PW-NMVCLVSGFPSMIAALKFE----------------------------------WALN
C7YV24_NECH7      PW-EVMILVTGFPSSIAALKFE----------------------------------WAMT
SLX1_BOTFB        PW-EMACIVTGFPTSIAALQFDR---------------------------------WAWQ
SLX1_PHANO        PW-EMTCIVTGFPSKFAALQFE----------------------------------WAWQ
SLX1_PYRTR        PW-EMTCIVTGFPSRFAALQFE----------------------------------WAWQ
SLX1_ASPFU        PW-EMVLVVEGFMSRLAALQFEWAWQNPWYSRHLRSEE-----SSALAEVKHRRMRKAKS
SLX1_ASPFC        PW-EMVLVVEGFMSRLAALQFEWAWQNPWYSRHLRSEE-----SSALAEVKHRRMRKAKS
SLX1_NEOFI        PW-EMLLVVEGFTSRLAALQFD----------------------SAPAEVKHRRKRKAKS
SLX1_ASPCL        PW-EMVMIVEGFMSRLGALQFEWAWQNPGYSRHLRSEEEGLEAPGTTSTTKPKTTRRAKS
SLX1_PENRW        PW-EMTLVVEGFTSRVGALQFEWAWQHP------------------------ERSRHLDS
SLX1_ASPNC        PW-EMVLLVEGFTSRVGALQFEWAWQNP----------------------RMSSQHPANR
SLX1_ASPOR        PW-EMVLIVEGFMSRTAALQFDTIYTT------------------------WAWQKPG--
SLX1_ASPTN        PW-EMVLLVEGFMSRTAALQFEWAWQH---------------------------------
SLX1_EMENI        PW-EMVMVVEGFMSKIAALQFEWAWQHPAATRHLTADAPSKEQSKTHEGIEDDDAVKKPQ
SLX1_ASHGO        PW-ELAASVSGFPSKIAALQFE----------------------------------HAWQ
SLX1_CANGA        PW-EMVAIVYGFPSRIAALQFE----------------------------------HAWQ
SLX1_YEAST        PW-EMIMIVRGFPSKIAALQFE----------------------------------HAWQ
SLX1_YEAS7        PW-EMIMIVRGFPSKIAALQFE----------------------------------HAWQ
SLX1_YEAS6        PW-EMIMIVRGFPSKIAALQFE----------------------------------HAWQ
SLX1_YEAS1        PW-EMIMIVRGFPSKIAALQFE----------------------------------HAWQ
SLX1_VANPO        PW-EMVLVVYGFTSKIAALQFE----------------------------------HAWQ
SLX1_KLULA        PW-KMVCFIYGFTSKIAALQFE----------------------------------HAWQ
SLX1_CANDC        PW-TMVVLVHGFPSRIAALQFE----------------------------------HSLQ
Q5A4X4_CANAL      PW-NMVVLVYGFPSRIAALQFE----------------------------------HSLQ
SLX1_DEBHA        PW-EMICLVYNFPSKNVALQFE----------------------------------HALQ
SLX1_PICST        PW-RMLLVVYDFPSKVSALQFE----------------------------------HSFQ
SLX1_YARLI        PW-SMVLIVNGFPSKISALKFE----------------------------------HALQ
A9TJN0_PHYPA      PW-DMILCVYGFACQVEALQFE----------------------------------WAWQ
D5GJR5_TUBMM      PW-EMTCIVSGFTSSVAALQFE----------------------------------WAWQ
A2F2W8_TRIVA      PW-EMTLVVWGFPTKKLALKFE----------------------------------WTWQ
C4M4C5_ENTHI      PW-EMVIVVHSFPTQTKVLQFE----------------------------------WDWQ
F4P011_BATDJ      PW-EMVAIVYGFPSDVTALQFE----------------------------------WAWQ
A8IU90_CHLRE      PW-EMTLVLYGFPTKIQALQFE----------------------------------WAWQ
SLX1_PICGU        PW-KMIAITHNFPSRVAALQFE----------------------------------HALQ
SLX1_GIAIC        PW-RMVLFVGGFSTKVSALKFE----------------------------------YIWT
SLX1_CRYNJ        PW-EMQMIVYGFPSKLAALQFE----------------------------------WAWQ
E3KL57_PUCGT      PW-EMELICYGFPSKLVALQFE----------------------------------WAWN
SLX1_MONBE        SW-DMAAIVYGFPNKVAALRFE----------------------------------WAWQ
SLX1_MALGO        PW-TMDVVVYGFPSKLAALQFE----------------------------------WSWQ
SLX1_CRYPI        PW-NLGICVGGFPDRVAALRFE----------------------------------WAWQ
                   *  :     .*      *:*:                                      

SLX1_HUMAN        HPHASRRLAHVGPRLRG-------------------------------ETAFAFHLRVLA
G1QJU5_NOMLE      HPHASRRLAHVGPRLRG-------------------------------ETAFAFHLRVLA
G1MA10_AILME      HPHASRRLAHVGPRVRS-------------------------------EAAFPFHLRVLA
SLX1_BOVIN        HPQASRRLTHVGRRLRG-------------------------------EATFAFHLRVLA
I3MYV3_ICTTR      HPQASRRLSHVGPRLRG-------------------------------EATFAFHLRVLA
G1Q3M3_MYOLU      HPQASRRLAHVAPRLRS-------------------------------EAAFAFHLRVLA
SLX1_MOUSE        HPQASRRLTHVGPRLRS-------------------------------EAAFAFHLRVLA
SLX1_RAT          HPQASRRLTHVGPRLRS-------------------------------EASFTFHLRVLA
H0XMG2_OTOGA      HPHASRRLAHVSRRLRR-------------------------------ESSFVFHLRVLA
SLX1_XENLA        HPHVSRRLTHVPRKTKK-------------------------------QSSFDFHLLVLC
F6YWF0_XENTR      HPHVSRRLTHVPRKPKK-------------------------------QSSFDFHLLVLS
H3A9L3_LATCH      HPHSSRRLTHVSRRSKK-------------------------------ESSFEFHLRVLS
H3CIK9_TETNG      HPHSSRRLSHVCKRFRK-------------------------------ESSLQFHWRVVS
B7PW25_IXOSC      HPDKSRRLGHVEKKNRK-------------------------------ESRFEFAFRVVS
E9GYI3_DAPPU      HPEKSRRLRKLIERKRTK------------------------------ENSFQHKIRILS
SLX1_NEMVE        KPTVSRRLKSAATKKKPR------------------------------ERPVQYCFRILS
SLX1_DROPE        QPTLSTRLKIFPDLKRKKPK----------------------------ETHFDYNFRILN
SLX1_DROPS        QPTLSTRLKIFPDLKRKKPK----------------------------ETHFDYNFRILN
SLX1_DROAN        QPTLSTRLKIFPELKRKNPR----------------------------ESHFDYNFRILN
SLX1_DROME        QPSLSTRLKMYPELKRKLPR----------------------------ETFFDYNFRILS
SLX1_DROSE        QPSLSTRLKMYPELKRKLPR----------------------------ETFFDYNFRILS
SLX1_DROER        QPSLSTRLKMYPELKRKLPR----------------------------ETFFDYNFRILS
SLX1_DROGR        QPALSTRLKCYPELRRKQPR----------------------------ETHFDYNFRIVN
SLX1_DROMO        QPTLSTRLKIFDDLRRKLPR----------------------------ETHFDYNFRIVN
SLX1_ANOGA        QPRVSRRLKQMPELQKKLRK----------------------------ESNFEYNFRILT
SLX1_TRYB2        NPSKSTRLKSHVSQLRC-------------------------------VHKLTHAVGVLL
D6XD30_TRYB2      NPSKSTRLKSHVSQLRC-------------------------------VHKLTHAVGVLL
SLX11_TRYCC       HPTKSTRLKTQMTQLRG-------------------------------VHRLPYAVGVLH
SLX12_TRYCC       HPTKSTRLKTQMTQLRG-------------------------------VHRLPYAVGVLH
V5AT06_TRYCR      HPTKSTRLKTQMTQLRG-------------------------------VHRLPYAVGVLH
Q682H4_ARATH      HPRESVAVREAAAAFKS-------------------------------FSGVASKIKLVY
F6GUC5_VITVI      HPTESLAVRKAAAGFKS-------------------------------LSGIANKIKLAY
C5XDH1_SORBI      HPTESLAVRKAAAEFKS-------------------------------LSGIGNKVKLAY
SLX1_SCHJY        HPQSTRHDDLRQHSRVVSVK----------------------------RQTLLSCVRALG
SLX1_SCHPO        NLGISRYTKDCDFR---SKK----------------------------QKTIMYCLKGLK
SLX1_PARBP        NTKVSRHADLDGNAIQELGVRICPRTGKGVK------------GTAKPRTSLTNILANLH
SLX1_PARBD        NTKVSRHADLDGNVIQELGVRICPRTGKGVK------------GTAKPRTSLTNILANLH
SLX1_PARBA        NTKVSRHADLDGNATQELGVRICPRTAKEVK------------RVAKPRTSLTNILANLH
SLX1_AJECG        HTKESRHAEVERCESEQLGTRGSSRTGKEVK------------RAGKPRTSLPNILENLH
SLX1_TALMQ        HVHTTRH--IGAVETDQLNRR---RKDPPVD------------QGSGIWTSTPKVLGNLH
SLX1_TALSN        HVHTTRH--IGAVETDQLNRK---RKNPPTD------------KGSGIWTSTPKVLGNLH
SLX1_CHAGB        NPHLSMHIPSAER--LVVSTQRNR-NGRPR----------------RPAKSLASVASSLH
SLX1_PODAN        NPHTSLHIPSESR--LAFSTQRKR-NGQPK----------------RPPKSLSSILSNLH
SLX1_NEUCR        NPHKSLHIPAEKRAEAVKGLGRRK-TGHLK----------------RPRKSLVGVMEALR
C7YV24_NECH7      NPHLTTHISAEER--LTKAAEKRKGMKKPR----------------KPIHTLTSVVSNLH
SLX1_BOTFB        NPHITLHIPPSSR--ISHATQKKR-SGHPK----------------RPRHTLQSLLSNLH
SLX1_PHANO        NTHATRHIDKDVRDARAEELQKGKKKATSPG-----------RRRKRPPMSLEARLKNLH
SLX1_PYRTR        NTHATRHIERDVREARKDELEKGRKNASPV-------------KRSRPPMSLEARLKNLH
SLX1_ASPFU        EDPEFLDSNCDSAKSRVKGTPK-KSKRRHR-----------------PPRSLDTYFSDLH
SLX1_ASPFC        EDPEFLDSNCDSAKSRVKGTPK-KSKRRHR-----------------PPRSLDTYFSDLH
SLX1_NEOFI        GDPESLDSNCDSAKTKDKGTPK-KSKRRPR-----------------PPRSLDTHFSDLH
SLX1_ASPCL        QTPQPLEFERDPSVSKSLGTPKRKNQRRRR-----------------PQRSLTTHFADLH
SLX1_PENRW        DDDLDSKPQAKANANADAKTGKPKSKPRAR-----------------TRRSLMAHLEDLH
SLX1_ASPNC        HQFDLETGDVAGTSGVQPSTEAGKAKHRGRG----------------SRRSLKAHLEDLH
SLX1_ASPOR        -----KSRHLGDDDNTESAREKGKTRPRG------------------PARSLKGHLENLH
SLX1_ASPTN        -----------EDSRHMSKGEPGNTKRRQR-----------------PRRSLTANLEKLH
SLX1_EMENI        QKTKGLTDSRATGEREDDGKKKTKRKPPARR----------------TRTSLKAHLEDLH
SLX1_ASHGO        HPYQTRFIKSEDRIVKKKGGG----------------------------RSIHQRLAVLK
SLX1_CANGA        HGYQTRYIKSQDRVVKTRKGG----------------------------RSIHHKLAMIT
SLX1_YEAST        HGYQTHYIAEKDRVVKHKAGG----------------------------RTLHHKVALMK
SLX1_YEAS7        HGYQTHYIAEKDRVVKHKAGG----------------------------RTLHHKVALMK
SLX1_YEAS6        HGYQTHYIAEKDRVVKHKAGG----------------------------RTLHHKVALMK
SLX1_YEAS1        HGYQTHYIAEKDRVVKHKAGG----------------------------RTLHHKVALMK
SLX1_VANPO        HGYKTHYIPMDDRIMKNANSG----------------------------RTVHHKLGLVR
SLX1_KLULA        HSYKTRFIENNERLVTKKNTR----------------------------NGIATKLGNAR
SLX1_CANDC        HAYQTRHINNDARITSSSRQ-----------------------------SSMHSKLANIR
Q5A4X4_CANAL      HAYQTRHIDNDARITSSSRQ-----------------------------SSIHSKLANIR
