CLUSTAL format seed alignment for MF_03101

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

I3NAV7_ICTTR          -----------------------------MVTEQE--------VEAIGQVLVDP---KQP
G1LG94_AILME          -----------------------------MVTDKE--------VEAIGQTLVDP---QQP
DOHH_HUMAN            -----------------------------MVTEQE--------VDAIGQTLVDP---KQP
H0WUB8_OTOGA          -----------------------------MVTEQE--------VEAIGRTLVDP---KQP
DOHH_MOUSE            -----------------------------MVTEQE--------IEAIGKTLVDP---KQP
DOHH_RAT              -----------------------------MVTEQE--------VEAIGKTLVDS---TQP
DOHH_CHICK            -----------------------------MVTEEE--------VTAIGRTLLDA---AQP
H3A597_LATCH          -----------------------------MANEKA--------IEMIGRTLVDV---EQP
DOHH_DANRE            -----------------------------MANDKD--------IAAVGSILVNT---KQD
H3CCH9_TETNG          -----------------------------MASVDA--------VAAVGRVLVDP---GCD
F6UWS3_XENTR          ----------------------------MAASLST--------VQSLGRLLIDS---GQP
F6UWT4_XENTR          ----------------------------MAASLST--------VQSLGRLLIDS---GQP
DOHH_XENLA            ----------------------------MAASLSSE-------VHSLGQLLIDP---GKP
B6IF58_CAEBR          ------------------------MVATKTFSDAE--------IDNIGQALNDT---KRP
DOHH_CAEEL            ------------------------MVASQKFSDAE--------IDSFGEALNDT---KKP
E0VTF2_PEDHC          ---------------------------MVNVPEDK--------IKAIGAILNDS---KKP
Q7PUV4_ANOGA          ---------------------------MVQIDESK--------VAAIGDVLNNR---DRP
W5JH70_ANODA          ---------------------------MVQIEDSK--------VASIGEVLNNR---ERP
Q177G8_AEDAE          ---------------------------MVQIEESK--------ISDIGRVLNDK---NRP
DOHH_DROME            -----------------------------MVSQQQ--------IEAIGGVLNNK---ERP
DOHH_DROPS            -----------------------------MVSQEQ--------IEAIGGVLNNK---DRP
E9GHP7_DAPPU          --------------------------MPALASDNQ--------LEAVSKVLNDT---NRP
B3RM40_TRIAD          ----------------MQYHDYPLFTNVSLLSACDCC---KYNLDNLSFLLFQHSIINRD
A9UV60_MONBE          ---------------------------MPEDTNTTNL---QAHVPKLGKVLADP---AKP
DOHH_DEBHA            -----------------------------MTEEINI---DTATLEQLRDVLTNKSG-DVK
DOHH_CANAL            ----------------------------MSADEVNI---DTASLEELRDILINKTG-NTK
DOHH_ASHGO            -----------------------MSTEFEKKMEEHI---DSCSLEQLRDILVNKNG-DAK
DOHH_KLULA            -----------------------MSTNFEKHFEVDV---DNCSLEQLRDILVNNSG-KAP
DOHH_CANGA            -----------------------MSTNFEKHFEENV---DDCNLEQLRDILVNKEG-KSA
DOHH_YEAST            -----------------------MSTNFEKHFQENV---DECTLEQLRDILVNKSG-KTV
DOHH_YARLI            -----------------------------------M---ATETLPELKKVLLNEDG-QTA
DOHH_SCHPO            ------------------------------MSSEPV---PQAVIDELERVLVNLDK-SNP
C7Z7L0_NECH7          ----------------------------------------METVLKLRESLCSED---TP
DOHH_GIBZE            -----------------------MSPSADTPEISNS---ADSTVLSLKKSLCSED---SP
DOHH_NEUCR            ---------------------------------------MSATIASLRESLCSET---TP
DOHH_CHAGB            ----------------MTAPTTTSPSSEATTTTTTT---TLNTIATLHQSLTTET---TP
A7ESN0_SCLS1          -----------------------MAPSATSPAPEET---PDATVLTLRKTLCSES---TP
DOHH_PHANO            -----------------------MAVTEQDTQ-----------VPTLRKIVTSES---EP
C0NP82_AJECG          -----------------------MSPAATDTPENSSVGMSISPIPILRKTLTSES---EP
DOHH_ASPFU            -----------------------MSPSATDTTEVMD-----PTILTLRKVLTSES---EP
DOHH_NEOFI            -----------------------MSPSATDTTEGVD-----PTILTLRKVLTSES---EP
DOHH_ASPCL            -----------------------MSPSATDNSDGPD-----ATVLTLRKVLTSES---EP
DOHH_ASPNC            -----------------------MSAVNENNLEGVS-----ETVLTLRKVVVNES---EP
DOHH_ASPOR            -----------------------MASSAVDQPEGVD-----ETILTLRKVLVNES---EP
DOHH_EMENI            --------------------------MTTDNLNSAD-----TTVQTLRNVLTSET---EP
DOHH_COCIM            -----------------------MASTIADNADNNG--NSKDSVQYLRKVLTSES---SP
D5GHJ2_TUBMM          -----------------------MATA--------------DPVPALRKVLGDDNQ--EN
A8NRZ7_COPC7          -----------------------------------MVAVAADELKALEECLLNTSG-KVP
DOHH_LENED            ------------------------------------MSLSATQLKALEDSVLNTSG-KVL
E3JYZ9_PUCGT          ---------------------------------MTVLSVTEDEINELHSTLTNRTG-TVP
F4P405_BATDJ          ---------------------------MPEPSDSQIVTASQETYALLQESL--CSA-ENP
I1CAV6_RHIO9          ------------------------------------MTELAVNYDLLEASLCNTSG-NVS
DOHH2_ORYSJ           ------------------------------------------MEGFLCDRLLDAA---QP
DOHH1_ORYSJ           -------------------------MESAEVAASSTFGPTPEMEKFLCDLLLDTA---QP
C5XW00_SORBI          ------------------------------MAATSAFESSPEMERFLCERLLDAE---QP
B9H8J8_POPTR          ---------------------------MGSLKATIPTDSRSNLEQFLFDRLLDQS---QP
B9GS37_POPTR          ---------------------------MGSLDTTTPTGSRSNMEQFLCERLVDQT---QP
D7U2X4_VITVI          ---------------------------MASCDNSFSVSPET--EKFLCDRLIDPT---QP
DOHH_ARATH            ------------------------------MESNGSVSSMVNLEKFLCERLVDQS---QP
A9SHU2_PHYPA          ------------------MQPVSTALPVELEASVSSAMSEAQMVSFLRRCLLDSS---LA
A8IGJ8_CHLRE          ------------------------------MTAPQLVEVADEVVADLKKKLVDPN---SS
F1A2N7_DICPU          ------------------------------METTPKIEVTPELVNGLKKTLLDVN---EP
D0NC43_PHYIT          ---------------------MPSHSSATETIST--VVDTTPSFEQLRDALLDLS---EP
H3GH76_PHYRM          ---------------------MPSHSSVTETIASQPVPDTTPSFERLRDALLDLS---EP
DOHH_ENCCU            --------------------------------------------MDIEVARKNIGCDSVS
Q38FR2_TRYB2          ---------------------------------------MDQDLSVCEQEYRKLLDPEEP
V5BF70_TRYCR          ---------------------------------------MAQDFAAYEEEYKRLLDPNEP
Q4Q901_LEIMA          -----------------------------------MSASNSCTVEEVRKEYAKLLDPQEP
A4I2C0_LEIIN          -----------------------------------MSALNSRTVEEVRKDYAKLLDPQEP
A4HF36_LEIBR          -----------------------------------MPDSTSRSVEELRKDYAKLLDPQEP
B7XJJ9_ENTBH          -------------------------------------MTCNQNLDKYSELIKSSN---VS
Q4UHP1_THEAN          ------------------------MSLQSLIDEFIKLDEFSSPSKDLITSILLNPE--VP
Q4N7W5_THEPA          ------------------------MSLQSLIDEFTKLDEFSTPSKHLIKSILLSPE--VP
A7AS23_BABBO          -----------------------MADLATAIAEFDSLNEFSKPDAKLLSTILLSDG--VK
A0A0Z0AA05_PLABE      -----------------------MIEGKI--GPRVIKYEDSTNKNFIRKYLIDVKN--EF
Q7PDV0_PLAYO          -----------------------MTENKIE-GPRVIKYEDSTNKNFIRKYLIDVKN--EF
B3LBI7_PLAKH          -----------------------MTASIQNRGSRLIQYEDSSNKEFIRKYLVETRN--EF
DOHH_PLAVS            -----------------------MTGSTHNGGSRLIQYEDSSNKEFIRKYLVETRN--EF
Q8I701_PLAF7          MGENNDNINIINNVNNNYNINSDNVGGDSSNKVRLIKYEESTNKEFILKYLVNIKN--DY
Q5CQK0_CRYPI          -------------MVVINEITPKAMLPGCPVKPLGGGEFSSFNIYSKEKIRELLLSHDTD
G4VSX8_SCHMA          ---------------------------------MTPKPVSETELREWGKCLLNPS---AT
A0C8W1_PARTE          ---------------------------------------MEKSPQKFYEIIINAN---ST
                                                                                  

I3NAV7_ICTTR          LQARFRALFTLRGLGGP---------GAIAWISRAFH-------DDSALLKHELAYCLGQ
G1LG94_AILME          LQARFRALFTLRGLGGP---------RAITWISRAFG-------DDSALLKHELAYCLGQ
DOHH_HUMAN            LQARFRALFTLRGLGGP---------GAIAWISQAFD-------DDSALLKHELAYCLGQ
H0WUB8_OTOGA          LQTRFRALFTLRGIGGP---------GAISWISQAFS-------DDSVLLKHELAYCLGQ
DOHH_MOUSE            LQARFRALFTLRGLGGP---------DAISWISRGFE-------DSSALLKHELAYCLGQ
