CLUSTAL format seed alignment for MF_03104

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MDM12_ASPFU       MSIDVNWRFATSGPDG--EALAERIRSFIHDRFQQVALPRFIRSVQVHAFDFGTIPPELE
MDM12_ASPFC       MSIDVNWRFATSGPDG--EALAERIRSFIHDRFQQVALPRFIRSVQVHAFDFGTIPPELE
MDM12_NEOFI       MSIDVNWRSATYGPDG--EALAERIRSFIHDRFQQVALPRFIRSVQVHAFDFGTIPPELE
MDM12_ASPCL       MSIDINWRTATSGPDG--EALAERIRSFIHDRFQQVALPRFIRSVQVHSFDFGTIPPELE
MDM12_ASPFN       MSIEVDWRAATSGPDG--EALAERIRSFIHDKFQQVALPRFIRSVQVHSFDFGTIPPDLE
MDM12_ASPOR       MSIEVDWRAATSGPDG--EALAERIRSFIHDKFQQVALPRFIRSVQVHSFDFGTIPPDLE
MDM12_ASPTN       MSIEVDWKTATSGPDG--EALAERIRSFIHDKFQQVALPRFIRSVQVHSFDFGTVPPDLE
MDM12_ASPNC       MSIEVDWGAATSGPDG--EALAERIRSFIHDKFQQVALPRFIRSVQVHSFDFGTIPPELE
MDM12_PENRW       MSIEVDWAAATSGPDG--EALAERIRSFVHDKFQEITLPRFIRSVQVHSFDFGTIAPDLE
MDM12_EMENI       MSIEVNWGTATSGPDG--EALAERIRSFIHDKFQQVPLPRFIRSVQVHSFDFGTVAPDLE
MDM12_TALMQ       MSIDLNWEAATSGPDG--EQLAERIRCFIHDKFQQVPLPRFIRSVNVHSFEFGSIAPELE
MDM12_TALSN       MSIDLNWEAATSGPDG--EQLAERIRSFIHDKFQQVPLPRFIRSVNVHSFEFGSIAPELE
MDM12_AJECG       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQIVLPRFIRSVQVTSFNFGTIPPELE
MDM12_AJECN       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQIVLPRFIRSVQVTSFNFGTIPPELE
MDM12_AJEDR       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQIVLPRFIRSVQVTSFNFGTIPPELE
MDM12_BLAGS       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQIVLPRFIRSVQVTSFNFGTIPPELE
MDM12_PARBP       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQMVLPRFIRSVQVTSFNFGTIPPELE
MDM12_PARBD       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQMVLPRFIRSVQVTSFNFGTIPPELE
MDM12_PARBA       MSIDIDWERATSGPDG--ELLAERIRSFIHDKFQQMVLPRFIRSVQVTSFNFGTIPPELE
MDM12_COCIM       MSIDINWEAATSGPDG--EALAERIRSFIHDKFQQIALPRFIRSVEVNSFDFGTIKPELQ
MDM12_UNCRE       MSIDINWEAATSGPDG--EALAERIRSFIHDKFQQIALPRFIRSVEVNSFDFGTVRPQLQ
MDM12_ARTOC       MSIDINWEAATSGPDG--EKLAERIRSFIHDKFQQIALPRFIRSVEVNSFDFGTVSPELQ
MDM12_BOTFB       MSIDLNWETLTTGPDG--IALAERIRDFVHAKFQTVTLPRFIKGVKVHTFEFGSIAPEVE
MDM12_SCLS1       MSIDLNWETLTTGPDG--IALAEKIRDFVHAKFQTVTLPRFIKGVKVHTFDFGSIAPEVE
MDM12_CHAGB       MSIDLNWETVTGGPDG--QELADQIRDFIHTKFQSVPLPRFIKSVTVHDFQFGVIPPELE
MDM12_MAGO7       MSIELNWETLTTGPDG--EELAHRIRDFIHSKFQTVPLPRFIKSVTVHDFQFGAIPPELE
MDM12_PHANO       MSIDINWDTLTGGADG--AARAETIRAFIHDKFQQVTLPKFIRSVHVHSFDFGSASPEIE
MDM12_PYRTR       MSIDINWDTITGGTEG--SARAEKIRAFIHDRFQQITLPRFIRSVHVHSFDFGSVPPEIE
D5G665_TUBMM      MSIEVNWETLTAGPDG--ARYAENIRSFVHEKFQSIPFPKFIKSVNVHSFSFGNVPPDVE
MDM12_SCHJY       MSIDIQWNLLD-------EQIAEKLRAKLDTKIAKLSLPRYIQDLHITSFDFGTSVPDVT
MDM12_SCHPO       MSIDFDWSKLD-------SELEAKVLHLLEGQVSNLSLPSYIKHLKVVDFHFGKVSPQIT
MDM12_COPC7       MSIDLEWAKLDSS-------LANYLVDVLNRQLSNAQRPSFIGPVEVTSLEFGSASPDVE
MDM12_LACBS       MSIDLEWCKLDSS-------LATYLVEVLNRQLGNAERPSFIGPVEVTSLDFGSASPDVE
MDM12_POSPM       MSIDLEWNGLDSS-------LASSLIDALNRQLSSTSRPSFIGPIEVTSFDFGSVSPDIE
MDM12_CRYNJ       MSLDINWSLLSQPDESATDQLSESLIALLNAQLAEAHRPSFIGPITVTAFDFGNAGPDLE