SLX1_DEBHA        HPYQTRHIKSELRITHKRNSG----------------------------NTLHHKLGNIR
SLX1_PICST        HCHETRHIKQEERISKNKLSG----------------------------RTLHHKVANVA
SLX1_YARLI        HPNMTRLITTKDIKRKVPQKA----------------------------RALGTHLAFIR
A9TJN0_PHYPA      HPLKSLVVREAAGRIPSS------------------------------VRGLKKQFYLLF
D5GJR5_TUBMM      NPHKTSKIEKSQRISKSIRIKTNFGRTRIIS----------------PRMGAKALLANLH
A2F2W8_TRIVA      HPTEAKSLKHINFEEFYQREGG--------------------------PRKYNTNLKILK
C4M4C5_ENTHI      HPEKGRRVRQAFDNMKGKHCGT--------------------------MFSLQYKIRLLA
F4P011_BATDJ      NPHKSRHFKKDQFSETRS------------------------------NMVVKGKLKVLS
A8IU90_CHLRE      HPERSLIVRPIAQALGRQR-----------------------------MQGVRGKILLML
SLX1_PICGU        HPKTSRHMAGGGGSVTATAETAKSAPVAGKSDATSPAKNR--RNAAPVARSGRTHLRNVA
SLX1_GIAIC        YPTRSRYVNCISATSQKLRLAC--------------------------PRSISTALDVLV
SLX1_CRYNJ        KPELSRHLRIRGEDQEYYHIFTKD----------------------ARRNWVERKVCVAY
E3KL57_PUCGT      TPYKSRHLQAVKPTKEDSKQTELDSTGAIAGKAPTATQTKKPMFPRSTGNRVEVKLKVLR
SLX1_MONBE        HPLKSRRLRDAVRSDLPASRAA--------------------------QMQLTAKLHTLA
SLX1_MALGO        KPHASRHLRVMHDDGTRPNKS---------------------------SATAAVYAGRSS
SLX1_CRYPI        HPNICKVTRDNIESWKIVKTKKTSENKRILN---------------KRQWSIQQRVSILL
                                                                              

SLX1_HUMAN        HMLRAPPWARLPLTLRWVRPDLRQDLCL------------------PPPPHVPLAFGPPP
G1QJU5_NOMLE      HMLRAPPWVRLPLTLRWLRPDLRQDLCL------------------PPPPHVPLAFGPPP
G1MA10_AILME      HMLRAPPWARLPLT-----ADFRRELCP------------------PPPPHMPLAFGPPP
SLX1_BOVIN        HMLRAPPWVRLPLTLRWLRADFRQDLCP------------------PPPPHMPLAFGPPP
I3MYV3_ICTTR      HMLRAPPWARLPLTLRWLRQDFRQDLCP------------------PPPPHVPLAFGPPP
G1Q3M3_MYOLU      HMLRGP-WARLPLTLRWLRADFRQELCL------------------PPPPHVPVAFGPPP
SLX1_MOUSE        HMLRVPPWVRLPLTLRWLRPDFRHELCP------------------APPAHMPIAFGPPP
SLX1_RAT          HMLRVPPWVRLPLTVRWLRPDFRHELCP------------------APPPHMPIAFGPPP
H0XMG2_OTOGA      HMLRAPPWARLPLTVRWLRPDFRRDFCL------------------PPPPHVPLAFGPLP
SLX1_XENLA        HMLRVAPWNRLPLTLRWLRQEYRRELPLL----------------LQPPLHMPLAFGQVR
F6YWF0_XENTR      HMLRVAPWNRLPLTLRWLRQEYRRELPLL----------------LQPPLHMPLAFGQVR
H3A9L3_LATCH      HMLRAAPWCRLPLTIRWLKQEYRRDFAPG----------------LEPPLHMPIAFGQVR
H3CIK9_TETNG      NMLQVAPWNRQPLTARWLKQEFKMDFEPH----------------LQPPMHIPIAFGSVT
B7PW25_IXOSC      HMLRVGPWTRLPLTVQWLMEEYRLDFQTS----------------LAPPPHMAIAYGPVK
E9GYI3_DAPPU      HMLRIGPWNRLALTIQWLVPKYRVEFETS----------------LLPPPHMPIEEGRVI
SLX1_NEMVE        ELLRVGPWNRLPLHIRWLMREYEMEFDPR----------------CLPPFHMTVVYGPLV
SLX1_DROPE        RMLGVGPWHRLALTIRWLETDYERAFD------------------LPIPCHMEIVSGKVS
SLX1_DROPS        RMLSVGPWHRLALTIRWLETDYERAFD------------------LPIPCHMEIVSGKVS
SLX1_DROAN        RMLGVGPWNRLALKIRWLETDYERGFE------------------VPLPRHMEIVSGKVS
SLX1_DROME        NMLGVGPWNRLPLTVRWLETDYERPFS------------------KALPKHMEIVSGKVS
SLX1_DROSE        HMLGVGPWNRLPLTVRWLETDYERPFS------------------KTLPNHMEIVSGKVS
SLX1_DROER        HMLGVGPWNRLPLSVRWLETDYERPFN------------------MPLPNHMDIVSGKVS
SLX1_DROGR        RMLGIGPWHRLPLTVRWLESECERGFV------------------VPLPPHVRIVSGKVA
SLX1_DROMO        RMLGVGPWHRLPLTVRWLETDYEREFQ------------------LPLPRHMRIVSGKVA
SLX1_ANOGA        EMLRMGPWNRLPLVVRWFADEFHREFEARR---------------LTLPVAAFRAREHAS
SLX1_TRYB2        LLLRTELFSRLQLTLHIFDREHFDKVISQL---------------LSALPTMEPLVETSL
D6XD30_TRYB2      LLLRTELFSRLQLTLHIFDREHFDKVISQL---------------LSALPTMEPLVETSL
SLX11_TRYCC       LLLRADLFARLQLTLHIFEPERVGRVVAEL---------------QGRVPSISPLVATSL
SLX12_TRYCC       LLLRADLFARLQLTLHIFEPEHVGRVVAEL---------------QGRVPSIPPLVATSL
V5AT06_TRYCR      LLLRADLFARLQLTLHIFEPERVGRVVAEL---------------QGRVPSIPPLVATSL
Q682H4_ARATH      TMLNLPAWNSLNLTVNYFSSKYAHHGGKS----------------PSLPLHMKVQVCAME
F6GUC5_VITVI      TMFTLPAWQSLNLTVNFFSTKYTKHSAGC----------------PILPEHMRVQVSPMD
C5XDH1_SORBI      TMLNLPSWENLNLAVNFFSSKNTKFTAGC----------------PSLPSQMKTVVCAME
SLX1_SCHJY        VMLCCEAWSRWGLRVAIFDDAVHRLWLKER---------------LPSNCIQLCSFDDVE
SLX1_SCHPO        HLVDSDTWRRWPLNITFLNKTAFSKW--NQ---------------LGKTYGNINVYFDEE
SLX1_PARBP        LLLRSPYFSKWPVEVRFFSADVHRVWQVWLQRVDGLLN-------DGIRVVTDFAL----
SLX1_PARBD        LLLRSPYFSKWPVEVRFFSADVHRVWQVWLQRVDGLLN-------DGIRVVTDFAL----
SLX1_PARBA        LLLRSPYFSKWPIEVRFFSADVHRVWQVWLQRVDGLLN-------DGIRVVTDFAP----
SLX1_AJECG        ILLRSPYFSEWPLEVWFFSADV---WQVWSQPKGNLLD-------NSIKVVTAFSS----
SLX1_TALMQ        QLLRSTYFGTWPLTVRFLSTEAHSHWQRWTERADGLLP-------DTIHVELDFHA----
SLX1_TALSN        QLLRSTYFGTWPLTVRFLSSEAHNHWQRWIERADGLLP-------DTIRVKLDFRA----
SLX1_CHAGB        LLLRVPSFARWPLCVQFFNRDAFAAWEK----------WCAGVSLGERGLRESWKV--VT
SLX1_PODAN        LLLSVPSFARWPLRVHFFKRDVHAAWGR----------WCGKV---ERELRGSLPV--VT
SLX1_NEUCR        MLVGVRSFGRWPLRVHFFEEDVWRVWERG-----G---WKAKSGGGGVGELGDLKVEVVT
C7YV24_NECH7      LLTNVPSFARWPLTVHFFASEPKKAWDK----------WLQSI---DAVPRQGMNV--FT
SLX1_BOTFB        ILLTVPSFSRWPLEIKFFAPDVHRAWLK----------WSKAA---TGSLRDTLPI--IT
SLX1_PHANO        HLLSVDSFCRWPLNLRFFAPDVFVQWER----------HTTKM---TTTLRKSITIQLTP
SLX1_PYRTR        HLLGVGSFSRWPLHVRFFAPDVFSQWEK----------HISKM---NTSLRKSITIRLTP
SLX1_ASPFU        RLLRSTYFSHWPLKIRFFSGDIYQSWKAWY---------------DRVDVRLRSPVKVIL
SLX1_ASPFC        RLLRSTYFSHWPLKIRFFSGDIYQSWKAWY---------------DRVDVRLRSPVKVIL
SLX1_NEOFI        RLLRSTYFSHRPLKIRFFSGDIYQSWKAWY---------------DRVDVRLRSPVKVIL
SLX1_ASPCL        RLLQSPYFSNWPLRIRFFSADVYQSWKAWY---------------DRVDIFLPGHVNILL
SLX1_PENRW        SLLRSTYFSSWPLRVRFFCADVYRVWRAWN---------------DRVDSRLPDMIKVIL
SLX1_ASPNC        LFLRSTYFSKWPLRLRFFNRDVYQLWTTWC---------------DRVDALLPEHVRTIL
SLX1_ASPOR        ALLRSTYFSGLPLRVRFFADDVHQLWRVWS---------------DRIDGFIPEHIKVIP
SLX1_ASPTN        SLLQSPCFSRWPLNIRIFASDVYQLWRVWC---------------DRANGTIPEHIRTIP
SLX1_EMENI        LLLRSTYFKEWPLSLRFFAADVSQQWRWLC---------------GRVNESIPTHIKMVA
SLX1_ASHGO        LLLHHPFFKVMSLVVHLFSEDIQRVWFLDKYKLEAPF------IHVEVDE------DALS
SLX1_CANGA        SLLKNEYFRYMDLTLHFFNQKVEEIWKNDKFNVSQTQESIDNNYTVSLSQ------DALT
SLX1_YEAST        LLLKHEFFQRMNLIVEVFNIKAWEVWKQDKFFIERDR----FPINIQINE------NALE
SLX1_YEAS7        LLLKHEFFQRMNLIVEVFNIKAWEVWKQDKFFIERDR----FPINIQINE------NALE
SLX1_YEAS6        LLLKHEFFQRMNLIVDVFNIKAWEVWKQDKFFIERDR----FPINIQINE------NALE
SLX1_YEAS1        LLLKHEFFQRMNLIVDVFNIKAWEVWKQDKFFIERDR----FPINIQINE------NALE
SLX1_VANPO        QLLANVYFRHMNLKVHFFSMPILDVWNLNKFNIKMGS----NEISVDVSQVSQETKTNLE
SLX1_KLULA        LLMKHPYFDKMNLHIRFFDRLAWESWELNKFKVDYGL------SLCEVDE------AVLT
SLX1_CANDC        LLTTS--FDKMSLKIAIFDEEVYRMWVENKH-----------------------KIECNV
Q5A4X4_CANAL      LLTTS--FDKMSLKIAIFDEEVYRMWIENKH-----------------------KIECSV
SLX1_DEBHA        LLLGSSFFSRMGLKVLLFDPEVHSAWCINKFGV---------------------NVTDNV
SLX1_PICST        LLLRSSYFRHLPLKVLVFEEAVYNSFMNNKF-----------------------VTCSHV
SLX1_YARLI        LLVRCSYFRRMHLRITFFRSHAHEAWEKNDYDV-----------------------GSLP
A9TJN0_PHYPA      TMLNCDKWSAMDLNVQFFSSKYIDYRKGCPGLPPHMGLSIAPVESLPVTAEEADSELDME
D5GJR5_TUBMM      LLLRVPAFARWPLSVRFFAEDLYVAWEAHCGTRCGPL--------KAVEVKLDLRKSESS
A2F2W8_TRIVA      EMLLSQQWNRLSLRICVQCKDVYEMLLQPP----------------VLPQHIKIELGSIN
C4M4C5_ENTHI      EILQMPAYCKLPLSVYITTHRYDNFLNDCP----------------PLPKQITVEYGDLN
F4P011_BATDJ      KMLHLEYWARWPLKIQFTVLDVQEMFKTFQ----------------APPPHIVVTFGSVS
A8IU90_CHLRE      SMLHESPWRHFPLTLQYLAPHRHMLYCATCASPFHLDCMAARWAATAVPAAADAAVAWSA
SLX1_PICGU        RLLESPYFSRMGLKVTIFDPSLFDMDLLPA----------------QLQSFAAFSGARTA
SLX1_GIAIC        TLLIHPPFSLQPLYVVLLDAEGNRVKSQLEQ--------------HSVPVFVSTMEALQI
SLX1_CRYNJ        ALISLTPFNRLPLHVRFFNHETHGIWQSIHEQAGVNTIQRGKSRAKPVNPLHLLSQSVAP
E3KL57_PUCGT      KMMTTLPWSQYPLKVLFFDESAYRLWLEQAKPP------------KSVSKQTSTTSDTLG
SLX1_MONBE        AMLYTVPWSDQPLTLCWLQPDIADKWSNIWQRHCQCQ--------SALPPFLTTRSGNLQ
SLX1_MALGO        KPLFPATRSSAPSSAASHDSGLNLRKKNRR----------VRMRSSTVPEYKFLVLRALL
SLX1_CRYPI        CMTTLEPWKNMNLTVFVFKDELENTIKEVIEGIKKIKISPNFTSPNILNKDYLLMFLYFG
                                                                              

SLX1_HUMAN        PQAPAPRR----------------------------------------------------
G1QJU5_NOMLE      PQAPAPRR----------------------------------------------------
G1MA10_AILME      PRAPAPRS----------------------------------------------------
SLX1_BOVIN        PRAPPPRS----------------------------------------------------
I3MYV3_ICTTR      PRAQLPKR----------------------------------------------------
G1Q3M3_MYOLU      PRMLAPKR----------------------------------------------------
SLX1_MOUSE        PQPLVPKR----------------------------------------------------