DOHH_RAT              LQARFRALFTLRGLGGP---------DAISWISRGFE-------DSSALLKHELAYCLGQ
DOHH_CHICK            LPARFRALFTLRNLGGP---------AAIDCIVRGFA-------DSSALLKHELAFCLGQ
H3A597_LATCH          LKARFRALFTLRNLGGH---------VAIDWISKAFG-------DESALLKHELAYCLGQ
DOHH_DANRE            LTTRFRALFTLRNLGGA---------EAVKWISEAFV-------DESALLKHELAYCLGQ
H3CCH9_TETNG          LPRRFRALFTLKNLGGA---------DAIEWIGRAFG-------DGSALLKHELAYCLGQ
F6UWS3_XENTR          LPLRFRALFTLRNLGGA---------EAIDYIGRGFQ-------DESALLKHELAYCLGQ
F6UWT4_XENTR          LPLRFRALFTLRNLGGA---------EAIDYIGRGFQ-------DESALLKHELAYCLGQ
DOHH_XENLA            LPLRFRALFTLRNLGGA---------EAIDCIGRGFQ-------DESALLKHELAYCLGQ
B6IF58_CAEBR          LKSRFRALFILRNIGCD---------RSVEWIGKCLN-------DESALLKHELAYCLGQ
DOHH_CAEEL            LKARFRALFILRNIGCD---------RSVDWIGKCLN-------DESALLKHELAYCLGQ
E0VTF2_PEDHC          LKARFRALFSLRNINNS---------TSVACISEGFS-------DPSALLKHELAYCLGQ
Q7PUV4_ANOGA          LKERFRALFTLRNIGGE---------RALESIGRCFD-------DESALLKHELAYCLGQ
W5JH70_ANODA          LKERFRALFTLRNIGGD---------KALESITRCFA-------DDSALLKHELAYCLGQ
Q177G8_AEDAE          LKERFRALFTLKNIGGP---------KALESIESCFE-------DDSALLKHELAYCLGQ
DOHH_DROME            LKERFRALFTLKNIGGG---------AAIEAISKAFD-------DDSALLKHELAYCLGQ
DOHH_DROPS            LKERFRALFTLKNIGGK---------TAIDAISKAFD-------DDSALLKHELAYCLGQ
E9GHP7_DAPPU          LKERFRALFTLRNLGGP---------KAVEGISSCFT-------DSSALLKHELAYCLGQ
B3RM40_TRIAD          LPSRFRALFTLRNIGGS---------KAISQINNCFN-------DSSALLKHECAFCLGQ
A9UV60_MONBE          LAERFRALFTLRNIVCP---------ESVQAIAAAFE-------DDSALLKHECAYVLGQ
DOHH_DEBHA            LANRFRALFNLKCVGAESENQ-DEVHKAIDYIAESFK-------DDSELLKHEVAYVLGQ
DOHH_CANAL            LANRFRALFNLKSVGSEDSDK-ERAHKAIKYIAECFN-------DDSELLKHEVAYVLGQ
DOHH_ASHGO            LTNRFRALFNLKCVAEEFAQRPEEAQRAVEYICEAFA-------DSSELLKHEVAYVLGQ
DOHH_KLULA            LANRFRALFNLKGHAEEFASKPEDALKATQYLAEAFG-------DESELLKHEVAYVLGQ
DOHH_CANGA            LANRFRALFNLKTAASEFEANPSDAEKAVQYMGETFG-------DNSELLKHEVAYVLGQ
DOHH_YEAST            LANRFRALFNLKTVAEEFATKPEEAKKAIEYIAESFVN------DKSELLKHEVAYVLGQ
DOHH_YARLI            LALRFRALFSLKDMGEK------GDNGAIDVIAEGFK-------DDSELLKHELAYVLGQ
DOHH_SCHPO            LSFRYRALFSLNALAKK------GDKRAVDAIYKAFI-------DDSELLKHEMAYVMGQ
C7Z7L0_NECH7          LPIRFRALFSLKHVAVTQINPEDVKVAAIEAIAAGFT-------SPSALLKHELAYCLGQ
DOHH_GIBZE            LPIRFRALFSLKHVATTADD-DATRVAAIEAIAAGFA-------SPSALLKHELAYCLGQ
DOHH_NEUCR            LPIRFRALFSLKHLAVQNKG-TADSLSAIDAIAAAFA-------SPSALLKHELAYCLGQ
DOHH_CHAGB            LPVRFRALFSLKHVAATHPATSAESLAAIDAIAAGFA-------SPSALLKHELAYCLGQ
A7ESN0_SCLS1          LDFRIRALFSLKHLASIPSS--SSNIAAIEAIAAAFT-------SPSALLKHELAYCLGQ
DOHH_PHANO            LARRFRALFSLKHLASLQPP-TEQTVPAIEAIAAAFS-------SPSALLKHELAYCLGQ
C0NP82_AJECG          LARRFRALFSLKHVACLQPP-TEQSLPSIQAIAAAFS-------SPSALLKHELAYCLGQ
DOHH_ASPFU            LGRRFRALFSLKHLACLQPP-TEKTLPAIQAIAAAFT-------SPSALLKHELAYCLGQ
DOHH_NEOFI            LARRFRALFSLKHLACLQPP-TEKTLPAIQAIAAAFT-------SPSALLKHELAYCLGQ
DOHH_ASPCL            LARRFRALFSLKYLACQQPA-TEKTLPAIQAIAAAFT-------SPSALLKHELAYCLGQ
DOHH_ASPNC            LARRFRALFSLKYLACLQPP-SEDTLPAIEAIAAAFS-------SKSALLKHELAYCLGQ
DOHH_ASPOR            LARRFRALFSLKYIACLQPP-TEKTLPAIQAIAAGFT-------SSSALLKHELAYCLGQ
DOHH_EMENI            LARRFRALFSLKHLACLQPP-TEKTLPAIQAIAAGFS-------SASALLKHELAYCLGQ
DOHH_COCIM            LAQRFRALFSLKHLASSKPP-TEETLPAIEAIAAAFS-------SPSALLKHELAYCLGQ
D5GHJ2_TUBMM          LALRFRALFSLKHLARNGSK------PAIEAIANAFS-------SKSALLKHELAYCLGQ
A8NRZ7_COPC7          LHVRFRALFTLKGLDND---------EAVDIISKGFD-------DPSALLKHELAYCLGQ
DOHH_LENED            LHDRVRALFTLKSLKNE---------DAIRIISKGFQ-------DSAALLKHELAYCLGQ
E3JYZ9_PUCGT          LASRFRALFTLKAIGSP---------PAVKAIGDALRPSKDSSDQPQALLGHELAYCLGQ
F4P405_BATDJ          LSKRFRALFTLKALKTN---------QAVDIIAQAFV-------DPSALLKHELAYVLGQ
I1CAV6_RHIO9          LAERFRTLFTLKNIADE---------RSIEIIGKALK-------DDSELLKHELAYCLGQ
DOHH2_ORYSJ           IAERFRALFSLRNLRGD---------APRRALLQAAR-------DSSNLLAHEAAFALGQ
DOHH1_ORYSJ           IAERFRALFSLRNLHGD---------GPRCALLQAAR-------DSSNLLAHEAAFALGQ
C5XW00_SORBI          IAERFRALFSLRNLRGD---------APRRALLQAAR-------DPSNLLAHEAAFALGQ
B9H8J8_POPTR          IHERFRALFSLRNLKGP---------GPRNALIHATR-------DSSNLLAHEAAFALGQ
B9GS37_POPTR          IHERFRALFSLRNLKGP---------GPRNALIHATR-------DSSSLLAHEAAFALGQ
D7U2X4_VITVI          ISERFRALFSLRNLRGP---------APRQALILATR-------DSSNLLAHEAAFALGQ
DOHH_ARATH            ISERFRALFSLRNLKGP---------GPRNALILASR-------DSSNLLAHEAAFALGQ
A9SHU2_PHYPA          VPLRWRAIFSLRNYKGD---------DARQALVDAMS-------DESNLLAHEAAFALGQ
A8IGJ8_CHLRE          LPEKYRVLFSLRNVKGA---------AAHDALELALK-------DDSALFRHDVAFCLGQ
F1A2N7_DICPU          IAKRFRSLFTLRNLNGP---------LSIDAMCEALN-------DKSALLRHEIAYCLGQ
D0NC43_PHYIT          TGKRTRAIFYLRSRGGL---------EDLQVLLTALLNR-----KDSELMRHELAYVIGQ
H3GH76_PHYRM          VGKRTRAIFYLRSRGGL---------EDLQVLLQALLNR-----EDSELMRHELAYVIGQ
DOHH_ENCCU            IAKRMRSLFYLRNVLLP---------ESARAITEAFG-------SKSVLLKHEAAYVLGQ
Q38FR2_TRYB2          LFSRTRELYRLKESILR-------TPAGVHVLAKAVDT------TNSVLLQHELVYNLGQ
V5BF70_TRYCR          LDSRIRELYRLKQSIFR-------TPAGVHVLTKAIDT------TDSVLLQHELVYNIGQ
Q4Q901_LEIMA          LDSRMRELYRLKEDCLK-------TVAGVTVILEAIDT------TDSVLLQHELAYNAGQ
A4I2C0_LEIIN          LDSRMRELYRLKEDCLK-------TAAGVTVILETIDT------TDSVLLQHELAYNAGQ
A4HF36_LEIBR          LDSRMRELYRLKENCLK-------TVAGVTVILEAIDT------TDSVLLQHELAYNAGQ
B7XJJ9_ENTBH          IQEKMNIIFTLKELGTN---------DAVYTLHNCIT-------NNSVLLDHEIAYILGQ
Q4UHP1_THEAN          LSLQLRALYYCRDLPEED---------CSKILISALDV------HFDTFMRHEIAYVIGQ
Q4N7W5_THEPA          LSLQLRALYYCRDLPEED---------CSQILISALDV------HFDTFMRHEIAYVIGQ
A7AS23_BABBO          LSQQLKALYFCRDLSSSE---------CATILKKALEV------HYDTFLRHEIAYVIGQ
A0A0Z0AA05_PLABE      IEKQMRALYECREVYKDDVD------EVLNILTYALEN------NDSVLLRHEIAYVIGQ
Q7PDV0_PLAYO          IEKQMRALYECREIYKDDVD------EVLNVLTYALEN------NDSVLLRHEIAYVIGQ
B3LBI7_PLAKH          IEKQMRALYECREIYKHDID------EVINILTYALEN------NDSVLLRHEVAYVIGQ
DOHH_PLAVS            IEKQMRALYECREIYKDDID------EVINILTYALEN------NDSVLLRHEVAYVIGQ
Q8I701_PLAF7          IEKQMRALYECREVYKDDID------EVINILTYALKN------NDSVLLRHEIAYVIGQ
Q5CQK0_CRYPI          ISSKIRCLFFGRFHGDE---------ESAEMLSKSLDY------SESVLFRHEVLYVLGQ
G4VSX8_SCHMA          LVDRSRALWGLRHAAEP---------LALELLADFVCNYVKPSPIANDLLQHEAAYCLGQ
A0C8W1_PARTE          VDQIYTAIFELRTINNQ---------EAVELLKQGFHHLNKVE-NKSCLLLHEIAYALGQ
                             ::  .                   :                :: *:  :  **

I3NAV7_ICTTR          MQ---DSRAIPVLSGVLRDTR-QEPMVRHEAGEALGAIG--NPQVLELLRQYC----SDP
G1LG94_AILME          MQ---DSRAIPVLLDVLRDTR-QEPMVRHEAGEALGAIG--NPDVLEVLKQYS----TDP
DOHH_HUMAN            MQ---DARAIPMLVDVLQDTR-QEPMVRHEAGEALGAIG--DPEVLEILKQYS----SDP
H0WUB8_OTOGA          MQ---DSRAIPVLVDVLCDTR-QEPMVRHEAGEALGAIG--NPEVLELLKQYS----TDP
DOHH_MOUSE            MR---DARAIPVLADVLQDTS-QEPMVRHEAGEALGAIG--NPEVLGLLKQYS----TDP
DOHH_RAT              MR---DPRAIPVLVSVLQDRN-QEPMVRHEAGEALGAIG--NPKVLGLLKQYS----TDP
DOHH_CHICK            MR---DRAAIPALLGVLQDSQ-QEPMVRHEAGEALGAIG--DPEVLDVLRRYS----EDP
H3A597_LATCH          MQ---DEYAIPVLIKVLEDTS-QEPMVRHEAGEALGAIG--NPKVLEILKHYS----EDP
DOHH_DANRE            MQ---DESAIPTLEAVLKDTN-QEPMVRHEAGEALGAIG--NPKVLELLKKYA----EDP
H3CCH9_TETNG          MQ---DPRAIPTLTAVLRDTG-QEPMVRHEAGEALGAIG--DPAVLDLLKEYS----QDP
F6UWS3_XENTR          MK---DRRALPVLMEVLQDRQ-QEAMVRHEAGEALGAIG--DPEVLELLKEYS----RDP