SLX1_RAT          PQPLVPKR----------------------------------------------------
H0XMG2_OTOGA      PRGFVSRP----------------------------------------------------
SLX1_XENLA        ARPIPKGEKE-------------------------------------------------K
F6YWF0_XENTR      ARPISKGQ---------------------------------------------------K
H3A9L3_LATCH      AKPR--------------------------------------------------------
H3CIK9_TETNG      AKKS--------------------------------------------------------
B7PW25_IXOSC      AVRS--------------------------------------------------------
E9GYI3_DAPPU      SKKVPSPS----------------------------------------------------
SLX1_NEMVE        SRKAKQ------------------------------------------------------
SLX1_DROPE        ISASQRK-----------------------------------------------------
SLX1_DROPS        ISASQRK-----------------------------------------------------
SLX1_DROAN        ISSSQRR-----------------------------------------------------
SLX1_DROME        ISASQRR-----------------------------------------------------
SLX1_DROSE        ISASQRR-----------------------------------------------------
SLX1_DROER        ISASQRK-----------------------------------------------------
SLX1_DROGR        ITAKQ-------------------------------------------------------
SLX1_DROMO        ITTSQRAL----------------------------------------------------
SLX1_ANOGA        QSTAQKC-----------------------------------------------------
SLX1_TRYB2        LRVESTTIEQFQTQYMN--DGQWGAAVDYGAYFMRAPPGANVDVSKPIVGGQDNTLRCGV
D6XD30_TRYB2      LRVESTTIEQFQTQYMN--DGQWGAAVDYGAYFMRAPPGANVDVSKPIVGGQDNTLRCGV
SLX11_TRYCC       LRIEEITKERFMSLYLDGVSG-DGTAGDGCVYFVTAPLSSQPDVDAPS--------RRVR
SLX12_TRYCC       LRIEEITKERFMSLYLDGVSGGDGTAGDGCVYFVTAPLSSQPEADAPS--------RRVR
V5AT06_TRYCR      LRIEEITKERFKSLYLDGVSGGDATARDGCVYFVTAPLSSQPDVDAPS--------RRVR
Q682H4_ARATH      DLQYFTKVDDS--SQPEDEESPEVNEEDDDDD-------------------------DDD
F6GUC5_VITVI      ELPCYSGSDQSFFDNARGDEKEELGERGSSSDGFDQVI-------------------AHE
C5XDH1_SORBI      DLQCQQADGPS--SEEDGNDIRDPEEPQDNDE-------------------------ELS
SLX1_SCHJY        SLRLADYG----------------------------------------------------
SLX1_SCHPO        WLNGFHEK----------------------------------------------------
SLX1_PARBP        -------------------------------------DGISEVERKELLAGAGRVGTLDV
SLX1_PARBD        -------------------------------------DGISEVERKELLAGAGRVGTLDV
SLX1_PARBA        -------------------------------------DGISEVEGKELLAGAGRVGTLDV
SLX1_AJECG        -------------------------------------KEAGDTNRREILGK--RIETLDT
SLX1_TALMQ        -------------------------------------EGASVLDSN---LPANDMTHINA
SLX1_TALSN        -------------------------------------EGASVLDSN---LPANDMTHIDA
SLX1_CHAGB        DFGE---GVTSGGS----------------------GEVAAAEGEDEA-PAPWGIHALPL
SLX1_PODAN        DFGEDEGAVVARASASEP--------------LGVVGEGLDGDGGGEE-VPTWGIYGLPL
SLX1_NEUCR        DFGSPTAPQGAGVIGMGE--------------EAENDPHDDDDGDDAQDENKHGIYALPL
C7YV24_NECH7      DFGP------------------------------------SKETQRESSPAPWGIYALPL
SLX1_BOTFB        DFPP--------------------------------AESQVNDEDGEITDRPYGIEALNV
SLX1_PHANO        AEIP--------------------------------KLASDVSTELQTHFIPEVIRAIPV
SLX1_PYRTR        AELP--------------------------------KLAPDVSSEMRTHFIPEVIRAIPV
SLX1_ASPFU        DGSC--------------------------------PEISAHTGGND--TRFGGVENAKI
SLX1_ASPFC        DGSC--------------------------------PEISAHAGGND--TRFGGVENAKI
SLX1_NEOFI        DGSC--------------------------------PEIGAHASGND--TRFGGVENAKI
SLX1_ASPCL        DGSC--------------------------------PENSAQCSAVG--ARFGSVEQAKV
SLX1_PENRW        DGDN--------------------------------LATAPDTNQRDGHAPVGNINNLSI
SLX1_ASPNC        DGDC--------------------------------PKDH-LSWADE--PRVGSVEHIKV
SLX1_ASPOR        DGSC--------------------------------FENR-QPGIEY--LRVGSVEHIQV
SLX1_ASPTN        DGNC--------------------------------PHNSPEPETDH--PRVGSIDGIQT
SLX1_EMENI        DGNC--------------------------------ADTSPQCDHSL---GVGSVREIGV
SLX1_ASHGO        EPTG--------------------------------EDEESVIEHAKK-NLRLVELFYGR
SLX1_CANGA        EINN--------------------------------DTIDDIMDVNEK-NMELVQNLYST
SLX1_YEAST        EPKE--------------------------------KTVDVLMDHSDE-NLKVVEAVYTK
SLX1_YEAS7        EPKE--------------------------------KTVDVLMDHSDE-NLKVVEAVYTK
SLX1_YEAS6        EPKE--------------------------------KTVDVLMDHSDE-NLKVVEAVYTK
SLX1_YEAS1        EPKE--------------------------------KTVDVLMDHSDE-NLKVVEAVYTK
SLX1_VANPO        QASD--------------------------------DDDDNGACSRDERNLQLVTELYDN
SLX1_KLULA        D--------------------------------------ESQLDELDELNLERIKAFYED
SLX1_CANDC        PCTL--------------------------------FKFDEFCN----------------
Q5A4X4_CANAL      PCTL--------------------------------FKFEEFCD----------------
SLX1_DEBHA        QVNV--------------------------------TRFEDYFSRDNN-D-ESSGFSLSR
SLX1_PICST        DLLN--------------------------------TNFNEYFSVMEK-DLDSTVDSWKT
SLX1_YARLI        PQFQ--------------------------------VETDYPSDEAEAPPSTVGSGELDI
A9TJN0_PHYPA      MEKETERGGSRETSNVEG--------SRDELFDVESRSFDFEEDDLNPPIVPQDCWSNGT
D5GJR5_TUBMM      RSPSPPPN-----------------------------RRTGCKVKQFSPTGEGGLQGLDI
A2F2W8_TRIVA      DLPI--------------------------------------------------------
C4M4C5_ENTHI      DIMKCVGIARIDRKEK--------TKIKHDNIFDNLHGTSQSQLSQLIEDFHLDDKTSQE
F4P011_BATDJ      TVNV--------------------------------------------------------
A8IU90_CHLRE      GGGGGGSR-----------------------------------------FGGVPEQGSCP
SLX1_PICGU        ACSD--------------------------------------------------------
SLX1_GIAIC        EPGV--------------------------------------------------------
SLX1_CRYNJ        AVTIILDLGGVSGTSG--------------------KRRECTKGVMSHEGPIDVKDVEFR
E3KL57_PUCGT      VSVHPIEVTFRP----------------------EGVDGMRKDRHTIPSSPDDQRKPIEV
SLX1_MONBE        DPLFQLNN--------------------------------------AAAAASTIQRAALA
SLX1_MALGO        ASEPFCFW---------------------------------HLHVGFYSEYAYGVWQFMD
SLX1_CRYPI        EDSFYEKG----------------------------IKFLRCDYETFKEFQKPSFDCDSD
                                                                              

SLX1_HUMAN        -----RAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPL--------------------
G1QJU5_NOMLE      -----RAGPFDDAEPEPDQGDPGACCSLCAQAIQDEEGPL--------------------
G1MA10_AILME      -----RSGTSADAESEPDQG-TEACCALCALSFQDEEGPL--------------------
SLX1_BOVIN        -----QAGPSDDMGFEPQQD-VDVRCTLCARALQDEESPL--------------------
I3MYV3_ICTTR      -----CAGPVVDRELEKDPG-AQSCCTLCSRTLEDEDSPL--------------------
G1Q3M3_MYOLU      -----PARPFADTEPQPDQD-AEAPCTLCARALQDEEGPL--------------------
SLX1_MOUSE        -----PAVSEADSERQLDLG-TKARCSLCARLLQDEEGPL--------------------
SLX1_RAT          -----PAASEADSERRLDLG-AKASCTLCARMLQDEEGPL--------------------
H0XMG2_OTOGA      -----RASPCADTAPE-----LEAVCTLCAGAFQDEEGPL--------------------
SLX1_XENLA        GRLGENRAEETEQEVILLGDAVVQRCRVCYERVQDKDDSL--------------------
F6YWF0_XENTR      GRLGETGEGESARGVM---PPAPQRCRVCYEWVQDKDDAL--------------------
H3A9L3_LATCH      -----EKQGEEERHDM-----TKVRCRVCCRKFGSEDETL--------------------
H3CIK9_TETNG      -----QQADLSPEETI-------FKCFLCKGLVK-VPEKL--------------------
B7PW25_IXOSC      -----HAQRSIEQDDI----QVMPLCCVCNTAIQSRKSTA--------------------
E9GYI3_DAPPU      -----KEKASTKSSSS------SEKCDICHQIMD-NDDVL--------------------
SLX1_NEMVE        -----KAVSSEDQRPD-----HKEKCIKCLDVIKIDEKLI--------------------
SLX1_DROPE        ----LEEATGTAPPVA-----WAHECHLCMQSIEQPERSR--------------------
SLX1_DROPS        ----LEEATGTAPPVA-----WAHECHLCMQSIEQPERSR--------------------
SLX1_DROAN        ----KGEDAAATVPVA-----WAPECHLCMQRIDQPERSR--------------------
SLX1_DROME        ----RPDDAVPPPPVA-----WASECHLCMQEMEQPEKSR--------------------
SLX1_DROSE        ----RPDDAVPPPPVA-----WASECHLCMQQIEQPEKSR--------------------
SLX1_DROER        ----RTDDAEVPPPVA-----WASECHLCMQQIEQPERSR--------------------
SLX1_DROGR        --------PEQAVASN-----RSLECHLCMQRVEPAERCRL-------------------
SLX1_DROMO        --AVKRTAAAAAATAS-----WSSECHLCMQRIEHPERSR--------------------
SLX1_ANOGA        --------TICAGELM-----LEQEKEEEKENAERRQGDLV-------------------
SLX1_TRYB2        MHNNLCEEEVIRQHVKERTLLESGHYPCSLCSLPLRAPYFL-------------------
D6XD30_TRYB2      MHNNLCEEEVIRQHVKERTLLESGHYPCSLCSLPLRAPYFL-------------------
SLX11_TRYCC       SCRYLSEEDVFRQHARVKELLEANQCPCALCSLPLRSPYFV-------------------
SLX12_TRYCC       SCRYLSEEDIFRQHARVKELLEANQCPCALCSLPLRSPYFV-------------------
V5AT06_TRYCR      SCRYLSEEDIFRQHARVKELLEANQCPCALCSLPLRSPYFV-------------------
Q682H4_ARATH      SSNLSQPGNSNTSSSDDRHFEKAKEPVTVFDEEDRLANFSG-------------------
F6GUC5_VITVI      ETALEQFGWIEEHGLRQPGDSPSPEVVHCSGKTQENAMRQP-------------------
C5XDH1_SORBI      DSSLRDGYSYSDHCFQQP---SSDDQVQPMDEQTGTAGSDV-------------------
SLX1_SCHJY        ----GDAGWLDTQRKKRAQLSVQAQCSICVRAILLPCFFL--------------------
SLX1_SCHPO        ----VIQKTYDHKLCLRKTISEPVKCNLCYECIESDELRA--------------------
SLX1_PARBP        GYNSIKEYVEKSQ-FLLEDG-ERINCGV--------------------------------
SLX1_PARBD        GYNSIKEYVEKSQ-FLLEDG-ERINCGVCKQRLILQHD---------------------I
SLX1_PARBA        GYNSIKEYVEKSQ-FLLEDG-ERINCGVCKQRLILQHD---------------------I
SLX1_AJECG        GYDALIEYVEKSQ-FLLESE-EAIDCGVCKQRLNPRND---------------------M
SLX1_TALMQ        TYSGIQDHLEKSA-SLLNDSAKTLACEVCKKLLSPHGD---------------------V
SLX1_TALSN        TYGGIQEHLAKST-SLLGDNTNSLSCEVCQQQLSTQTE---------------------I
SLX1_CHAGB        DYEPMKEYVAKGQ-EIFEFE-RQGRCVVCREEMKSGEG---------------------L
SLX1_PODAN        DYAPLKEYVAKGQ-DIFEFE-RQGSCVVCKEEIDPEEGG--------------------L
SLX1_NEUCR        DYAPIKDYVAKSQ-EIWEFE-RQGSCVVCKEAMVAGRG---------------------L
C7YV24_NECH7      DYAPMKGYIEKAH-NVVSFE-REGKCVHCHEELESGKG---------------------L
SLX1_BOTFB        AYEDTKSHLEKGE-RIFHSE-MKESCNICNQDLQHNSG---------------------L
SLX1_PHANO        AYEDCKQYIEKSR-RVLEDD-QRLGCGVCKNPADMSSS---------------------L
SLX1_PYRTR        AYEDIKPYVEKSM-STLRDG-KTRDCGVCKKDVNVDRS---------------------L
SLX1_ASPFU        TYAAIRDYIEKAI-FLLDDP-KDVRCHVCQGQIVPTEE---------------------L
SLX1_ASPFC        TYAAIRDYIEKAI-FLLDDP-KDVRCHVCQGQIVPTEE---------------------L
SLX1_NEOFI        TYATIQDYIEKAI-FLLDDP-KDVRCHVCQGQIVPKEE---------------------L
SLX1_ASPCL        NYDIIQDYLEKAM-FLLDDP-KDLSCRVCQTQIAPKEQ---------------------L
SLX1_PENRW        DYTRLEDHLEKSM-FMLDDP-DDLQCTVCKESISPNEE---------------------Q
SLX1_ASPNC        DYSDIYDYVEKSH-FLLDDP-SDLRCKICQAKIALSEE---------------------L
SLX1_ASPOR        DYSKIHSYLEKTT-FQLDDP-EDLQCKVCQAPVVPKEE---------------------L
SLX1_ASPTN        DYSKIQDYLEKAV-FLLDDP-NELHCKVCEAQAKPEKE---------------------L
SLX1_EMENI        DYTPIRDYLEKAT-FLLDDM-RGSYCKICKEQYV-DND---------------------W
SLX1_ASHGO        SLKEDSECLEEYRRRLQNG---AMRCAICEKIVDYVKDSDSFS------------SEKEL
SLX1_CANGA        TLAEKTKTLLLYKEKIDTG---INTCQFCNKIIKHNLSGN---------------ISENL
SLX1_YEAST        VIENERNIFETFEKKLTTG---VVRCEICEKEIDYTSEEQ---------------NLKPF
SLX1_YEAS7        VIENERNIFETFEKKLTTG---VVRCEICEKEIDYTSEEQ---------------NLKPF
SLX1_YEAS6        VIENERNIFETFEKKLTTG---VVRCEICEKEIDYTSEEQ---------------NLKPF
SLX1_YEAS1        VIENERNIFETFEKKLTTG---VVRCEICEKEIDYTSEEQ---------------NLKPF
SLX1_VANPO        TVTKENEIKEIIKDILVLG---ERNCNLCGQCYDYTSEDD---------------TMKMH
SLX1_KLULA        QMAQESSLLQRYQDNLTYD---QKSCMICDKKIDYIHDEG-----------------TQM
SLX1_CANDC        --SIQEIDIEDAKNILLGK---QLDCMVCKASIDYFKDSTPNISSREELSNYLAKGNYPL
Q5A4X4_CANAL      --SIKEIDIEDAKNVLLSK---QLECMECRVSIDYFQDNTPNISSRQELSNYLSKGNYPL
SLX1_DEBHA        QKESERIYFESSKKILFFD---NQPCFICNETIDYQSESEVSFSSKLDVDAYLREGNMPL
SLX1_PICST        RHTNENEIWSMAKEAVILG---SPRCALCLEPIEQVPETSSPISKRSDLQRYLQSESLPL
SLX1_YARLI        NNRSIEEYLQKCRDAVSNDK--QLTCYLSEKTLNISEGN---------------------
A9TJN0_PHYPA      GRVESLDRAKKQSKLPDASKFEGTSASLYTSSISQPLVISTKVSGTLEEVEAENLRDRRQ
D5GJR5_TUBMM      TNRHLDRHMQKARDLLRDED---IKCGVCAGGVSHDGGATA-------------------
A2F2W8_TRIVA      ----------DSHGFPSPGEYGNTPCPLCNESEPPYNMNW--------------------
C4M4C5_ENTHI      VTVTEEQKKIQMQKELKEIQNTSSNCFICQQRIKLDQRIV--------------------
F4P011_BATDJ      ----------GIVSPDIPDLQTETDCIICYETLNLQDQSS--------------------
A8IU90_CHLRE      ACGAAHTWMELLRGMQTVGWGNKSGRRQSIALSSSASPSPS-------------------
SLX1_PICGU        YFSVAKKAALTTAHCCLCSDAIDYVPEMLPESIKDVLLVLP-------------------
SLX1_GIAIC        RAPSDIIYAQCTSSNGTTDTTFTDVCPICQDGVSPSN-----------------------
SLX1_CRYNJ        QGFGVRGKWLEIRKRILSGQ--DLCCHLCQERIAFNDHLTF-----------------SI
E3KL57_PUCGT      HDEEAVLEDYEKIELIKKRCNGDLKCFLCDQSIDVEDHLSY-------------------
SLX1_MONBE        ADHHAWRLAAAAQAQAPDFFTGLGRLDLAAPSVEESGAGPH-------------------
SLX1_MALGO        RANPTRYSVSRITRRPLPPSYPPVACDFRGVQGTNTPLAPP----------------QDA
SLX1_CRYPI        SNIEDNSNVFNPEEIISHEDSFSIKCFLCQKDIGIGRNYLEFPCC----------TEIKV
                                                                              

SLX1_HUMAN        --CCPHPGCLLRAHVICLAEEFLQEEPGQ-------------------------------
G1QJU5_NOMLE      --CCPHPDCPLRAHVICLAEEFLREEPGQ-------------------------------
G1MA10_AILME      --CCPHPGCRLRAHVICLAEEFLQEEPGQ-------------------------------
SLX1_BOVIN        --CCPHPGCSLRAHVICLAEEFLQEEPGQ-------------------------------
I3MYV3_ICTTR      --CCPHPGCPLKTHVICLAEEFLQEEPGQ-------------------------------
G1Q3M3_MYOLU      --CCPHPGCSLRAHMTCLADEFLQEEPGQ-------------------------------
SLX1_MOUSE        --CCPHPGCPLRAHIICLAEEFLQEEPGQ-------------------------------
SLX1_RAT          --CCPHPGCPLRAHIICLAEEFLQEEPGQ-------------------------------
H0XMG2_OTOGA      --CCPHPGCRLRAHVICLAEEFLQKEPGQ-------------------------------
SLX1_XENLA        --HCFHPGCTLTAHIMCLAKLFLLNEPQN-------------------------------
F6YWF0_XENTR      --CCFQPGCTLTAHILCLAKLFLLKEPQS-------------------------------
H3A9L3_LATCH      --QCFHANCAMTTHIVCLAREFLKTEPEH-------------------------------
H3CIK9_TETNG      --SCFHPFCDMRSHVICLAKHFLKSESSH-------------------------------
B7PW25_IXOSC      --RCIHPGCTATSHLSCLAKLFLQGDSKS-------------------------------
E9GYI3_DAPPU      --NCINNDCTLKTHILCLASHFLKSEPDH-------------------------------
SLX1_NEMVE        --RCPKSGCTMTAHMFCLARDFLHCGNEGGLF----------------------------
SLX1_DROPE        -LGCTNPTCRLTCHMLCLASYLLGDEPGQ-------------------------------
SLX1_DROPS        -LGCTNPTCRLTCHMLCLASYLLGDEPGQ-------------------------------
SLX1_DROAN        -LGCTNPTCRLTCHMLCLANYLLGDEPGH-------------------------------
SLX1_DROME        -LGCTNQMCRLTCHMVCLANYLLGDEPGH-------------------------------
SLX1_DROSE        -LGCTNQMCRLTCHMVCLANYLLGDETGH-------------------------------
SLX1_DROER        -LGCTNQMCRLTCHMMCLANYLLGDEPGH-------------------------------
SLX1_DROGR        -LGCLRASCPLTCHMLCLASYLLGDQPGQ-------------------------------
SLX1_DROMO        -FSCLNASCCLSCHMLCLASYLLDDQPGQ-------------------------------
SLX1_ANOGA        -LRCLQSRCPLACHVECLAELVL--EPGQ-------------------------------
SLX1_TRYB2        -RCSRTPFCRLRAHIVCLAMWFIYDSSQRGGDPLVKDAGPAEVAENSNDAACQVNENCYS
D6XD30_TRYB2      -RCSRTPFCRLRAHIVCLAMWFIYDSSQRGGDPLVKDAGPAEVAENSNDAACQVNENCYS
SLX11_TRYCC       -RCYRTPFCALRAHLACLAMWFTYETMQKRDVTMGQSTRNERSGEYSNKIKDDSNDGTMD
SLX12_TRYCC       -RCSRTPFCTLRAHLACLAMWFTYETMQKRDATMGQSTRNERSGEYSNKIKDDSNDGTMD
V5AT06_TRYCR      -RCSRTPFCSLRAHLACLAMWFTYETMQKRDVTMGQSTKNERSGEYSNKIKDDSNDGTMD
Q682H4_ARATH      -FGLLDEEETVEDEVSHITVGSIRATEKEP------------------------------
F6GUC5_VITVI      -ADLSTSKDEHRSPFCLID-SPVRTSSHST------------------------------
C5XDH1_SORBI      -EDDLADELAPAMGWSQLL--EARRELNGP------------------------------
SLX1_SCHJY        --CCPFPDCRMIAHSTCLAASFLQEAQDDE------------------------------
SLX1_SCHPO        --NCPFTDCNSINHLTCLASSFLTEEC---------------------------------
SLX1_PARBP        ------------SHLSCLSSHFLKDKD---------------------------------
SLX1_PARBD        IAVCSHSSCHCAAHLSCLSSHFLKDKD---------------------------------
SLX1_PARBA        IAVCSHSSCHCAAHLSCLSSHFLKDKD---------------------------------
SLX1_AJECG        IAICSHSLCRCASHLLCLSAHFLEAAG---------------------------------
SLX1_TALMQ        IVVCSQPHCHAVSHVKCLSQLFLRDEG---------------------------------
SLX1_TALSN        IVVCSHRRCHAVFHVNCISQLFLEDEG---------------------------------
SLX1_CHAGB        HAVCTHEGCDGVGHISCWSRSFLKNND---------------------------------
SLX1_PODAN        HAVCSNEGCEGVGHLRCWGRYLLKSEEG--------------------------------
SLX1_NEUCR        YAICPNTSCEAVGHLDCWSRCLLKQETRRMKI----------------------------
C7YV24_NECH7      HPMCPNGRCEAMGHLDCWSKHALKGED---------------------------------
SLX1_BOTFB        YTICPNINCHSITHMTCLSQHFLRAEKNE-------------------------------
SLX1_PHANO        ILVCPIEACQTVSHLSCLSNKFLTEGGE--------------------------------
SLX1_PYRTR        VLICPNETCCSVSHMSCLSQRFLAEEAN--------------------------------
SLX1_ASPFU        TTVCPQAECHCTCHLLCLSRKFVDAALE--------------------------------
SLX1_ASPFC        TTVCPQAECHCTCHLLCLSRKFVDAALE--------------------------------
SLX1_NEOFI        TTVCPQAECHCTCHLLCLSRKFIDAAEE--------------------------------
SLX1_ASPCL        AVVCPQAGCHCTCHLLCLSKKFLDAMPE--------------------------------
SLX1_PENRW        IVVCPHPNCRGTSHLLCLSTKFLDATNE--------------------------------
SLX1_ASPNC        ALVCPRASCYCISHLLCLSSRFLDHAEE--------------------------------