F6UWT4_XENTR          MK---DRRALPVLMEVLQDRQ-QEAMVRHEAGEALGAIG--DPEVLELLKEYS----RDP
DOHH_XENLA            MK---DRRALPVLKQVLQDRQ-QEPMVRHEAGEALGAIG--DPEVLELLREYA----QDP
B6IF58_CAEBR          MQ---NKSAIPTLVNVLQDEK-QEPMVRHEAGEALGAIA--DPSVKEVLRKYA----QDP
DOHH_CAEEL            MQ---NKHAIPTLVSVLEDEK-QEPMVRHEAGEALGAIA--DPSVKDVLRKYA----QDP
E0VTF2_PEDHC          MQ---NKEAIPLLIKILEDKN-QEPIVRHEAAEALGAIG--LSSVAETLKTYS----TDK
Q7PUV4_ANOGA          MQ---DVRAIPVLTKVLADVQ-QEAMVRHEAAEALGAIG--DSSVEDTLVSYS----KDP
W5JH70_ANODA          MQ---DVRAIPALTKVLADTE-QEPMVRHEAAEALGAIG--DISVEEILLQYS----KDP
Q177G8_AEDAE          MQ---DRAAIPILTKVLEDVK-QEPMVRHEAAEALGAIG--ASDVEQILVKYS----KDP
DOHH_DROME            MQ---DAQALDILTKVLKDTT-QEPMVRHEAAEAMGAIG--HPDVLPILEEYK----QDP
DOHH_DROPS            MQ---DPTALEILTKVLKDTT-QEPMVRHEAAEAMGAIG--HADVLAILEEYK----KDP
E9GHP7_DAPPU          MQ---DPTAIPVLTSVLKDVQ-QEPMVRHEAGEALGAIG--SAESLLVLQEHC----EDK
B3RM40_TRIAD          MQ---DQDAIPVLISLLEDEN-QEPIVRHEAGEALGAIGVHSEELLSLLQKYC----NHP
A9UV60_MONBE          MQ---DLSAIPLLTSVLENKQ-QDAMVRHEAAEALGAIG--DAESIAVLTRFK----DDE
DOHH_DEBHA            TK---NLHAAQYLRSVLENNN-QQIMVRHEAAEALGALG--DKDSLALLEDYF-K--NDP
DOHH_CANAL            TK---DLYAAPYLREVLENDN-QQCMVRHEAAEALGALG--DKESLPLLEKYF-K--EDP
DOHH_ASHGO            TG---NLACAATLREVMLDHA-QQCMVRHEASEALGALG--DAASLGALERSR-R--EDP
DOHH_KLULA            TK---NMAGAPLLRDVLADDK-QQCMVRHEAAEALGALN--DVDSLDILEKYF-K--EDP
DOHH_CANGA            TK---NLKAAPLLRKTMLDLA-QQPMVRHEAAEALGALG--DKDSLEDLEKCL-K--NDP
DOHH_YEAST            TK---NLDAAPTLRHVMLDQN-QEPMVRHEAAEALGALG--DKDSLDDLNKAA-K--EDP
DOHH_YARLI            TK---NFHAVKPLQGVLADTN-QQAMVRHEAAEALGALG--DKGSVAMLQEYF-E--NDP
DOHH_SCHPO            SG---QQYAVQPLINIVNDLD-QQVMVRHEAAEALGALG--FTESLPVLEKYY-K--EDP
C7Z7L0_NECH7          TC---NTAAVKPLREVLADLK-EDPMCRHEAAEALGALG--WADNLDILREYRDR--KGE
DOHH_GIBZE            TG---NTAAVKPLRQVLSDLK-EDPMCRHEAAEALGALG--WADNLDILREYRDR--KEE
DOHH_NEUCR            TG---SDAAIPHLTQVLEDLQ-EDPMCRHEAAEALGALG--KAESLGVLQKYLHR--EGE
DOHH_CHAGB            TA---NGAAIPYLTAVLEDTG-EDAMCRHEAAEALGALG--DVASLGVLKRFRDR--EGE
A7ESN0_SCLS1          TR---NLECSKYLRAVLENRE-ENGMVRHEAAEALGALG--DKDSLQLLKERRDD--TTE
DOHH_PHANO            SG---HDAAIAPLRGVLEDKD-EDSMCRHEAAEALGALS--DKGSLELLKKMRDD--ANE
C0NP82_AJECG          TK---NLAAVPYLREVLENRG-EDPMCRHEAAEALGALC--DSDSLDLLRNLRDD--ENE
DOHH_ASPFU            TR---NPASLPFLQQVAKDTE-QDTMCRHEAAEALGALG--YEDSLEILKALRDN--QNE
DOHH_NEOFI            TR---NPESVPFLQQVAKDTE-QDTMCRHEAAEALGALG--YEDSLEILKALRDN--QNE
DOHH_ASPCL            TR---NPESVPYLQEVVKDTE-QDTMCRHEAAEALGALG--YEDSLEILKVLRDN--KDE
DOHH_ASPNC            TR---NPDAVAFLQQVLKDKE-EDVMCRHEAAEALGALG--YEDSLEILKALKDD--ENE
DOHH_ASPOR            TR---NPDAVSYLLEVVKNTE-QDAMCRHEAAEGLGALG--FDTSLDVLKALRDD--EKE
DOHH_EMENI            TR---NTDALPFLLDVVQDTQ-EDSMCRHEAAEALGALG--YESSLEVLKALRDN--ENE
DOHH_COCIM            TR---NLDTVPHLRKVLEDTQ-EDAMCRHEAAEALGALG--DAGSLAILQRLRDD--ESE
D5GHJ2_TUBMM          SA---DSYAAQFLQSILDTKS-EDPMVRHEAAEALGALA--HAESLPLLEKYLND--PEE
A8NRZ7_COPC7          LK---KESALPKLEAVLRDTA-EDPMVRHEAAEAIGAIS--SKGSIPVLEEFL----KDS
DOHH_LENED            IR---NPLALPVLESVLRNPS-EDPMVRHEAAEAMGAIS--TADSIPILKQYL----SDP
E3JYZ9_PUCGT          IA---DPTALPVLEATLRDTS-VHPMVRHEAAEAMGAIG--NPISLGILREFL----KDE
F4P405_BATDJ          MK---NSHAIPYLTRVLRNMQ-EQPMVRHEAAEALGAIA--DPSALEILQPFL----KDD
I1CAV6_RHIO9          IG---NPKANSILSEVLEDLN-EHEMVRHEAAEALGAIG--SLESLPILEKYL----NDK
DOHH2_ORYSJ           MQ---DAEAIPALEAVLKDLS-LHPIVRHEAAEALGAIG--LEKSISLLEESLA---VDP
DOHH1_ORYSJ           MQ---DAEAIPALEAVLKDLS-LHPIVRHEAAEALGAIG--LEKSIPLLEESLA---ADP
C5XW00_SORBI          MQ---DAEAIPALVAVLKDLS-LHPIVRHEAAEALGAIG--LEKSIPLLEESLT---TDP
B9H8J8_POPTR          MQ---DAEAIPALEAVLNDLS-LHPIVRHEAAEALGAIG--LESIVPLLKNSLT---GDP
B9GS37_POPTR          MQ---DAEAIPALEAALNDLS-LHPIVRHEASEALGAIG--LESNVPFLKNSLT---NDP
D7U2X4_VITVI          MQ---DVDAVPALEAVLNDFS-LHPIVRHEAAEALGAIG--LESNVPLLKNSLV---VDP
DOHH_ARATH            MQ---DAEAIPALESVLNDMS-LHPIVRHEAAEALGAIG--LAGNVNILKKSLS---SDP
A9SHU2_PHYPA          MQ---DAEAIAALRNTLRSVNEFHSIVRHEAAEALGAIG--KPECLELLQEALV---NDP
A8IGJ8_CHLRE          RQ---DSRAVQVLTSILHDNN-EHPMVRHEAGEALGAIG--TEECLTPLREHQ----QDS
F1A2N7_DICPU          ME---NDHALSVLIDLVKNHD-EHPMVRHEAAEALGAIG--NPIALETLKEHS----TDK
D0NC43_PHYIT          FQ---MEEACETLQQVLADEA-DDGMVRHEAAEALGAIG--ASQSLPVLEKYS----ADP
H3GH76_PHYRM          FQ---REEACDTLHRVLSDEL-DDGMVRHEAAEALGAIG--AAQSLPILEQFS----TDS
DOHH_ENCCU            MR---MEESVRVLLDVLSDED-EDEIVRHEAGEALGNFRP-REEIVEALRKYS----NHP
Q38FR2_TRYB2          SA---MVEACPHLERFIRAVGKYDIVTRHEAVEALGAIGD-PACIPLLRHFMEPA--NEP
V5BF70_TRYCR          CG---LEEACPILERVIHATDVYDTVTRHEAVESLGAIAS-SSSKPILERYMDPA--HEP
Q4Q901_LEIMA          SG---REEAVPELERILRTTS-YDVVTRHEAAEALGAIGS-PLALQVLETHSAPT--TEP
A4I2C0_LEIIN          SG---REEAVPELERILRTTS-YDVVTRHEAAEALGAIGS-PLALQVLEAHSDPT--TEP
A4HF36_LEIBR          SG---LEEAVPELERILRTVS-YDVVTRHEAAEALGAIGS-SLALQVLEAHSDPT--TEP
B7XJJ9_ENTBH          LK---NDISIPFLINLAKNIK-YDPIVRHEAIEALGNFE--DINIIKHLELFL----TNN
Q4UHP1_THEAN          SG---CFSASKKLAELVEDVT-EDPMVRHEAIEALAALK--SKDHIHLIKKYC----DDE
Q4N7W5_THEPA          SG---CFSASKKLAELVENVT-EDPMVRHEAIEALAALK--SKDYIHLIKKYC----EDE
A7AS23_BABBO          AE---CEEAADVLVRLLEDTN-EDPMVRHEAAEAIAAIG--DKKYIDKLEKYK----DDE
A0A0Z0AA05_PLABE      IS---NEKSNDLLIKLLSDKE-ENLMVRHEAAEGLAAIG--SDSNIEVIQRFI----NDE
Q7PDV0_PLAYO          IG---NEKSNDLLIKLLSDKE-ENLMVRHEAAEGLAAIG--SDSNIEVIQRFI----NDE
B3LBI7_PLAKH          IS---NEKCNDILIKLLSDTE-ENLMVRHEAAEGLAAIG--SDSNIDVIKKFL----NDE
DOHH_PLAVS            IS---NEKCNDILIKLLNDTE-ENLMVRHEAAEGLAAIG--SDSNIEVIKKFL----NDE
Q8I701_PLAF7          IS---NEKCNNILINLLSDEN-ENIMVRHEAAEGLAAIG--SESNIPVIKKYL----NDS
Q5CQK0_CRYPI          MG---LKSPLTRLYEILADET-EHPMVRHEAGEAIAAIG--DDESLEIVEKYLN----DN
G4VSX8_SCHMA          RG---DPKAVPYLLNALHNDK-HVTLIRHEAAEALAALSGCDGADIEVIEKALKEYVNSN
A0C8W1_PARTE          ADLGLEPLITQFLIQIISDDQ-QFDVVRHEGAEALANIN--QKEALEIFEKYSKKNVNDD
                                  *            : ***. *.:. :                      

I3NAV7_ICTTR          TVEVAETCQLAVRRLEWLQQ----------------------------------------
G1LG94_AILME          VIEVAETCQLAVQRLESLQQ----------------------------------------
DOHH_HUMAN            VIEVAETCQLAVRRLEWLQQ----------------------------------------
H0WUB8_OTOGA          IVEVAETCQLAVQRLEWLQK----------------------------------------
DOHH_MOUSE            VVEVAETCQLAVGRLEWLQQ----------------------------------------
DOHH_RAT              VVEVAETCQLAVRRLEWLQQ----------------------------------------
DOHH_CHICK            VVEVAETCQLAVRRLEWLQE----------------------------------------
H3A597_LATCH          VIEVAETCQLAVKRIEWLQN----------------------------------------
DOHH_DANRE            VIEVAETCQLAVKRLEWLMNGGE-------------------------------------
H3CCH9_TETNG          VVEVAETCQLALRRLEWLQASEKL------------------------------------
F6UWS3_XENTR          VIEV-KTLILCV-LAYHFLK----------------------------------------
F6UWT4_XENTR          VIEV-KTLILLLCFTKWLLS----------------------------------------
DOHH_XENLA            VIEVAETCQLAVSRIEWLQK----------------------------------------
B6IF58_CAEBR          CPEVSETCQIALGRVEWVEKSGKD------------------------------------
DOHH_CAEEL            CPEVSETCQIALGRVEWVEKSGKD------------------------------------
E0VTF2_PEDHC          IQEVAETCELALARLSWLQNNDND------------------------------------
Q7PUV4_ANOGA          VVEVAETCEIALERVRWLK-QKE-------------------------------------