SLX1_ASPOR        VLVCPQTRCYCVSHLLCLSARFLDSTKD--------------------------------
SLX1_ASPTN        VIVCPQASCFGISHLLCLSARFLKSSND--------------------------------
SLX1_EMENI        AVVCPEADCTSTTHLLCLSRTFLDATED--------------------------------
SLX1_ASHGO        VAFCYNSVCDYFSCLSCLYNVFAS---DEELR----------------------------
SLX1_CANGA        FAFCRDTSCTFVSHLACAYRYFMS---NTELP----------------------------
SLX1_YEAST        VALCNNKDCGCVNHLKCLHRYFLD---DEQLM----------------------------
SLX1_YEAS7        VALCNNKDCGCVNHLKCLHRYFLD---DEQLI----------------------------
SLX1_YEAS6        VALCNNKDCGSVNHLKCLHRYFLD---DEQLI----------------------------
SLX1_YEAS1        VALCNNKDCGSVNHLKCLHRYFLD---DEQLI----------------------------
SLX1_VANPO        IFICPNSTCHYEAHLNCLYEKFIE---EESGI----------------------------
SLX1_KLULA        VGFCSDDECDFLSCLSCLYKEFTK---NSK------------------------------
SLX1_CANDC        IGICGD----HAFHLSCIARQRG-------------------------------------
Q5A4X4_CANAL      IGICGD----HAFHLSCMARQHG-------------------------------------
SLX1_DEBHA        LAICYHENCRKLYHLSCLGLHFLEKGDELSNK----------------------------
SLX1_PICST        VTMCYNPQCRDVFHLSCLGHRFT-------NS----------------------------
SLX1_YARLI        VALCHNCDGAFDVAELAERFLNEEIPEELPFT----------------------------
A9TJN0_PHYPA      TADTPIADNFSIRTVPMVNTDLLRTRHRHTRGP---------------------------
D5GJR5_TUBMM      -VVCPHAFCNHVAHLKCLSQVFLQADVRY-------------------------------
A2F2W8_TRIVA      ---VVCPFCGTLMHLKCMALRLISQSPSAG------------------------------
C4M4C5_ENTHI      ---KCLYKCGMKAHLCCLGKMFSENTHT--------------------------------
F4P011_BATDJ      WLRCSRPKCKMRGHLVCLSSWFIEEECQSLQD----------------------------
A8IU90_CHLRE      -TSPAASRSPSPAPLLARGRGGSSTGPAAGAA----------------------------
SLX1_PICGU        -LIAVCPSCAVICHLRCLAASWYQSSEIN-------------------------------
SLX1_GIAIC        ---VQCMQCSARFCITCAGKLFTRRNT---------------------------------
SLX1_CRYNJ        CPLAESQDCFCITHLICLAKHFQDEAPVEDRR----------------------------
E3KL57_PUCGT      -VNCRSPDCFMSAHLLCLSKHLLDASTIDPLPPLTIGDEP--------------------
SLX1_MONBE        PSSCSVPPSTGSSAAPTPGALAPQPTKQNK------------------------------
SLX1_MALGO        TAHTLRTSYPVLPEATTLSAAQKKKRSTSASCAP--------------------------
SLX1_CRYPI        HLSCIQLWGESNNHLETVIDELFPLKEFV-------------------------------
                                                                              

SLX1_HUMAN        ----------------------------------------------------LLPLEGQ-
G1QJU5_NOMLE      ----------------------------------------------------LLPLEGQ-
G1MA10_AILME      ----------------------------------------------------LLPLEGQ-
SLX1_BOVIN        ----------------------------------------------------LLPLEGA-
I3MYV3_ICTTR      ----------------------------------------------------LLPLEGQ-
G1Q3M3_MYOLU      ----------------------------------------------------LLPLEGR-
SLX1_MOUSE        ----------------------------------------------------LLPLEGH-
SLX1_RAT          ----------------------------------------------------LLPLEGH-
H0XMG2_OTOGA      ----------------------------------------------------LLPLEGQ-
SLX1_XENLA        ----------------------------------------------------LIPVEGL-
F6YWF0_XENTR      ----------------------------------------------------LIPVEGL-
H3A9L3_LATCH      ----------------------------------------------------LIPVEGQ-
H3CIK9_TETNG      ----------------------------------------------------LLPVEGE-
B7PW25_IXOSC      ----------------------------------------------------LIPVNGD-
E9GYI3_DAPPU      ----------------------------------------------------MLPLEGS-
SLX1_NEMVE        ----------------------------------------------------CLPVDGN-
SLX1_DROPE        ----------------------------------------------------YIPIGGE-
SLX1_DROPS        ----------------------------------------------------YIPIGGE-
SLX1_DROAN        ----------------------------------------------------YIPVGGE-
SLX1_DROME        ----------------------------------------------------YIPVGGE-
SLX1_DROSE        ----------------------------------------------------YIPVGGE-
SLX1_DROER        ----------------------------------------------------YIPVGGQ-
SLX1_DROGR        ----------------------------------------------------YIPIGGT-
SLX1_DROMO        ----------------------------------------------------YLPIVGN-
SLX1_ANOGA        ----------------------------------------------------YVPVEGD-
SLX1_TRYB2        LSGCGPVVGGI-FNHDAYTDRRDDNSPPSPPCPLPTQSSQADASLAATSLPLVPRAPCD-
D6XD30_TRYB2      LSGCGPVVGGI-FNHDAYTDRRDDNSPPSPPCPLPTQSSQADASLAATSLPLVPRAPCD-
SLX11_TRYCC       AHASGRQLHSLSVNNADFSSSRDAGSILDSSGHISAFEESRCAS--SPSLTLLPCQPCP-
SLX12_TRYCC       AHASGRQLHSLSVNNADFSSSRDAGSILDSSGHISAFEESRCAS--SPSLTLLPSQPCP-
V5AT06_TRYCR      VHASGRQLHSLSVNNVDFSSSRDAGSILDSSGHISAFEESRCAS--SPSLTLLPCQPCP-
Q682H4_ARATH      ----------------------------------------------------ETVFNDR-
F6GUC5_VITVI      ----------------------------------------------------EGTLDKD-
C5XDH1_SORBI      ----------------------------------------------------RTSPLCS-
SLX1_SCHJY        ---------------------------------------------------HILPISGT-
SLX1_SCHPO        ---------------------------------------------------QVLPIEGM-
SLX1_PARBP        ------------------------------------------------SDSELIPREGT-
SLX1_PARBD        ------------------------------------------------SDSELIPREGT-
SLX1_PARBA        ------------------------------------------------SDSELVPREGT-
SLX1_AJECG        ------------------------------------------------FIGKLIPKEGT-
SLX1_TALMQ        ------------------------------------------------SSG-LVPTLGD-
SLX1_TALSN        ------------------------------------------------SSG-LVPILGE-
SLX1_CHAGB        -------------------------------------------------TGSILPVQGQ-
SLX1_PODAN        -----------------------------------------------GGEGAILPVGGR-
SLX1_NEUCR        -----------------------------------------------DEGDEILPVKGE-
C7YV24_NECH7      -------------------------------------------------EGAMIPRSCT-
SLX1_BOTFB        -----------------------------------------------QSGEELIPVQGM-
SLX1_PHANO        -------------------------------------------------LETLVPLEGT-
SLX1_PYRTR        -------------------------------------------------KEAFIPIEGT-
SLX1_ASPFU        -------------------------------------------------PNQIVPKHGI-
SLX1_ASPFC        -------------------------------------------------PNQIVPKHGI-
SLX1_NEOFI        -------------------------------------------------PNQIVPRHGI-
SLX1_ASPCL        -------------------------------------------------PDCLIPRHGA-
SLX1_PENRW        -------------------------------------------------TDLLVPTQGT-
SLX1_ASPNC        -------------------------------------------------PEQLVPIDGI-
SLX1_ASPOR        -------------------------------------------------RGRLIPISGK-
SLX1_ASPTN        -------------------------------------------------PNQLVPRSGT-
SLX1_EMENI        -------------------------------------------------PERLVPLTGK-
SLX1_ASHGO        -----------------------------------------------TGEIPLIPTSGQ-
SLX1_CANGA        -----------------------------------------------KED-TIIPQSPK-
SLX1_YEAST        -----------------------------------------------VGRRNLIPRGGK-
SLX1_YEAS7        -----------------------------------------------VGRRNLIPRGGK-
SLX1_YEAS6        -----------------------------------------------VGRRNLIPRGGK-
SLX1_YEAS1        -----------------------------------------------VGRRNLIPRGGK-
SLX1_VANPO        -----------------------------------------------DSKNILLPNFCM-
SLX1_KLULA        ---------------------------------------------------QIIPKSGH-
SLX1_CANDC        --------------------------------------------------PAMVPKSVT-
Q5A4X4_CANAL      --------------------------------------------------PSMVPKFVT-
SLX1_DEBHA        -----------------------------------------------TDSEEKLGDTVNY
SLX1_PICST        -----------------------------------------------DGFQSLIPATVN-
SLX1_YARLI        -----------------------------------------------TPSRHIIPIGGD-
A9TJN0_PHYPA      -----------------------------------------------TLRTEAESSFSVC
D5GJR5_TUBMM      ---------------------------------------------------AVLPTEGL-
A2F2W8_TRIVA      --------------------------------------------------TALIPTHGS-
C4M4C5_ENTHI      ----------------------------------------------------LIPTTGN-
F4P011_BATDJ      -----------------------------------------------RQCMQLLPINGT-
A8IU90_CHLRE      ------------------------------------------------ARARRVGGGGGG
SLX1_PICGU        --------------------------------------------------AALIPSDVS-
SLX1_GIAIC        ----------------------------------------------------LIPCFGK-
SLX1_CRYNJ        ----------------------------------------------APSQPKILPYQGL-
E3KL57_PUCGT      ----------------------------------------------QPSLPRVLPDRGR-
SLX1_MONBE        --------------------------------------------------FGVDPRLDS-
SLX1_MALGO        -------------------------------------------------ENEHMWAEEIP
SLX1_CRYPI        --------------------------------------------------APLIPLNIS-
                                                                              

SLX1_HUMAN        -------CPCCEKSLLWGDLIWLCQMDTEKEVEDSELE-----------EAHWTDLLET-
G1QJU5_NOMLE      -------CPCCEKSLLWGDLIWLCQMDTEKEVEDSELE-----------EAHWTDLLET-
G1MA10_AILME      -------CPGCKNSLLWGDLIWLCRMGAEEEEEDLESE-----------EEHWTDMLET-
SLX1_BOVIN        -------CPGCKNSLLWGDLIWLCRMGTEEDEEDSELE-----------EEHWTDMLKT-
I3MYV3_ICTTR      -------CPSCENSLLWGDLIRLCRMGTEEEEDGSELE-----------EEHWTDMLDT-
G1Q3M3_MYOLU      -------CPGCKNSLLWGDLIWLCRMGSEEE-ENLELE-----------EEHWTDMLEI-
SLX1_MOUSE        -------CPSCKKSLLWGNLVGQCHADTEEEE-DLELE-----------EEHWTDLLET-
SLX1_RAT          -------CPSCKKSLLWGNLVGQCHEDTEEEEVDLELE-----------EEHWTDLLET-
H0XMG2_OTOGA      -------CPSCKNSVLWGDLIRLCWMETEEE-EESELE-----------EEHWTDMLET-
SLX1_XENLA        -------CPSCGHSLLWGDLIRHRNGCYGDLEEISSS------------QAHWGDELHRC
F6YWF0_XENTR      -------CPSCGHSVLWGDLIRYRNGCYGDLEEIPSS------------QAHWVDELHRS
H3A9L3_LATCH      -------CPGCRRTLLWGNLIRYKKGCYGDLEEIHSSS-----------QNHWADDLQL-
H3CIK9_TETNG      -------CPSCSKSLLWGTLIRYKNGCFRNLEETTPSSY----------SVSYTTEVFFL
B7PW25_IXOSC      -------CPRCGKWTLWGELVRHSRTCDWF------------------------------
E9GYI3_DAPPU      -------CPSCCSDLLWADLIRKFKGCYQNQ------------------NLALDETILT-
SLX1_NEMVE        -------CPQCKGSLLWGDLVKPAESIPSAEDVDEDTD------------DHWTQGLRL-
SLX1_DROPE        -------CPLCETRLSWSALLQRKRLQLGVPEEMQDNE----EEDLSDDGPDVDSDVEVQ
SLX1_DROPS        -------CLLCETRLSWSALLQRKRLQLGVPEEMQDNE----EEDLSDDGPDVDSDVEVQ
SLX1_DROAN        -------CPLCETRLSWSALLQRKRLLNGIPEELLDQEE--ADEDLSD-GPDVDSDVEVL
SLX1_DROME        -------CPLCETRLSWAALLQRKRLLLGVPEELQDHD-----EDLSD-DIDVDSDIED-
SLX1_DROSE        -------CPLCETRLSWAALLQRKRLLMGVPEELQDHD-----EDLSD-DIDVDSDIEDG
SLX1_DROER        -------CPLCENRLSWAALLQRKRLLLGVPKELRDYD-----EDLIE-DIDVDSNIEDT
SLX1_DROGR        -------CPLCELPLSWAELLRR----QGGFTETDQDSDDVACDELSDDVPDVDSDVEQQ
SLX1_DROMO        -------CPLCETPLVWAELLERKRFEQGVQIQGEDENEEEDRDELSD-CPDVDSDVEHI
SLX1_ANOGA        -------CPHCEGHFLWGDIIRKANGCSDLVDDTDNVD------------PVVLDEVSDE
SLX1_TRYB2        -------CPLCDEELQWSALVYDLKRRVAVEKRRAERER------REAMDAEFAQRFQRL
D6XD30_TRYB2      -------CPLCDEELQWSALVYDLKRRVAVEKRRAERER------REAMDAEFAQRFQRL
SLX11_TRYCC       -------CPLCDEPLQWGALVHDLKRRAVLEKRWMERQR------REKIEAALAERLQRL
SLX12_TRYCC       -------CPLCDEPLQWGALVHDLKRRAVLEKRWMERQR------REKIEAALAERLQRL
V5AT06_TRYCR      -------CPLCDEPLQWGALVHDLKRRAVLEKRWMERQR------REKIEAALAERLQRL
Q682H4_ARATH      -------LASFTCFGLVEIVEDEVSHGTIGSTEAMEKECRKRRNHITSTTTEVDVEVIDL
F6GUC5_VITVI      -------TSGLS------KENKVLTMKQLPATVAADRGKPK----ISSLDTSCEIEVIDL
C5XDH1_SORBI      -------LSPCSEDVGLEEGSGLMSPLLMPNASSDDDDGRG-------RRILYGNDVVDL
SLX1_SCHJY        -------CARCKRLLSWKLLVQASLSPSDEDNGAVGDTG----------ESDDNNERESS
SLX1_SCHPO        -------CTKCKRVLRWREFLSTVFTTSLETDERDFESE----------NRIEIIDLELE
SLX1_PARBP        -------CPACYGKLEWLTMMKEISLRLRGQEEVNRLFRRRRQAGTPKGQGLKSVRGRGR
SLX1_PARBD        -------CPACYGKLEWLTMMKEISLRLRGQEEVNRLFRRRRQAGTPKGQGLKSVRGRGR
SLX1_PARBA        -------CPTCYSKLEWLTMMKEISLRLRGQAEVNRLFGRRQRAGTPKGQGLKSVRGRGH
SLX1_AJECG        -------CPACLGKLEWPTLMKEITLRLRGQEEVKRLLGRRR---RTEQVGKRKISNHVS
SLX1_TALMQ        -------CPACKREVTWVALMKELSMRLHGAKIATKLLKKER------------------
SLX1_TALSN        -------CPACRQEVTWVELMKELSMRLHGGKNATKLLKGER------------------
SLX1_CHAGB        -------CPMCKEEVDWADMMKELTLRLRGQKEVDKLLKRKR-------------KRA--
SLX1_PODAN        -------CPRCKGEVHWGTMMKELTLRVRGQKEVENLLKVKR-------------KRAPR
SLX1_NEUCR        -------CPKCHGEVLWGDMMKELTLRIRGQAEVEKLLKKKK-------------RRRAA
C7YV24_NECH7      -------CPSCYSEIQWGDMMKELTLRVRGPKEVEKLLKKPR-------------RTR--
SLX1_BOTFB        -------CPGCRMDIRWNDVVKELSLRMRGQKVVEKLLGAKR-------------VKK-G
SLX1_PHANO        -------CPGCRSCIKWATMIKELSLRTNGEEELKLLFKPKR-------------KRKSD
SLX1_PYRTR        -------CPSCHSPIKWSDMIKELSLRMRGEDELKTLFKTKR-------------KKKQV
SLX1_ASPFU        -------CPACEATIEWPLMMKELSFRSRAKQELLEILKRKR------------------
SLX1_ASPFC        -------CPACEATIEWPLMMKELSFRSRAKQELLEILKRKR------------------
SLX1_NEOFI        -------CPACEATVEWPLMMKELSFRSRAKQELLEILKRKR------------------
SLX1_ASPCL        -------CPACKATVQWSLMMQELSFRSRGEQEALAILKRKR------------------
SLX1_PENRW        -------CPSCGNTVQWVTMMRELSLRNRAEKEARAILRKKE------------------
SLX1_ASPNC        -------CPLCNKVIQWSTMMQELSLRTRGHNEFRAILRKAK------------------
SLX1_ASPOR        -------CPGCHKTIQWSLMMQELSFRTRGAKELQAILRKKK------------------
SLX1_ASPTN        -------CPACSKLVQWPLMMQELSFRTRGGKEVQVILRKKA------------------
SLX1_EMENI        -------CPTCAQTVQWPLMMKELSIRTRGGRLLHNMLKKGG------------------
SLX1_ASHGO        -------CPNCNIELSWARIVRYSMFLSA-------------------------------
SLX1_CANGA        -------CPKCYTLLKWCDVIYYSIKLNKDNTTADDKKKTI-------------------
SLX1_YEAST        -------CPKCDMFCDWTTLVKFSTRMKLAHGK---------------------------
SLX1_YEAS7        -------CPKCDMFCDWTTLVKFSTRMKLAHGK---------------------------
SLX1_YEAS6        -------CPKCDTFCDWTTLVKFSTRMKLAHGK---------------------------
SLX1_YEAS1        -------CPKCDTFCDWTTLVKFSTRMKLAHGK---------------------------
SLX1_VANPO        -------CPGCLDEMSWSDFVKISTMIKNSFSN---------------------------
SLX1_KLULA        -------CPNCHKCLEWSQIVKYSTVLREKLIKD--------------------------
SLX1_CANDC        -------CTTCGQKLDWSDIIKVSTRLRHYVVQDSLHLAITQL-----------------
Q5A4X4_CANAL      -------CTTCGQKLDWSDIIKVSTRLRHYVVQDSLHLAITQL-----------------
SLX1_DEBHA        LTPLQGKCLSCNNFINWAKLSKMSTKLREYFLKDLLNTGATSQFIENDADD---------
SLX1_PICST        ------RCCSCNAKLEWRTLAKIATKLRYYVLKDSLQ--LPSQVLENDDNYESQNVNDS-
SLX1_YARLI        -------CPSCLARMEWSNVIKGVLAMRPVLEDNKE------------------------
A9TJN0_PHYPA      ILETPPTIPCRAKTIAGQDAPAQSKMEMKPIRDIQECESRCSDDWCELPSPQALSPLPYA
D5GJR5_TUBMM      -------CPECNRSTKWVDLVRELSSRTRRRSEATRKKSAGAVGTVGREDEEDEEEEEEM
A2F2W8_TRIVA      -------CPSCKENIIWRDLVELRNQIQDEEE----------------------------
C4M4C5_ENTHI      -------CPKCQREIRWGDIIKVLKNKTIESF----------------------------
F4P011_BATDJ      -------CPICRLNLVWGDLVADLKLRVSGLVQVRSSIDGECIDPNRGETNCTDLDAVDI
A8IU90_CHLRE      N----GAAAAAAEGTGWGHMQRLLAESDRDEEEAGAAGDFGGGGASGGPAAPDDDDEMSD
SLX1_PICGU        -------CSQCGAQTSWRLVADMATKLRQYALSS--------------------------
SLX1_GIAIC        -------CPICKREFQWKEMLRKRAEELVAGRKSVPHKTQAVDGQSSLSQNSSYDDYDTI
SLX1_CRYNJ        -------CPNCKRTVQWGQHIRACYARKEQVEKAEKAEKAEKAEKAEKAEKAEKAEKAEK
E3KL57_PUCGT      -------CPACSVDFRWGELVKGCYRRMPKNHTKAQISDADDEEEADLVFPYAEGDNQYP
SLX1_MONBE        --------DDRDDNHQFESPDNHEAAAVNVDVVDDSADDGTTDGNEDGPDDVAPHQEVTA
SLX1_MALGO        HARDAETLGLTWEQLEHAPTIARMEVPDGLMQASSAARGRSRRLRSHTSFLEALDQDASA
SLX1_CRYPI        -------CPCCFKDFEWEEAKKNYIKTKNVPTESLELGEDFPVLSNGEKENYSQEENSQN
                                                                              

SLX1_HUMAN        ------------------------------------------------------------
G1QJU5_NOMLE      ------------------------------------------------------------
G1MA10_AILME      ------------------------------------------------------------
SLX1_BOVIN        ------------------------------------------------------------
I3MYV3_ICTTR      ------------------------------------------------------------
G1Q3M3_MYOLU      ------------------------------------------------------------
SLX1_MOUSE        ------------------------------------------------------------
SLX1_RAT          ------------------------------------------------------------
H0XMG2_OTOGA      ------------------------------------------------------------
SLX1_XENLA        SD----------------------------------------------------------
F6YWF0_XENTR      SD----------------------------------------------------------
H3A9L3_LATCH      ------------------------------------------------------------
H3CIK9_TETNG      ------------------------------------------------------------
B7PW25_IXOSC      ------------------------------------------------------------
E9GYI3_DAPPU      ------------------------------------------------------------
SLX1_NEMVE        ------------------------------------------------------------
SLX1_DROPE        EFSD--------------------------------------------------------
SLX1_DROPS        EFSD--------------------------------------------------------