W5JH70_ANODA          VIEVAETCEIALERVRWLK-QKATN-----------------------------------
Q177G8_AEDAE          VVEVAETCEIALGRVRWLQ-NKE-------------------------------------
DOHH_DROME            VVEVAETCAIALDRVRWLQ-SGQ-------------------------------------
DOHH_DROPS            VVEVAETCAIALDRVRWLQ-SGQ-------------------------------------
E9GHP7_DAPPU          VTEVAETCQLAVQRINWLLDEKKKS-----------------------------------
B3RM40_TRIAD          IREIADTCHLAVNRIQWLKTHGA-------------------------------------
A9UV60_MONBE          SVEVAETCEIALDRIAFKQQAKQ-------------------------------------
DOHH_DEBHA            SIEIKQTCELAIERIRWENSEKAKA-----------------------------------
DOHH_CANAL            LLEIRQTCELAIERIHWENSEKAKN-----------------------------------
DOHH_ASHGO            SEEVRQTSELAIERIRWQASGAAAT-----------------------------------
DOHH_KLULA            LLEIRQTCELAIDRIKWETSEEGRR-----------------------------------
DOHH_CANGA            HVAVRETCELAIARINWQHSDAPTK-----------------------------------
DOHH_YEAST            HVAVRETCELAINRINWTHGGAKDK-----------------------------------
DOHH_YARLI            LEVIRETCELALERIKWENSEAAKT-----------------------------------
DOHH_SCHPO            LAPIRETCELAIARIQWKNGLDKNN-----------------------------------
C7Z7L0_NECH7          DISIVETCEIAIERVEWENSEERQK-----------------------------------
DOHH_GIBZE            DISIVETCEIAIERIEWENSAERQK-----------------------------------
DOHH_NEUCR            DVSVKETCEIAIDRIEWENSEERKQ-----------------------------------
DOHH_CHAGB            EVVVTETCELAVERIEWENGEGKKA-----------------------------------
A7ESN0_SCLS1          PVEVSQTCELSVERIEWEHSDAGKA-----------------------------------
DOHH_PHANO            VDVVRETCDIAVDRIEWEHGLQKGT-----------------------------------
C0NP82_AJECG          PDVVRETCDIAVERIEWEMSGRRKA-----------------------------------
DOHH_ASPFU            PEVIRETCDIAVDRILWENSEARKA-----------------------------------
DOHH_NEOFI            SDVIRETCDIAVDRILWENSEARKA-----------------------------------
DOHH_ASPCL            PDVIRETCDIAVDRILWENSEQRKA-----------------------------------
DOHH_ASPNC            PEVIRETCDIAVDRIVWENSEARKA-----------------------------------
DOHH_ASPOR            EDVIRETCDIAVDRILWENSEERKS-----------------------------------
DOHH_EMENI            VDVVRETCDIAVDRILWEQSEARKA-----------------------------------
DOHH_COCIM            EEVVRETCDIAVDRILWETSKDSKS-----------------------------------
D5GHJ2_TUBMM          --VVRQTCELSIARINWVSSQKDGE-----------------------------------
A8NRZ7_COPC7          ERAVRETCEIAIAKIQWDHSEEAKR-----------------------------------
DOHH_LENED            DRSVRETCEIAIAKIEWDKTEEGAK-----------------------------------
E3JYZ9_PUCGT          EVSVRETCELAIEKIEGNES----------------------------------------
F4P405_BATDJ          VVEVRETTVLAIEKIKYEMSKAENN-----------------------------------
I1CAV6_RHIO9          NESVVETCELAIDKIKYDHDPKNKA-----------------------------------
DOHH2_ORYSJ           AVEVQETCELAIRRIEEQK----NT-----------------------------------
DOHH1_ORYSJ           AVEVQETCELALRRIEQQK----NA-----------------------------------
C5XW00_SORBI          AVEVQETCELALRRIEEQK----KA-----------------------------------
B9H8J8_POPTR          AQEVRETCELALKRIEEMNATTSTV-----------------------------------
B9GS37_POPTR          AQEVRETCELALKRIEEMN-STSNV-----------------------------------
D7U2X4_VITVI          AQEVRETCELALRRIEEVKNVVGN------------------------------------
DOHH_ARATH            AQEVRETCELALKRIEDMSNVDAE------------------------------------
A9SHU2_PHYPA          APEVRETCELALHRIHQVE-----------------------------------------
A8IGJ8_CHLRE          VLEVAETCQLALQRIEWLK-----A-----------------------------------
F1A2N7_DICPU          VREVSETCQLALSRVEWYTE----------------------------------------
D0NC43_PHYIT          APEVSDTCKLAVTLVKYKLAKAKGE-----------------------------------
H3GH76_PHYRM          APEVSDTCKLAVDLVKYKLAKAQGK-----------------------------------
DOHH_ENCCU            KKPISETCYLALMKLKDGSDIVSK------------------------------------
Q38FR2_TRYB2          EAAIRESCELALKRIEMLEEKGKEA-----------------------------------
V5BF70_TRYCR          HKAIRDSCELALERIRIRELRGDAA-----------------------------------
Q4Q901_LEIMA          EASIRETCELALARIAMKETKGDAA-----------------------------------
A4I2C0_LEIIN          EAPIRETCELALARIAMKETKGDAA-----------------------------------
A4HF36_LEIBR          EAPIRETCELALARIERKEAKGSAA-----------------------------------
B7XJJ9_ENTBH          NDLIRESAILAIYKLNQLSYNNGIS-----------------------------------
Q4UHP1_THEAN          NRAVRDTCNLALHTLINAE---DSN-----------------------------------
Q4N7W5_THEPA          NRAVRDTCNLALHTLTNAE---ESN-----------------------------------
A7AS23_BABBO          SIVVRDTCRLALESLNNNAKKGDSSDGVA-------------------------------
A0A0Z0AA05_PLABE      QIEVRETCELALSSLIEKNKYTVCS----CSNK---------------------------
Q7PDV0_PLAYO          QIEVRETCELALSSLIEKNKYTVCS----CSNK---------------------------
B3LBI7_PLAKH          KVEVRETCELALSSLLEKNKYATCS----CSNK---------------------------
DOHH_PLAVS            KVEVRETCELALSSLLEKNKYAVCS----CSNK---------------------------
Q8I701_PLAF7          SVEVRETCELALSSLIEKNKYAACS----CINKTVPYKNNVLNNDNPKRDSNNNSNNNNN
Q5CQK0_CRYPI          SPAVRETCYLAAHSLRLKREKRLKE-----------------------------------
G4VSX8_SCHMA          ITELAETCQVGLNRIEWIKKKKTGQHK---------------------------------
A0C8W1_PARTE          LNILQDTCTIGLEKAKSINELGHLY-----------------------------------
                         : .:  :                                                  

I3NAV7_ICTTR          -------HPGQPAVAGP----------------YLSVDPAPPAEE-RDLGQ---------
G1LG94_AILME          -------HSGEPAVAGP----------------YLSVDPAPPAEE-RDVGR---------
DOHH_HUMAN            -------HGGE-PAAGP----------------YLSVDPAPPAEE-RDVGR---------
H0WUB8_OTOGA          -------HHGE-LVAGP----------------YLSVDPAPPAEE-RDVGR---------
DOHH_MOUSE            -------HPGEATCAGP----------------YLSVDPAPPAAE-QDVGR---------
DOHH_RAT              -------HPGEATCAGP----------------YLSVDPAPPAAE-GDVGR---------
DOHH_CHICK            -------HGEE-PGSSP----------------YRSVDPAPPAEE-TDVAT---------
H3A597_LATCH          -------NEKDGE-ENP----------------YFSVDPAPPDQE-KDVKK---------
DOHH_DANRE            -------QTKDGTDENP----------------YCSVDPAPPAQR-KSVPE---------
H3CCH9_TETNG          -------PAEDGVEENP----------------YCSVDPAPAAAR-RSVPE---------
F6UWS3_XENTR          --------YFHLEGGHS----------------TKSVLPYPDCRP-LRNIG---------
F6UWT4_XENTR          --------YFHLEGGHS----------------TKSVLPYPDCKD-FGVTK---------
DOHH_XENLA            --------NPDSPDTNP----------------YLSVDPAPPAEE-KDVPT---------
B6IF58_CAEBR          ---------TNSP--------------------YDSVDPTPSAST-VDVTE---------
DOHH_CAEEL            ---------TNSP--------------------YDSVDPTPSAST-SDVEE---------
E0VTF2_PEDHC          ---------KESDSFHH----------------FQSVDPAPASNE-TDLVK---------
Q7PUV4_ANOGA          ----------ALKDDNP----------------YASVDPTPPATS-KSVEE---------
W5JH70_ANODA          -------EKTDSKDGNP----------------YASVDPTPAADG-RSVEE---------
Q177G8_AEDAE          ---------TNLVDNNP----------------YASVDPTPPAET-SNVAE---------
DOHH_DROME            ----------KVDDSNP----------------YASVDPSPPTAGDKSVTE---------
DOHH_DROPS            ----------QVADNNP----------------YASVDPSPPTAGDKSVAE---------
E9GHP7_DAPPU          -------EIDSAYQQNP----------------YCSVDPTPSTSV-KETGE---------
B3RM40_TRIAD          ---------KENLSNNP----------------FNSIDPAPPCKE-DNVSK---------
A9UV60_MONBE          --------ADELSPSGG----------------YLSVDPAPPAPE-ADIAS---------