SLX1_DROAN        ESD---------------------------------------------------------
SLX1_DROME        TPELSD------------------------------------------------------
SLX1_DROSE        AQELSN------------------------------------------------------
SLX1_DROER        P-----------------------------------------------------------
SLX1_DROGR        LTP---------------------------------------------------------
SLX1_DROMO        CELSD-------------------------------------------------------
SLX1_ANOGA        GE----------------------------------------------------------
SLX1_TRYB2        Q--SESNKKSTARERGALEGVRRK-------------------RRRRGEVAAKLTQQTAV
D6XD30_TRYB2      Q--SESNKKSTARERGALEGVRRK-------------------RRRRGEVAAKLTQQTAV
SLX11_TRYCC       QNSSLTERKSRRKATPALGQKRNRGEYCGDTVGDGGKEAVTNWRARAMDGCDSWNDTNDF
SLX12_TRYCC       QNSSLTERKSRRKAKPALGQKRNRGEYCGDTVGDGGKEAITNWRARVMDGCDSWNDTNDF
V5AT06_TRYCR      QNSSLTERKSRRKAKPALGQKRNRGEYCTDTVGDGEKEAVTNWRARAMDGCDSWNDTNDF
Q682H4_ARATH      MTPSPSCRAGSSMKRRRVS----EFIDLTMSPNFIES-----------------------
F6GUC5_VITVI      LSCSPDYRTNPCFKKRRATTVHPEIIDLTNSPIFV-------------------------
C5XDH1_SORBI      VTPTPVGRLP---RRDCVSSICPKIIDLTSSPIVIQL-----------------------
SLX1_SCHJY        ------------------------------------------------------------
SLX1_SCHPO        K-----------------------------------------------------------
SLX1_PARBP        GRGHSEDESDALQVSTGLDIVDLTPCSDDPWTIDCAIGELGGIAHRPGGESSGNDSDATI
SLX1_PARBD        --GHSEDESDALQVSTGLDIVDLTPCSDDPWTIDCAIGELGGIAHRPGGESSGNDSDATI
SLX1_PARBA        S--EDENESDALQVSTGLDTVNLPPCSDGPWTIDCAIGVLGGIAHRPGGVSSGNDSDATV
SLX1_AJECG        S---EKGESEASMPSTDAKTMALPIRSH-PSVGGSNFGKLGRSVGSAIRTNTDNGSVKAV
SLX1_TALMQ        -------KSKAISDSRKSSKSGKKTANTYADILGNDYDDLDEDWMNSVNVDSGSEP----
SLX1_TALSN        -------KDKANTQGTKSSKGGKKPAKTGDYTLDGDYEDLDEDWMNAVNVEPSSED----
SLX1_CHAGB        --TKKAKKT---------------------------------------------------
SLX1_PODAN        KKTAKTKETREEDG----------------------------------------------
SLX1_NEUCR        KGKEKGKGKVADEKGNNAEGRNTKGN-------------REVKTTPQRVVEDSEDSEFLD
C7YV24_NECH7      ----KAAVS---------------------------------------------------
SLX1_BOTFB        KGIATSQEVVESEGDEEEEEEEEKEQELVDYFDADEFHARNVAQEENGFVDYLDDDDSDA
SLX1_PHANO        NPAESDAADGQALEQE------------------------DEELDETWMEDMSQDEEPSP
SLX1_PYRTR        DTTEDDTDEYPDIDDLNADL--------------------DEDLDETWMENVNEEDDKP-
SLX1_ASPFU        RVDRKQGAVTGE------VESSSRRT---------VSVDLDDRFGQHAEDEFLLDEDWWE
SLX1_ASPFC        RVDRKQGAVTGE------VESSSRRT---------VSVDLDDRFGQHAEDEFLLDEDWWE
SLX1_NEOFI        RVDRKQSVVTGK------VESSSRRS---------VSVDLDDRFGQDAEDEFLLDEDWWD
SLX1_ASPCL        RLDRRQQVISKAKCAGKGVDSSDVRP---------TSVDLD-RSNNNASDDLLLDDDWFD
SLX1_PENRW        KRVRKESAAMEG--------SSVPRS---------SSTEPRSLLEEPTQDD--LGPNWFE
SLX1_ASPNC        RGRAKAHGSVHEASAPDGVASAVENPGSRAACVESASVGVSDSLDVDNHDDASLDENWTE
SLX1_ASPOR        RGDCRVKDVPEK--DTDDVGTVTAECCDFPESVGGSIEGPGDASDESTHDDVRLDDDWYE
SLX1_ASPTN        RSDKRKAAAARP--AEIDANTASNEP-------LESTAQAFDRLNENVHQDV-LDEDWAE
SLX1_EMENI        KRTRTIQKAQDA-----TAESDDNAS---------AADIAVDASHEDSDDTDSLIDYWDR
SLX1_ASHGO        ------------------------------------------------------------
SLX1_CANGA        ------------------------------------------------------------
SLX1_YEAST        ------------------------------------------------------------
SLX1_YEAS7        ------------------------------------------------------------
SLX1_YEAS6        ------------------------------------------------------------
SLX1_YEAS1        ------------------------------------------------------------
SLX1_VANPO        ------------------------------------------------------------
SLX1_KLULA        ------------------------------------------------------------
SLX1_CANDC        ------------------------------------------------------------
Q5A4X4_CANAL      ------------------------------------------------------------
SLX1_DEBHA        ------------------------------------------------------------
SLX1_PICST        ------------------------------------------------------------
SLX1_YARLI        ------------------------------------------------------------
A9TJN0_PHYPA      RSALDSDTASPFSALLERYSLKQPSSIVKRCLQQKANECNTTRPESSASTQDLRKNSLPV
D5GJR5_TUBMM      DLMLSDDELGLYDIVARVSDSAGSISTSDSDSDSEASDRSRGSAWKSKKKRPGNKN----
A2F2W8_TRIVA      ------------------------------------------------------------
C4M4C5_ENTHI      ------------------------------------------------------------
F4P011_BATDJ      SDDDLVIDLNDFISNASLLDTPYASGSSRCIDTESAARSVLKPSGSHRSCAPTSDNGYMH
A8IU90_CHLRE      DVIIID------------------------------------------------------
SLX1_PICGU        ------------------------------------------------------------
SLX1_GIAIC        SLLSSSSEPEKDDISRDESGTVASVQPVSSVALSDSSRSPATTSPTKPLAIDPLLSSPRP
SLX1_CRYNJ        AEKAGRKVRQREMKTKKGDQSNGTVAQPESIYSATPVHTTFGLSNASATLIDPSMPARSM
E3KL57_PUCGT      NLNDYGNTSVTEDEVDPNIRGSTTSSRGSKPAPAKKKQTSSRKPVTSRKQPSSKPTGKSR
SLX1_MONBE        RHVHGAIGETCGHCHQSVYQELCIVCLNATCTYRAHLLCAAQAAVHPLGQSSPSETRLVP
SLX1_MALGO        LEAHLVHASRKDMSSSICGLCGGHINRHVPLSYTHCPHACDAVFHLTCLARYSLEQETRA
SLX1_CRYPI        KVIEDGFLEMDIDNHRNRLSYAHETKQKRDILFSDDEFSEISQKCEFIDLTVDSD-----
                                                                              

SLX1_HUMAN        ------------------------------------------------------------
G1QJU5_NOMLE      ------------------------------------------------------------
G1MA10_AILME      ------------------------------------------------------------
SLX1_BOVIN        ------------------------------------------------------------
I3MYV3_ICTTR      ------------------------------------------------------------
G1Q3M3_MYOLU      ------------------------------------------------------------
SLX1_MOUSE        ------------------------------------------------------------
SLX1_RAT          ------------------------------------------------------------
H0XMG2_OTOGA      ------------------------------------------------------------
SLX1_XENLA        ------------------------------------------------------------
F6YWF0_XENTR      ------------------------------------------------------------
H3A9L3_LATCH      ------------------------------------------------------------
H3CIK9_TETNG      ------------------------------------------------------------
B7PW25_IXOSC      ------------------------------------------------------------
E9GYI3_DAPPU      ------------------------------------------------------------
SLX1_NEMVE        ------------------------------------------------------------
SLX1_DROPE        ------------------------------------------------------------
SLX1_DROPS        ------------------------------------------------------------
SLX1_DROAN        ------------------------------------------------------------
SLX1_DROME        ------------------------------------------------------------
SLX1_DROSE        ------------------------------------------------------------
SLX1_DROER        ------------------------------------------------------------
SLX1_DROGR        ------------------------------------------------------------
SLX1_DROMO        ------------------------------------------------------------
SLX1_ANOGA        ------------------------------------------------------------
SLX1_TRYB2        RHEPTSGASGDRAHSAPPAPSCGGFDEIPANVTN-----PTAPLHADVLQVTEFNVDEWL
D6XD30_TRYB2      RHEPTSGASGDRAHSAPPAPSCGGFDEIPANVTN-----PTAPLHADVLQVTEFNVDEWL
SLX11_TRYCC       SHSVSLPPSRDEGYACDSSRRGVGGSKHTTRMTDEGKNDSITDICDCVLQLTEFNLDEWL
SLX12_TRYCC       SHSVSLPPSGDEGYACDSSRRGVGGSKHTTRMTDEGKNDSITDICDCVLQLTEFNLDEWL
V5AT06_TRYCR      SHSVSLPPSGDEGYACDSSRRGVGGSKHTTQMTDEGKNDSITDICDCVLQLTEFNLDEWL
Q682H4_ARATH      ------------------------------------------------------------
F6GUC5_VITVI      ------------------------------------------------------------
C5XDH1_SORBI      ------------------------------------------------------------
SLX1_SCHJY        ------------------------------------------------------------
SLX1_SCHPO        ------------------------------------------------------------
SLX1_PARBP        TLEMETPPQRRRRNQNTRTQRLGLQKSATINLSDWDDAEVIE------------------
SLX1_PARBD        TPEMETPPQRRRRNQNTRTQRLGLQKSATINLSDWDDAEVIE------------------
SLX1_PARBA        TPEIETHPQRCRRNQNTRTQRLGLQKSAMINLSDWYDAEVIE------------------
SLX1_AJECG        TPEIEFY---RRRKCNAKKNFSGLYSTPRINISDWDNAEIIE------------------
SLX1_TALMQ        -------------LDHKFTNANNSTGRVEIVIEDSEEETFD-------------------
SLX1_TALSN        -------------GDRNAANVKGSTGRVEIVIDDSEEDGFD-------------------