DOHH_DEBHA            -------E---NLETSL---------------YTSI-DPAPPMPS-DQESK---------
DOHH_CANAL            -------E---VLEKSL---------------YTSI-DPAPPLATNDSTSK---------
DOHH_ASHGO            -------E---QLQQSL---------------YSSV-DPAPPLSL-EKDYD---------
DOHH_KLULA            -------E---ALQESL---------------YSSI-DPAPPFSL-EKDYK---------
DOHH_CANGA            -------E---SLQQSL---------------YSSI-DPAPPLAL-EKEYD---------
DOHH_YEAST            -------E---NLQQSL---------------YSSI-DPAPPLPL-EKDAT---------
DOHH_YARLI            -------E---TLQKSA---------------YTSI-DPAPPLPTDQAEGSD-----KAT
DOHH_SCHPO            -------E---KITPSM---------------YDSVVDPAPPMPDHEQDVKS-----E--
C7Z7L0_NECH7          -------E---KLRPSA----------------FSSIDPAPPMPE---TDK------KAE
DOHH_GIBZE            -------E---KLRPSD----------------FASIDPAPPMPE---SDK------EAE
DOHH_NEUCR            -------E---KLRQSD----------------FASVDPAPPMPE---DDE------KQT
DOHH_CHAGB            -------E---KLRASD----------------FSSVDPAPPTAQ---GQE------EQT
A7ESN0_SCLS1          -------E---KLRQSD----------------FASIDPAPPTAE---GNSG-----SLS
DOHH_PHANO            -------E---KLKKSD----------------FTSVDPAPPMPE---SNE------APS
C0NP82_AJECG          -------E---NLKQSD----------------FTSIDPAPPLPM---ATD------EPS
DOHH_ASPFU            -------E---KLKTSD----------------FTSIDPAPPLPM---TAS------EPS
DOHH_NEOFI            -------E---KLKTSD----------------FTSIDPAPPLPM---TAS------EPS
DOHH_ASPCL            -------E---KLKASD----------------FTSIDPAPPLPM---ATS------EPS
DOHH_ASPNC            -------E---KLKPSD----------------FTSIDPAPPMPL---EAA------EPS
DOHH_ASPOR            -------E---KLKPSD----------------FTSIDPAPPLPM---ASS------QPS
DOHH_EMENI            -------E---KLKPSD----------------FTSIDPAPPMPL---TAK------EPS
DOHH_COCIM            -------E---KLKQSD----------------FTSIDPAPPLPL---SSA------EQS
D5GHJ2_TUBMM          -------G---GSKDGSGQEGG---------LFAGVVDPAPPAG-------------GGN
A8NRZ7_COPC7          -------Q----REAENA-------------VPYTSIDPAPATSKLLAGKPKPEDISSES
DOHH_LENED            -------NDKATRDENRL-------------PLYTSIDPAPATSGLLTGAPRPEEISQTK
E3JYZ9_PUCGT          ------------FKANEA-------------GVYGTIDPAPSMIKSFHDTS-ATDLGRND
F4P405_BATDJ          -------D----VSEEDS-------------CMYSSVDPAPAAKHAHLLTK---------
I1CAV6_RHIO9          -------E-----KETNK-------------SLYHSVDPAPPTTETRSVEE---------
DOHH2_ORYSJ           -------SGVESATVSP----------------FLSVDPALPAKQGLPVEQ---------
DOHH1_ORYSJ           -------GVSESTTISP----------------FLSVDPALPAKQGLSVHQ---------
C5XW00_SORBI          -------NGAESTVASP----------------FLSVDPALPAKHGLSVDQ---------
B9H8J8_POPTR          -------DGSSVAEKSP----------------FLSVDPAAPASLSSSVDE---------
B9GS37_POPTR          -------DGSSVAEKSP----------------FMSVDPAAPASFCSSVDE---------
D7U2X4_VITVI          -------DGMSMVEASP----------------FLSVDPAAPASSCSSVDQ---------
DOHH_ARATH            -------NQSSTTEKSP----------------FMSVDPAGPAASFSSVHQ---------
A9SHU2_PHYPA          ---------AEDLEESP----------------FRSVDPVIAASSSSSVAE---------
A8IGJ8_CHLRE          -------HPEAGDEESP----------------YYSVDPTPALPTSTPTEE---------
F1A2N7_DICPU          -------NEPESIDNKV----------------YLSVDPAPPLPTGTNHES---------
D0NC43_PHYIT          -------VVEGEVDRNP----------------YLSEDPAPAAEKDVSTAE---------
H3GH76_PHYRM          -------VAEGEVDRNP----------------YLSEDPAPAAEKDVTTAE---------
DOHH_ENCCU            ---------------------------------FGSRDPALPMEGSFEEAR---------
Q38FR2_TRYB2          -------VGPAAN------------------CPFVSIDPAPAFNG--TNTGGSA---PYT
V5BF70_TRYCR          -------LKLPCN------------------CPYASVDPAPAFCD--ANTDGPV---PFT
Q4Q901_LEIMA          -------VAPPSG------------------CEFVSVDPSPAFSALYSSTDEPV---PLT
A4I2C0_LEIIN          -------VAPPSG------------------CEFVSVDPSPAFSALYSSTDEPV---PHT
A4HF36_LEIBR          -------VAPPSG------------------CEFVSVDPSPAFSALDSSTDEPV---PQT
B7XJJ9_ENTBH          -------KIS----------------------IFGSRDPTYPANE---------------
Q4UHP1_THEAN          ------TEGCTSFPISS--------------SPYRAIDPVRTDSVD--ESDLNS------
Q4N7W5_THEPA          ------TEGCTSFPISS--------------SPYRAIDPVRTDSVD--ESDLNS------
A7AS23_BABBO          ------ICGCVSAPIST--------------SAYRAIDPVPCVATEIAEMSILE------
A0A0Z0AA05_PLABE      NIIKDAIKEKRSEEFVS--------------KKFNTIDPIVFTLNSN--DNFVK------
Q7PDV0_PLAYO          NIIKDAIKEKRSEEFVS--------------KKFNTIDPIVFTLNSN--DNFGK------
B3LBI7_PLAKH          DNIKEEIKKKRNEEFIS--------------KKFNTIDPVVFTPNDNT-KSVDA------
DOHH_PLAVS            DSIKEAIKKKRNDEFVS--------------KKFNTIDPVVFTSSGNA-KSVDA------
Q8I701_PLAF7          NNINNNNSNSHSNSFSNSQDDADDDVYFHSKKKFNTIDPVVCISDSNNKKHVND------
Q5CQK0_CRYPI          -------SNKQDIDTNISNI-----------NAFNTRDPTPPKSSCEVSHI---------
G4VSX8_SCHMA          -------DSQALCDLATK-------------LFPNTIDPAHSFTGDQQYTD---------
A0C8W1_PARTE          --------------------------------GKRYLGTREPAAPFEHLDK---------
                                                            .                     

I3NAV7_ICTTR          --LREA-LLDET--LPLFDRYRAMFALRNAGGQ------------------------EAA
G1LG94_AILME          --LREAGLLDEA--RPLFDRYRAMFALRDAGGE------------------------EAA
DOHH_HUMAN            --LREA-LLDES--RPLFERYRAMFALRNAGGE------------------------EAA
H0WUB8_OTOGA          --LREV-LLDET--QPLFDRYRAMFALRNAGGR------------------------EAA
DOHH_MOUSE            --LREA-LLDEA--RPLFERYRAMFALRNVGGK------------------------EAA
DOHH_RAT              --LRET-LLDEA--QPLFERYRAMFALRNVGGK------------------------EAA
DOHH_CHICK            --LRAV-LLDES--RPLFDRYRAMFALRNLGGR------------------------DAV
H3A597_LATCH          --LRES-LLDES--LPLFDRYRAMFALRNLGGE------------------------EAV
DOHH_DANRE            --LRTQ-LLDET--LPLFDRYRAMFALRNLGTE------------------------EAV
H3CCH9_TETNG          --LRLS-LLDES--LPLFERYRAMFALRNHGSE------------------------EAV
F6UWS3_XENTR          --GEEA-VLALA--DDFSLNLGDMFALRNIGGE------------------------EAV
F6UWT4_XENTR          --VSSQ-VMTCL--CSYMEPFGDMFALRNIGGE------------------------EAV
DOHH_XENLA            --LRAT-LLDET--CPLFHRYRAMFALRNIGGE------------------------EAV
B6IF58_CAEBR          --LAAT-LVNVS--LPLFDRYRAMFSLRNINTD------------------------ESI
DOHH_CAEEL            --LAAT-LIDAS--LPLFDRYRAMFSLRNIKTD------------------------KSI
E0VTF2_PEDHC          --LDRM-LLNES--LSLFDRYKAMFALRNIASD------------------------ESA
Q7PUV4_ANOGA          --LQRI-LMDEA--DTLFNRYRAMFALRNLRTE------------------------EAT
W5JH70_ANODA          --LQRI-LMDET--DTLFNRYRAMFALRNLQSK------------------------EAT
Q177G8_AEDAE          --LQKI-LMDDN--ESLFNRYRAMFSLRNLRTE------------------------ESV
DOHH_DROME            --LKAI-YLDAQ--QSLFDRYRAMFSLRNLRTE------------------------ESV
DOHH_DROPS            --LKAI-YLDAK--QTLFDRYRAMFSLRNLCTE------------------------ESV
E9GHP7_DAPPU          --LKTI-LLDET--LPLFERYRAMFALRNKGDV------------------------ESV
B3RM40_TRIAD          --LYSI-LTNAD--EDLFNRYRAMFSLRNMATD------------------------KSV
A9UV60_MONBE          --LRDQ-YLDTS--RSLFQRYRSLFALRNIGNT------------------------EAV
DOHH_DEBHA            VEKLQKILNNQD--EPLFERYRAMFRLRDMGTD------------------------EAC
DOHH_CANAL            VEKLKEILNDQD--KPLFERYRAMFRLRDIGTD------------------------EAC
DOHH_ASHGO            VPQLQALLNDQR--APLFERYRAMFRLRDIGSD------------------------EAC
DOHH_KLULA            IQELKDILNDQN--RPLFERYRAMFRLRDIGND------------------------EAC
DOHH_CANGA            LEELKKLLNDQE--KPLFLRYRAMFRLRDIGTD------------------------EAV
DOHH_YEAST            IPELQALLNDPK--QPLFQRYRAMFRLRDIGTD------------------------EAI
DOHH_YARLI            VEKLQKTLMDKS--QSLFHRYRAMFRLRDIGTE------------------------DAV
DOHH_SCHPO            VAKLRSEIVDQN--LPLFYRYRVMFRLRNIGNE------------------------EAV
C7Z7L0_NECH7          VAELGRKLMDTK--APLFIRYRAMFALRDLASPPDLPTAV-----------------PAV
DOHH_GIBZE            VEDLGRKLMDTN--ADLFSRYRAMFALRDLASPPDLPTAT-----------------PAV
DOHH_NEUCR            VETLEKKLLDTS--LPLFKRYRAMFALRDLASPPDLPTAV-----------------PAI
DOHH_CHAGB            VEELGNALMDTS--LPLFKRYRAMFALRDLASPPDLPTAV-----------------PAV
A7ESN0_SCLS1          IEKLEETLLDTK--TSLFKRYRAMFALRDLASPPDLPTAV-----------------PAV
DOHH_PHANO            IPALEKTLLDTT--LPLFQRYRAMFALRDLSSPPDLPTAV-----------------PAV
C0NP82_AJECG          IPDLERTLLDPN--LPLFQRYRAMFALRDLASPPDLPTAV-----------------PAV
DOHH_ASPFU            IPEIEQTLLDTS--LPLFLRYRAMFALRDLASPPDLPTAT-----------------RAV
DOHH_NEOFI            IPEIEKTLLDTS--LPLFLRYRAMFALRDLASPPDLPTAT-----------------RAV
DOHH_ASPCL            IPDIEKRLLDTS--LPLFQRYRAMFALRDLASPPDLPTAT-----------------HAV
DOHH_ASPNC            IPELEKTLLDTK--LPLFQRYRAMFALRDLASPPDLPTAV-----------------QAV
DOHH_ASPOR            ISDLEKTLLDTK--LPLFQRYRAMFALRDLASPPDLPTAV-----------------EAV
DOHH_EMENI            IPDLEKTLLDTN--LPLFERYRAMFGLRDLASPPDLPTAK-----------------QAV
DOHH_COCIM            IPELKQILLDAS--LPLFKRYRAMFALRDMCSPPDLPTAV-----------------PAI
D5GHJ2_TUBMM          VEELQRTLNDQG--TDLFERYRVMFRLRDIGSK------------------------EAV
A8NRZ7_COPC7          IQALQAQLVDTK--LPLFERYRAMFALRNIGTAE------------------------AV
DOHH_LENED            IDELRDNLLDVN--RPLFERYRAMFALRNIGSPA------------------------AV
E3JYZ9_PUCGT          LIKMKFQLLDQQ--KSLFERYRAMFGLRDAVRRASENDELD---------------GIAI
F4P405_BATDJ          --QLRETLLDDN--KSLFERYRAMFALRNRGNSE------------------------DV
I1CAV6_RHIO9          ---LEAQLTNPK--LKLFVRYRAMFALREIGNTE------------------------AV
DOHH2_ORYSJ           ---LRELLLNEQ--ESMYERYAALFALRNDSGD------------------------AAV
DOHH1_ORYSJ           ---LREILLNEQ--ESMYERYAALFALRNDSRD------------------------AAV
C5XW00_SORBI          ---LRDLLLNEQ--ESMYERYAALFALRNDGGD------------------------AAV
B9H8J8_POPTR          ---LRG----------MYERYGALFALRNHGGD------------------------GAV
B9GS37_POPTR          ---LRGVLLDEK--RSMYERYGALFALRNHGGD------------------------EAV
D7U2X4_VITVI          ---LREVLLDEE--KGMYERYAALFALRNQGGD------------------------EAV
DOHH_ARATH            ---LRQVLLDET--KGMYERYAALFALRNHGGE------------------------EAV
A9SHU2_PHYPA          ---MRKVLLDEK--EKMHLRYEALFGLRNRGGP------------------------EAV
A8IGJ8_CHLRE          ---LRQVLLDEN--KRMFDRYSALFALRNKGGD------------------------EAV
F1A2N7_DICPU          ---LCKQFLNQE--LDIFNRYRALFSLRDCGDE------------------------KSV
D0NC43_PHYIT          ---LRKVLLDPN--GDMFARYRAMFSLRNRNTE------------------------EAA
H3GH76_PHYRM          ---LRKVLLDHD--GDMFAKYRAMFSLRNRNTE------------------------EAA
DOHH_ENCCU            -----RILLDKN--ECLYRRYQAMFYLRDLGTS------------------------AAI
Q38FR2_TRYB2          VSELENLLCDTTGAVSLWLRYQAMFTLRNIGTP------------------------EAV
V5BF70_TRYCR          VEELERLLCDTTGATSLWRRYQAMFSLRNMGTE------------------------AAV
Q4Q901_LEIMA          VEELEAVLLDTSGRTRLFRRYMAMFTLRNLATE------------------------AAV
A4I2C0_LEIIN          VEELEAVLLDTSGHTRLFRRYMAMFTLRNLATE------------------------AAV
A4HF36_LEIBR          VEELEAVLLDTSGRTRLFRRYMAMFTLRNLATE------------------------AAV
B7XJJ9_ENTBH          --SNLNNLKHMFIYGTLIEKYQAMFKLRDINTQ------------------------ESI
Q4UHP1_THEAN          ---LSEILFNQS--LPLYKRYEALYKIRGISGD------------------------EAA
Q4N7W5_THEPA          ---LSKLLFDQS--LPLYKRYEALYKIRGHSGD------------------------EAA
A7AS23_BABBO          ---LNKVMLDEA--APLHKRYEALFQIRNSGGD------------------------EAA
A0A0Z0AA05_PLABE      ---LIEDLNNVN--NPLKLRYEALFKLRDMESE------------------------DSI
Q7PDV0_PLAYO          ---LIEDLNNDN--IPLKSRYEALFKLRDMESE------------------------DSI
B3LBI7_PLAKH          ---LIEDLNNER--IPLKLRYEALFKLRDMETD------------------------MSI
DOHH_PLAVS            ---LIEDLNNEA--VPLKLRYEALFKLRDMETD------------------------VSI
Q8I701_PLAF7          ---LIRDLNNEA--LALKNRYEALFLLRDMETD------------------------TSL
Q5CQK0_CRYPI          -ESLASDLLNED--LQLEKRYAALFALRNILTGIIDSNQRKSLSDQYDQQIDNDKVHFIA
G4VSX8_SCHMA          -EQLHDLLMDPN--QNLFTRYRAMFTLRDRVLQAVIDKTSPE---------------KPA
A0C8W1_PARTE          --NPVEYILDDQ--TTLFNKYRALYYLRNNAET-------------------------YF
                                             :: :*                                

I3NAV7_ICTTR          LALAEGLRC--GSALFRHEVGYVLGQLQHEAAV--PQLAATLAHPAESPMVRHECAEALG
G1LG94_AILME          LALAEGLRS--GSALFRHEIGYVLGQLQHEAAV--PQLTATLARQAESPMVRHECAEALG
DOHH_HUMAN            LALAEGLHC--GSALFRHEVGYVLGQLQHEAAV--PQLAAALARCTENPMVRHECAEALG
H0WUB8_OTOGA          LALAEGLHC--GSALFRHEVGYVLGQLQHEAAV--PQLGAALACHSENPMVRHECAEALG
DOHH_MOUSE            LALAEGLQC--GSALFRHEVGYVLGQLQHEAAV--PGLAATLARTTESPMVRHECAEALG
DOHH_RAT              LALAEGLKC--GSALFRHEVGYVLGQLQHEAAV--SELAATLARTTESPMVRHECAEALG
DOHH_CHICK            LALADGLRA--GSALFRHEIGYVLGQMQDEACV--PQLTAALRSRAENPMVRHECAEALG
H3A597_LATCH          LALADGLQC--SSALFRHEIGYVLGQMQHEACV--PQLTQALSKLEENPMVRHECAEALG
DOHH_DANRE            LALGDGLQC--SSALFRHEIGYVLGQIQHEASI--PQLQAALEKMDENAMVRHECAEALG
H3CCH9_TETNG          RALGAGLQC--SSALFRHEIAYVLGQMQHPAAV--SDLCATLESCSENPMVRHEAAEALG
F6UWS3_XENTR          LALADGLQI--SGSLFRHEIGYVLGQMQHKAAI--PGLSAALERFEENPMVRHECAEALG
F6UWT4_XENTR          LALADGLQI--SGSLFRHEIGYVLGQMQHKAAI--PGLSAALERFEENPMVRHECAEALG
DOHH_XENLA            LALADGLQI--GGSLFRHEIGYVLGQMQHKAAV--PGLSAALERFEENPMVRHECAEALG
B6IF58_CAEBR          KALAQGLYCE-DSALFRHEIAYVLGQVQSPVAI--KELKDRLLLPTENCMVRHECAEALG
DOHH_CAEEL            KALAQGLYCE-DSALFRHEVAYVLGQLQSPVAT--QELKDRLLLSTENCMVRHECAEALG
E0VTF2_PEDHC          LILTKGLKS--NSALFSHEIAFILGQLQNKVTI--PALIECLKDKTKNEMVRHECAEALG
Q7PUV4_ANOGA          LALASGLKG--KSALFRHEVAFVLGQLQEECSV--PFLVENLRDPAENEMVRHECAEALG
W5JH70_ANODA          LALATGLKG--KSALFRHEVAFVLGQLQEECSI--PFLVENLRDPAENEMVRHECAEALG
Q177G8_AEDAE          LALATGLKG--KSALFRHEVAFVLGQLQEPCSI--PFLADSLKDGAENEMVRHECAEALG
DOHH_DROME            LAIAEGLKD--SSALFRHEVAFVLGQLQEPCSI--PFLQENLEDRLENEMVRHECAEALG
DOHH_DROPS            LAIAEGLKD--SSALFRHEVAFVLGQLQEPCSI--PYLQENLEDHKENEMVRHECAEALG
E9GHP7_DAPPU          KALAEGLKC--SSALFRHEIAYVLGQVQSPACI--QELIERLELADENEMVRHECAEALG
B3RM40_TRIAD          KALAAALDV--EGALIKHEIAYVLGQMQHQAAV--ESLTKHLQDSTEHAMVRHECAEALG
A9UV60_MONBE          EAIVEGLND--SSALFRHEAAYVLGQMQHPASV--TGLAERLKDVSENYMVRHECAEALG
DOHH_DEBHA            LALASGLDDD-PSALFKHEIAYVFGQLCNPVTV--PALIKTLKDEREAAMVRHEAAEALG
DOHH_CANAL            LALASGFDD--PSALFKHEIAYVFGQMCNPVTV--PSLIKVLKDESEAGMVRHEAAEALG
DOHH_ASHGO            YALASGFDD--PSALFKHEIAYVFGQIGNPCVV--PHLQEVLKREHEAPMVRHEAAEALG
DOHH_KLULA            LALASGFDD--PSALFKHEIAYVFGQICNPVVV--PHLKEVLARPEEAPMVRHEAAEALG
DOHH_CANGA            LALASGFND--PSALFKHEIAYVFGQMGSTAAV--PSLTEVLGRKEEAPMVRHEAAEALG
DOHH_YEAST            LALATGFSA--ESSLFKHEIAYVFGQIGSPAAV--PSLIEVLGRKEEAPMVRHEAAEALG
DOHH_YARLI            LALATGFDD--SSALFRHEIAYVFGQMSDPASV--PALIKVLGKTEEEGMVRHEAAEALG
DOHH_SCHPO            LALTDGFKD--PSPLFRHEIAFVFGQMIAPASV--PALIKVLENTEEVPMVRHEAAEALG
C7Z7L0_NECH7          LELAKGFAD--SSALFRHEIAFVFGQLSHPASI--PSLTAALSDVNEASMVRHEAAEALG
DOHH_GIBZE            LALAKGLSD--SSALFRHEIAFVFGQLSHPASI--PALTEALSNTNEASMVRHEAAEALG
DOHH_NEUCR            LALAKGLKD--ESALFRHEIAFVFGQLSHPASI--PALTEALSNLDEVSMVRHEAAEALG
DOHH_CHAGB            LALAKGFAD--SSALFRHEIAFVFGQLAHPASI--PALTEALSNTEEASMVRHEAAEALG