SLX1_CHAGB        ------------------------------------------------------------
SLX1_PODAN        ------------------------------------------------------------
SLX1_NEUCR        IACLQ-------------------------------------------------------
C7YV24_NECH7      ------------------------------------------------------------
SLX1_BOTFB        VSNISMESSKSPKRKRTIGPFSKAKLIAVIEDSDVDEEIEGEELER--------------
SLX1_PHANO        VKKSR-------------------------------------------------------
SLX1_PYRTR        --RS--------------------------------------------------------
SLX1_ASPFU        GLAAESD-SDTDLRLKPLSKAAP-KLETVIEDSECDDADIL-------------------
SLX1_ASPFC        GLAAESD-SDTDLRLKPLSKAAP-KLETVIEDSECDDADIL-------------------
SLX1_NEOFI        GLASESD-SDADRRLKTLSKAAP-KLETVIEDSECDDAEIL-------------------
SLX1_ASPCL        EFASESD-SDTGHRSKALSKAAP-NLETVVEDSEGDDLEFL-------------------
SLX1_PENRW        EVDIESD-SDVEGRQKHRSTQPPSKLEIVIEDSDWDDAELIE------------------
SLX1_ASPNC        SLDLDPNPDELLNRPKDHKMESS-RVEIIIDDSDCEEMEDLG------------------
SLX1_ASPOR        SLGIESD-HEIADWSESHPAMPT-RVEIVIEDSDCDNTG---------------------
SLX1_ASPTN        ELDCASE-DDTNERLKTGSKDQQ-RVEIVIEDSDEDDLEFL-------------------
SLX1_EMENI        ILGSDSE-SGASIHSQYGSKASG--TEVNIEKNVFLDNGLLD------------------
SLX1_ASHGO        ------------------------------------------------------------
SLX1_CANGA        ------------------------------------------------------------
SLX1_YEAST        ------------------------------------------------------------
SLX1_YEAS7        ------------------------------------------------------------
SLX1_YEAS6        ------------------------------------------------------------
SLX1_YEAS1        ------------------------------------------------------------
SLX1_VANPO        ------------------------------------------------------------
SLX1_KLULA        ------------------------------------------------------------
SLX1_CANDC        ------------------------------------------------------------
Q5A4X4_CANAL      ------------------------------------------------------------
SLX1_DEBHA        ------------------------------------------------------------
SLX1_PICST        ------------------------------------------------------------
SLX1_YARLI        ------------------------------------------------------------
A9TJN0_PHYPA      NVACTPPCRPRVVVVIPDDTPIMSSREVIDLTDSPY------------------------
D5GJR5_TUBMM      ------------------------------------------------------------
A2F2W8_TRIVA      ------------------------------------------------------------
C4M4C5_ENTHI      ------------------------------------------------------------
F4P011_BATDJ      QPAPSSRCISNRSASSIRQTLPSRPMPITITLLDDSDNESGHVQSKITRRSTASSNLVPS
A8IU90_CHLRE      ------------------------------------------------------------
SLX1_PICGU        ------------------------------------------------------------
SLX1_GIAIC        CALPSDVISITD------------------------------------------------
SLX1_CRYNJ        KSKDVGGEGIRHSTHTDDSDGIISVYSETEDESESEPEWEIFEAEMMALS----------
E3KL57_PUCGT      SAKPKPTKRTQRPIPEEDEDEPEQDFVKLMEELQVSD-----------------------
SLX1_MONBE        LRHSCPRCAHQAHWASWIAEVTL-------------------------------------
SLX1_MALGO        HARTFCLPTSAWCPMCQRPPVPWPEIVRRVFRRAELKVSM--------------------
SLX1_CRYPI        ------------------------------------------------------------
                                                                              

SLX1_HUMAN        -------------------------------------------
G1QJU5_NOMLE      -------------------------------------------
G1MA10_AILME      -------------------------------------------
SLX1_BOVIN        -------------------------------------------
I3MYV3_ICTTR      -------------------------------------------
G1Q3M3_MYOLU      -------------------------------------------
SLX1_MOUSE        -------------------------------------------
SLX1_RAT          -------------------------------------------
H0XMG2_OTOGA      -------------------------------------------
SLX1_XENLA        -------------------------------------------
F6YWF0_XENTR      -------------------------------------------
H3A9L3_LATCH      -------------------------------------------
H3CIK9_TETNG      -------------------------------------------
B7PW25_IXOSC      -------------------------------------------
E9GYI3_DAPPU      -------------------------------------------
SLX1_NEMVE        -------------------------------------------
SLX1_DROPE        -------------------------------------------
SLX1_DROPS        -------------------------------------------
SLX1_DROAN        -------------------------------------------
SLX1_DROME        -------------------------------------------
SLX1_DROSE        -------------------------------------------
SLX1_DROER        -------------------------------------------
SLX1_DROGR        -------------------------------------------
SLX1_DROMO        -------------------------------------------
SLX1_ANOGA        -------------------------------------------
SLX1_TRYB2        NH-----------------------------------------
D6XD30_TRYB2      NH-----------------------------------------
SLX11_TRYCC       DA-----------------------------------------
SLX12_TRYCC       DA-----------------------------------------
V5AT06_TRYCR      DA-----------------------------------------
Q682H4_ARATH      -------------------------------------------
F6GUC5_VITVI      -------------------------------------------
C5XDH1_SORBI      -------------------------------------------
SLX1_SCHJY        -------------------------------------------
SLX1_SCHPO        -------------------------------------------
SLX1_PARBP        -------------------------------------------
SLX1_PARBD        -------------------------------------------
SLX1_PARBA        -------------------------------------------
SLX1_AJECG        -------------------------------------------
SLX1_TALMQ        -------------------------------------------
SLX1_TALSN        -------------------------------------------
SLX1_CHAGB        -------------------------------------------
SLX1_PODAN        -------------------------------------------
SLX1_NEUCR        -------------------------------------------
C7YV24_NECH7      -------------------------------------------
SLX1_BOTFB        -------------------------------------------
SLX1_PHANO        -------------------------------------------
SLX1_PYRTR        -------------------------------------------
SLX1_ASPFU        -------------------------------------------
SLX1_ASPFC        -------------------------------------------
SLX1_NEOFI        -------------------------------------------
SLX1_ASPCL        -------------------------------------------
SLX1_PENRW        -------------------------------------------
SLX1_ASPNC        -------------------------------------------
SLX1_ASPOR        -------------------------------------------
SLX1_ASPTN        -------------------------------------------
SLX1_EMENI        -------------------------------------------
SLX1_ASHGO        -------------------------------------------
SLX1_CANGA        -------------------------------------------
SLX1_YEAST        -------------------------------------------
SLX1_YEAS7        -------------------------------------------
SLX1_YEAS6        -------------------------------------------
SLX1_YEAS1        -------------------------------------------
SLX1_VANPO        -------------------------------------------
SLX1_KLULA        -------------------------------------------
SLX1_CANDC        -------------------------------------------
Q5A4X4_CANAL      -------------------------------------------
SLX1_DEBHA        -------------------------------------------
SLX1_PICST        -------------------------------------------
SLX1_YARLI        -------------------------------------------
A9TJN0_PHYPA      -------------------------------------------
D5GJR5_TUBMM      -------------------------------------------
A2F2W8_TRIVA      -------------------------------------------
C4M4C5_ENTHI      -------------------------------------------
F4P011_BATDJ      IGSNPSSHNGTTRLTNTRQLADHQELTSDDDDDLLNALLVGNR
A8IU90_CHLRE      -------------------------------------------
SLX1_PICGU        -------------------------------------------
SLX1_GIAIC        -------------------------------------------
SLX1_CRYNJ        -------------------------------------------
E3KL57_PUCGT      -------------------------------------------
SLX1_MONBE        -------------------------------------------
SLX1_MALGO        -------------------------------------------
SLX1_CRYPI        -------------------------------------------