A7ESN0_SCLS1          LALAKGLHD--PSALFRHEIAFVFGQLSHPASI--PALVGSLSNLEEASMVRHEAAEALG
DOHH_PHANO            HALARGFGD--PSALFRHEIAFVFGQLSHPASI--PSLTEALSNTKEASMVRHEAAEALG
C0NP82_AJECG          CALAEGFKD--SSALFRHEIAFVFGQLSHPASI--PSLTATLHNMEEASMVRHEAAEALG
DOHH_ASPFU            EALAKGLKD--PSALFRHEIAFVFGQLCHPASI--PSLTEALSNQSEAGMVRHEAAEALG
DOHH_NEOFI            EALAKGLKD--PSALFRHEIAFVFGQLCHPASI--PSLTEALSNQSEAGMVRHEAAEALG
DOHH_ASPCL            EALAKGLKD--PSALFRHEIAFVFGQLSHPASI--PSLTEALSDQNEVGMVRHEAAEALG
DOHH_ASPNC            DALAKGLKD--PSALFRHEVAFVFGQLCHPASV--PSLTECLSNQEEAGMVRHEAAEALG
DOHH_ASPOR            EALAKGLKD--PSALFRHEVAFVFGQLCHPASV--PSLTETLSDQKEMGMVRHEAAEALG
DOHH_EMENI            QSLAKGMKD--PSALFRHEIAFVFGQLCHPASV--PSLTETLSDLNEVGMVRHEAAEALG
DOHH_COCIM            EALAEGFKD--RSALFRHEIAFVFGQLSHPASI--PSLVATLSDKNEVGMVRHEAAEALG
D5GHJ2_TUBMM          DALASGFGD--PSALFRHEIAFVFGQLSDPHSI--PALIKVAGNKEEAPMVRHEAVEALG
A8NRZ7_COPC7          DALASGFAD--DSALFKHEIAFIFGQMLSPHSV--PALLQVLQNASESDMVRHEAAEALG
DOHH_LENED            DALAAGFSG--DSALFKHEIAFVFGQLLSPHSV--PCLIEVLQNSPESDMVRHEAAEALG
E3JYZ9_PUCGT          DALADGFSD--PSALFRHEIAYVFGQLSHPLSV--PALVKVLENKQEDEMVRHEAAEALG
F4P405_BATDJ          LALADGFAD--NSALFRHEIAYIFGQMQHPASI--PSLIKVLSNTSESAMVRHEAAEALG
I1CAV6_RHIO9          LALAKGLKD--KSALFRHEVAYVFGQLQHPASV--PALKECLADKDEVHMVRHEAAEALG
DOHH2_ORYSJ           SAIVAALGV--KSALLRHEVAYVLGQLQNKAAS--DALSTVLKNVDEHPMVRHEAAEALG
DOHH1_ORYSJ           SAIVAALGA--KSALLKHEVAYVLGQLQNKAAS--DALSTVLKNVDEHPMVRHEAAEALG
C5XW00_SORBI          SAIVAALSV--KSALLRHEVAYVLGQLQNKAAS--DALSTVLKDVCEHPMVRHEAAEALG
B9H8J8_POPTR          SAIVDSLAA--NSALLKHEVAYVLGQLQNKAAS--AALCRILRNANEHPMVRHEAAEALG
B9GS37_POPTR          SAIVDSLAA--SSALLKHEVAYVLGQLQNKVAS--AALCRILRDANEHPMVRHEAAEALG
D7U2X4_VITVI          SAIVDSLCA--NSALLRHEVAYVLGQLQDKAAS--AALSNILRNVNEHPMVRHEAAEALG
DOHH_ARATH            SAIVDSLSA--SSALLRHEVAYVLGQLQSKTAL--ATLSKVLRDVNEHPMVRHEAAEALG
A9SHU2_PHYPA          AAIVETLHC--ESALLKHEVAYVLGQLQDKDST--EALVTTLKDAMEHPMVRHEAAEALG
A8IGJ8_CHLRE          AALGAVFGA--RSALLKHEVAYVMGQMLDKKAV--DFLSGVLKNPEEHAMVRHEAAEALG
F1A2N7_DICPU          LALCEGLKD--SSALLKHEVAFVLGQLQHRAAI--DSLTTCVLDESESAMVRHEAAEALG
D0NC43_PHYIT          LALAEAFQD--PNALFKHEVAYVMGQMENPVLV--PALKKVLLDETEHRMVRHEAAEALG
H3GH76_PHYRM          LALAEAFSD--PNALFKHEVAYVMGQMENPVLV--PALKKVLLDDSEHRMVRHEAAEALG
DOHH_ENCCU            HALGKSMED--DSALFKHEVSFVFGQMRSRESI--PYLIKGMEDEKEHGMVRHECAEALG
Q38FR2_TRYB2          AALSRALRQDNTSALLRHEVAFVLGQLEHPASQ--PALLDALRDEHEAPMVRHEAAEALG
V5BF70_TRYCR          MALTRALRGDTVSALLRHEVAFVLGQMEHPSSQ--AALIEALKDETEAPMVRHEAAEALG
Q4Q901_LEIMA          AALCRGLREDTISALFRHEVAFVLGQLERPSSQ--PALIAALKDEEEAPMVRHEAAEALG
A4I2C0_LEIIN          AALCRGLREDNVSALFRHEVAFVLGQLERPSSQ--PALIAALKDEEEAPMVRHEAAEALG
A4HF36_LEIBR          AALCRGLREDTVSPLFRHEVAFVLGQLEHPSSQ--PALIAALKDEEEAAMVRHEAAEALG
B7XJJ9_ENTBH          DILNMGFSD--NSALLRHEVAYVLGQAKNSHAI--NALKLVLENESEEDVVRHEAAEALG
Q4UHP1_THEAN          KIIGEALVKDKVSEVFRHECAFVLGQMQSVAPV--KSLIECLRNRNEEPMARHEAALALG
Q4N7W5_THEPA          KIIGEALVRDKVSEVFRHECAFVLGQMQSVAPV--KSLIECLKNRDEEPMARHEAALALG
A7AS23_BABBO          VMIGNALISDNVSEVFRHECAFVLGQMQSMAAA--DHLIKCLANSKEKPIARHEAALALG
A0A0Z0AA05_PLABE      NALGEALLRDKKSAIFRHEVAFVLGQALRLNSL--KYLLSSLKNDKEHEMVRHEAALALG
Q7PDV0_PLAYO          NALGEALLRDKKSAIFRHEVAFVLGQALRLNSL--KYLLSSLKNDKEHEMVRHEAALALG
B3LBI7_PLAKH          NALGEVLIKDRKSAIFRHEVAFVLGQALHLNSL--KYLISSLQNVDEHEMVRHEVALALG
DOHH_PLAVS            NALGEVLIKDKKSAIFRHEVAFVLGQALHLNSL--KYLISSLQNVGEHEMVRHEVALALG
Q8I701_PLAF7          NALGEALVKDKSSAIFRHELAFVLGQVLHLNSL--KYLLSSLTNVSEHEMVRHEVALALG
Q5CQK0_CRYPI          GEIAKAMEIDKSSAVFRHECAFVLGQIQVISTA--DTLSRVLSNQSEESMVRHEAAFALG
G4VSX8_SCHMA          GLLAEGLTAP-NSALLRHEVAFVLGQLTVASTV--PQLSTCVRQTNEHPMVRHEAAEALG
A0C8W1_PARTE          DKIDQLLTSNKLGALFKHEICFVIGQVGEAPKQIHEALINMIKDENQPAIARHEAIAAFQ
                        :   :     . :: **  :::**           *        :  :.***   *: 

I3NAV7_ICTTR          AIARPSCLA--------------------ALHAHTA--DPERVVRESCLVALDMYEQ-ER
G1LG94_AILME          AIARPACLA--------------------ALRAYSA--DPERVVRESCEVALDMYEY-ET
DOHH_HUMAN            AIARPACLA--------------------ALQAHAD--DPERVVRESCEVALDMYEH-ET
H0WUB8_OTOGA          AIARPACLD--------------------MLRAYAA--DPERVVRESCEVALDMYEH-EN
DOHH_MOUSE            AIARPACLA--------------------ALREHIE--DPEQVVRESCEVALDMYEY-ES
DOHH_RAT              AIARPACLA--------------------ALREYIT--DPERVVRESCEVALDMYEY-EN
DOHH_CHICK            SIARPSCLE--------------------TLRAFAQ--DEERVVRESCEVALDMYEY-EN
H3A597_LATCH          SIAKGSCLE--------------------TLKEYLR--DEERVVKESCEVALDMYEY-EK
DOHH_DANRE            SIGKEPCVQ--------------------ILERYRK--DQERVVKESCEVALDMLEY-EN
H3CCH9_TETNG          AIGKQECLS--------------------VLQRYQQ--DGERVVKESCQVALDMLEY-EN
F6UWS3_XENTR          SIAHEDCLK--------------------ALRAHVG--DGEQVVRESCEVALDMYEY-EN
F6UWT4_XENTR          SIAHEDCLK--------------------ALRAHVG--DGEQVVRESCEVALDMYEY-EN
DOHH_XENLA            SIAHEDCLK--------------------ALRAHVG--DGERVVRESCEVALDMHDY-EN
B6IF58_CAEBR          AIANEECTE--------------------ILKQYVN--DEERVVRESCEVALDMVDY-EN
DOHH_CAEEL            AIANEECTE--------------------ILKQYVN--DEERVVRESCEVALDMAEY-EN
E0VTF2_PEDHC          AIATEECFN--------------------ILKTFLD--DEKRVVRESCEIALDICDY-EN
Q7PUV4_ANOGA          AIATDECTR--------------------VLNEYLK--DEKRVVKESCEVALDMCEY-EN
W5JH70_ANODA          AIATDECTR--------------------VLNEYLK--DEKRVVKESCEVALDMCEY-EN
Q177G8_AEDAE          AIATDECTK--------------------ILNEYLR--DEKRVVKESCEVALDMCEY-EN
DOHH_DROME            AIATEDCIQ--------------------ILNRYAE--DDKRVVKESCVIALDMCEY-EN
DOHH_DROPS            AIATDDCIQ--------------------ILTRYAD--DEKRVVKESCVIALDMCEY-EN
E9GHP7_DAPPU          SIAQDECRE--------------------ILQKYAD--DSARVVKESCEVALDMCEY-EN
B3RM40_TRIAD          SIATEACFE--------------------LLRKYIS--DSEPLVRESCIVALDMCEY-EQ
A9UV60_MONBE          SIASDEVLP--------------------LIKEFAK--DEAVVVKESCEVALDMAEY-EA
DOHH_DEBHA            SIATDECLP--------------------VLQSFLN--DKDQVVRDSAVVALDMYEY-EN
DOHH_CANAL            SIATDECLP--------------------VLQSFLN--DSEPVVRDSAIVALDMYEY-EN
DOHH_ASHGO            SIATDDVLP--------------------VLKRHLQ--DKDEVVRESAAIALDMYDY-EN
DOHH_KLULA            SIATDDVLP--------------------VLKEHLK--DSDSVVRESAIVALDMYEY-EN
DOHH_CANGA            AIASEDALP--------------------ILKQYLN--DEVDVVRESAIVALDMWEY-EN
DOHH_YEAST            AIASPEVVD--------------------VLKSYLN--DEVDVVRESCIVALDMYDY-EN
DOHH_YARLI            SIATDDVLP--------------------ILKKFAE--DKDQVVRESAIVALDMYEY-EN
DOHH_SCHPO            GIANDECLP--------------------VLKKFSK--DDVRVVAESCIVALDMIEY-EK
C7Z7L0_NECH7          SLGDEEGVE-------------------DTLRRFLH--DKEKVVRESVIVALDIADY-EK
DOHH_GIBZE            SLGEKDGVE-------------------DTLRKFLH--DKEKVVRESCIVALDIAEY-EK
DOHH_NEUCR            SLGDEEGVE-------------------ETLLKFLH--DKEKVVRESVIVALDMAEF-EQ
DOHH_CHAGB            SLGDEEGVE-------------------ETLRKFLH--DAEAVVRESVIVALDMAEY-EK
A7ESN0_SCLS1          SLGDEEGVE-------------------DTLKKFLE--DKDKVVRDSVIVALDMAEF-EK
DOHH_PHANO            SLGDEEGVE-------------------ETLKKFLN--DPEQVVRDSVIVALDMAEF-EK
C0NP82_AJECG          SLGDEEGVE-------------------ETLKKFLD--DPEQVVRDSVIVALDMAEF-EK
DOHH_ASPFU            SLGDYEGVE-------------------ETLRKFLN--DPEQVVRDSVIVALDMAEY-EK
DOHH_NEOFI            SLGDCEGVE-------------------ETLRKFLN--DPEQVVRDSVIVALDMAEY-EK
DOHH_ASPCL            SLGDCEGVE-------------------DTLKKFLN--DPEQVVRDSVIVALDMAEY-EK
DOHH_ASPNC            SLGDVEGVE-------------------DTLKKFLN--DPEQVVRDSIIVALDMAEF-EK
DOHH_ASPOR            SLGDVEGVE-------------------DTLKKFLN--DPEQVVRDSIIVALDMAEY-EK
DOHH_EMENI            SLGDVEGVE-------------------DTLKKFLN--DPEKVVRDSIIVALDMAEF-EK
DOHH_COCIM            SLGAEDGVE-------------------ETLKRFVN--DPETVVRDSIIVALDMAEY-EK
D5GHJ2_TUBMM          SIAD-ESVD-------------------ALLKEYAK--DVEEVVRDSAVVALDMAEF-ER
A8NRZ7_COPC7          GIATPEVLP--------------------HLREWMTREDSPQVVRESCQVAIDMWEH-EN
DOHH_LENED            GIATPEVLP--------------------PLKEWVARDDAPVVVRESCQVALDLWEY-EN
E3JYZ9_PUCGT          SIATPEVLT--------------------TLKAHASPEEQSRVVRESCEVALDMYNH-EH
F4P405_BATDJ          SIAYPECFQ--------------------VLQKFVN--DPEQVVRESCVIGLDMLEH-ES
I1CAV6_RHIO9          SIATPEVLE--------------------VLESYRQ--DQEQVVRESCVVALDMYEY-ET
DOHH2_ORYSJ           SIADQESIA--------------------LLEEFAK--DPEPIVSQSCEVALSMLEYERS
DOHH1_ORYSJ           SIADQESIA--------------------LLEEFAK--DPEPIVSQSCEVALSMLEYERS
C5XW00_SORBI          SIADQESIA--------------------LLEEFAK--DPEPIVSQSCEVALSMLEYERS
B9H8J8_POPTR          SIADEKSVA--------------------LLEEFSK--DPEPLVAQSCEVALSMLEFERS
B9GS37_POPTR          SIADEQSVA--------------------LLEEFSK--DHEPLVAQSCEVALSMLEFERS
D7U2X4_VITVI          SIADEHSVA--------------------LLEEFAK--DPEPIVSQSCEVALTMLEFERS
DOHH_ARATH            SIADEQSIA--------------------LLEEFSK--DPEPIVAQSCEVALSMLEFENS
A9SHU2_PHYPA          SIADERSVE--------------------LLKSFRS--DAEPIVAQSCEVALHMLELEQQ
A8IGJ8_CHLRE          AIADRVTLE--------------------LLRQYAA--DPEPIVAHSCVVALDVLEFEQS
F1A2N7_DICPU          AIASTETVP--------------------LLEKLLH--DKEPIVSESCAIALDVTEYFNN
D0NC43_PHYIT          AIGSTECEK--------------------ILKQYLK--DDVQVVRESCEVALDIMDYWAP
H3GH76_PHYRM          AIGTTECED--------------------ILKQYLK--DDVQVVRESCEVALDIMDYWAP
DOHH_ENCCU            AIGDDAALK--------------------ALSKYLH--DPCDILRESVEVAVDIHSY-MT
Q38FR2_TRYB2          AIADPKTLP--------------------ALEEYAK--HKEAIVRDSCVVALEMHKYWSQ
V5BF70_TRYCR          AIADPKALE--------------------TLANYAE--HKEQIVRDSCVVAIEMHNYWSR
Q4Q901_LEIMA          AIADPATLP--------------------VLESYAT--HHEPIVRDSCVVALEMHKYWAH
A4I2C0_LEIIN          AIADPATLP--------------------VLESYAT--HHEPIVRDSCVVALEMHKYWAN
A4HF36_LEIBR          AIADPATLP--------------------VLESYAT--HHEPIVRDSCVVALEMHKYWTN
B7XJJ9_ENTBH          AIGTSDCYD--------------------ILMKFKN--TNIQIIKESIEVGLSMLSNIN-
Q4UHP1_THEAN          SCASLYCQEQ-----TEGFEDWEKLIVE-VLEEFLQ--DEVKVVSDSCLVAMDYINESKH
Q4N7W5_THEPA          SCASLCGQEQ-----AKGSEDWEKLIVE-VLEEFMQ--DEVKVVSDSCLVAMDYINESKH
A7AS23_BABBO          SCAAASNNQS-----DR------NHIIA-ALEAHKL--DSMKVVADSCIVALDVISESAI
A0A0Z0AA05_PLABE      SLGSLNLN-------SKEYKDAQDVIIN-TLKNYSK--DGCRVVAESCLVGLDYIAENLN
Q7PDV0_PLAYO          SLGSLNLN-------SQEYKDAQDVIIN-TLKNYAK--DSCRVVAESCLVGLDYIAENLN
B3LBI7_PLAKH          SLGSLNIN-------SQEYKNVQSEIIS-TLKTFSK--DACRVVSESCLVGLDYIAENLN
DOHH_PLAVS            SLGSLNIN-------SQEYKNVQSEIIS-TLKTFSK--DACRVVAESCLVGLDYIAENLN
Q8I701_PLAF7          SLGSLNLN-------SDEYKIIQEQIID-TLKKYSK--DECVVVAESCLVGLDYISENLN
Q5CQK0_CRYPI          SVGSNDPRC---------------SENLEKMDKLCTKKELDRVRKLSIETLLKYSNDLDI
G4VSX8_SCHMA          SILGELEGKYLTNNVKGSIPKEFEHQAREVLEEFTK--DKEPVVRESCVLALDIANYIAS
A0C8W1_PARTE          TVSSNKEITL------------------EILNAYAK--SPDQIVRETAIVSLKMMEFYG-
                                                    :           :   :    :        

I3NAV7_ICTTR          GP-FQ--------QDPPP--------
G1LG94_AILME          GSAFQYADGLEQLRSPPS--------
DOHH_HUMAN            GRAFQYADGLEQLRGAPS--------
H0WUB8_OTOGA          QAAFQYADGLEQLRQAPS--------
DOHH_MOUSE            SQDFQYADGLERLRPPP---------
DOHH_RAT              GQDFQYADGLERLRPPP---------
DOHH_CHICK            GPQFQYADGLCRLQA-----------
H3A597_LATCH          GEEFQYADGLVRLETTV---------
DOHH_DANRE            SSQFQYADGLLRLQSAH---------
H3CCH9_TETNG          SQQFQYADALLRLPA-----------
F6UWS3_XENTR          SGDFQYANGLSQICGQI---------
F6UWT4_XENTR          SGDFQYANGLSQICGQI---------
DOHH_XENLA            SGDFQYANGLSQICEQI---------
B6IF58_CAEBR          SSDLQYASL-----------------
DOHH_CAEEL            SDDLQYAHV-----------------
E0VTF2_PEDHC          TKEFQYALT-----------------
Q7PUV4_ANOGA          SPEFQYADTLVKVNDGQ---------
W5JH70_ANODA          SPEFQYADGLVKLNDH----------
Q177G8_AEDAE          SPEFQYADTLGKVTH-----------
DOHH_DROME            SPEFQYADGLAKLDATK---------
DOHH_DROPS            SPEFQYADGLSKLDGTK---------
E9GHP7_DAPPU          SPEFQYANVLTNLDS-----------
B3RM40_TRIAD          NHDFQYANTLTNLKESTV--------
A9UV60_MONBE          SGDFQYANAIVANEDQDHE-------
DOHH_DEBHA            STEI----------------------
DOHH_CANAL            SNELEYATVK----------------
DOHH_ASHGO            SNELEYAPA-----------------
DOHH_KLULA            SNDLEYAPV-----------------
DOHH_CANGA            SNELEYAPA-----------------
DOHH_YEAST            SNELEYAPTAN---------------
DOHH_YARLI            SNEVEYAH------------------
DOHH_SCHPO            SGDMEYAYIPKVSA------------
C7Z7L0_NECH7          GGETEYALIPEVGGAAA---------
DOHH_GIBZE            GEDAEYALIPESAGAAA---------
DOHH_NEUCR            SGQAEYALIPEVASKAS---------
DOHH_CHAGB            SNETEYALIPEAQGTA----------
A7ESN0_SCLS1          NGETEYAFIPEKEAVAAA--------
DOHH_PHANO            NGEVEYAIVPQAQAIAA---------
C0NP82_AJECG          NGEKEYALIPEAVAA-----------
DOHH_ASPFU            NGEVEYALVPDAGVAAA---------
DOHH_NEOFI            NGEVEYALVPDAGVAAA---------
DOHH_ASPCL            NGEIEYALVPDSGVAAA---------
DOHH_ASPNC            NGEMEYALVPDSGAPAAVSA------
DOHH_ASPOR            NGEMEYALVPDSAAPAAVSAA-----
DOHH_EMENI            NGEIEYALIPDSGNPAAVPAA-----
DOHH_COCIM            SGEQEYILEQPVAA------------
D5GHJ2_TUBMM          SGGFEYALIPGAA-------------
A8NRZ7_COPC7          SGEFQYANGLETVANVSVAA------
DOHH_LENED            SGDFQYANGLESPSTPISV-------
E3JYZ9_PUCGT          SQEFQYTLPLKSV-------------
F4P405_BATDJ          SGEFQYANGLGQ--------------
I1CAV6_RHIO9          SGELQYANGLENQAQNMHSLKLAH--
DOHH2_ORYSJ           GKAFEFLFPQTPQVQQES--------
DOHH1_ORYSJ           GKSFEFLFLQTPGVQQES--------
C5XW00_SORBI          GKSFEFLFLQTPHVQS----------
B9H8J8_POPTR          GKSFEYLFMQDPLAQA----------
B9GS37_POPTR          GKSFEYLFMQDPLVQA----------
D7U2X4_VITVI          GKSFEYLFMQTPQVQ-----------
DOHH_ARATH            GKSFEFFFTQDPLVH-----------
A9SHU2_PHYPA          GKSFEVGCTNPECGGVDHSSSCVLVW
A8IGJ8_CHLRE          G-GFEYADKGANGEAPAKRPICPCRG
F1A2N7_DICPU          TEAFQYADGIKILLEKNHSSINTNN-
D0NC43_PHYIT          TK------------------------
H3GH76_PHYRM          SK------------------------
DOHH_ENCCU            GDEIEYCNAE----------------
Q38FR2_TRYB2          FNNQRIQH------------------
V5BF70_TRYCR          FRQHGEAAA-----------------
Q4Q901_LEIMA          FNSLAHQQQEA---------------
A4I2C0_LEIIN          FNSLAHQQQQEA--------------
A4HF36_LEIBR          FNTLAHHQQQQQEQEA----------
B7XJJ9_ENTBH          --------------------------
Q4UHP1_THEAN          ELTAH---------------------
Q4N7W5_THEPA          ELTAH---------------------
A7AS23_BABBO          EAAS----------------------
A0A0Z0AA05_PLABE      IAIEIN--------------------
Q7PDV0_PLAYO          ITIEIN--------------------
B3LBI7_PLAKH          MAIEIN--------------------
DOHH_PLAVS            MAIEVN--------------------
Q8I701_PLAF7          ISIEVH--------------------
Q5CQK0_CRYPI          IVAESCIVGLQTIMDETGSLDILLE-
G4VSX8_SCHMA          PEQFQYAAVPQN--------------
A0C8W1_PARTE          --------------------------