MDM12_MALGO       MSIELDWTGLEKS-------FADSLCERLNAALADMDMPTFLGPTRVQAIELGSEGPDVQ
E3KPX8_PUCGT      MSIEIDWLSLTPS-------IAEKLTERLNGLLANLSTPDFLGPLRIQSIDFGDIAPEVE
MDM12_YEAS6       MSFDINWSTLESD-----NRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAIT
MDM12_YEAS7       MSFDINWSTLESD-----NRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAIT
MDM12_YEAST       MSFDINWSTLESD-----NRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAIT
MDM12_YEAS1       MSFDINWSTLESD-----NRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAIT
MDM12_ZYGRC       MSFDIHWSNLESD-----TRLNESIKNHLNTYLESISLPSYVCNLRILDFSLGKTAPNIT
MDM12_CANGA       MSFEINWEKLSSD-----SDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNIT
MDM12_VANPO       MSFDINWEQLRND-----SNLNRTVTEKLNGYLTSINLPSYVNNLRIERFSMGDRPPKVT
MDM12_ASHGO       MSFDINWNKINED-----STINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRIT
MDM12_KLULA       MSVEIDWDNIRGD-----LSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVI
MDM12_LACTC       MSFEINWQDLGED-----EAVNDSIKSFLNSHLQSISLPSYVSSLQVTDFCLGGIPPNIT
MDM12_CANAL       MSFDINWNQLTID-----DTINQSIKEFLDQQFKNISLPSFISNLAVTDFNLGEIPPEVT
MDM12_CANAW       MSFDINWNQLTID-----DTINQSIKEFLDQQFKNISLPSFISNLAVTDFNLGEIPPEVT
MDM12_CANDC       MSFDINWNQLTID-----DTINQSIKEFLDQQFKKISLPSFISNLSVTDFNLGEIPPEIT
MDM12_CANTT       MSFDIKWENLTVD-----NTINESIQSFLDEQFKKLSLPSYISNLSVTDFQLGEIPPEIT
MDM12_LODEL       MSFDINWEKLTTD-----NQINDSIKNFLHEQFQSLQLPSYISNLEVVDFKLGTIPPEIT
MDM12_DEBHA       MSFDINWSELVSD-----ESLNESIKEFLDNQFQSISLPSFIDNLSVSDFSLGNSPPEIT
MDM12_PICST       MSFEINWENLTSD-----SSINESLKEFLDRQFQNISLPSYIANLSVTNFSVGDIPPEIT
MDM12_PICGU       MSFDINWSQLVED-----ESINNSIKEFLASQFSSVSLPSYIDNLTVSDFSLGDKAPEII
MDM12_CLAL4       MSFDINWDKLVSD-----DSISNSIKDFLNDQFNEISLPSFVDTLSVTGFSLGSIPPNIT
MDM12_KOMPG       MSLEVNWEQIASS-----EAIREQLVDWLNDQLKAVEVPKYLADIHVTSLSLGSKAPEIT
F4NT33_BATDJ      MSFIIDWNLLNDG------VEAERLKLLVNDHFQEVARPSFLGKVTVMQLDFGDIPPEVT
MDM12_YARLI       MSIDLDWDGMINSDE---IDVAEWLRSLLDKQFQQLDLPRNIRSVSITTLSLGTIPPELE
                  **. ..*                     :   .     *  :    :  : .*   * : 

MDM12_ASPFU       IKDFCEPFADFYEEDDDD-----HTSDAS--EERGEE-HSSRWNSTHPELNEPSYRED--
MDM12_ASPFC       IKDFCEPFADFYEEDDDD-----HTSDAS--EERGEE-HSSRWNSTHPELNEPSYRED--
MDM12_NEOFI       IKDFCEPFADFYEEDDDD-----HTSDAS--EELGSE-HSSQWNRTHPELNEPSYRED--
MDM12_ASPCL       IKDFCEPFADFYEEDDDA-----DTSDVS--EDLLSE-HSSQWDRTHSELNEPPYREE--
MDM12_ASPFN       VKDICEPFADFYEEDEDD-----ETSDVS--EELVSG-HGTQWHR---DLNEPPFHEE--
MDM12_ASPOR       VKDICEPFADFYEEDEDD-----ETSDVS--EELVSG-HGTQWHR---DLNEPPFHEE--
MDM12_ASPTN       IKDFCEPFADFYEEDEDD-----ETSEVS--EELVSA-HGNQWHRTHSELNEPPYRDE--
MDM12_ASPNC       IKDLCEPFADFYEEDEDD-----EASDVS--EGLVSR-HGSPWHGTHPELNESSFRDD--
MDM12_PENRW       VKDICEPFADFYEEEADDA----DTSVAS--EELGHE-LHESPYEDDMTYNPTAHNLH--
MDM12_EMENI       IKDFCEPFADFYEDDEDGD----SGSEIS--EELQHRTHDNPWDRTQSELNETSFRDDR-
MDM12_TALMQ       IKDICDPFVDFYEESDS-E----DEDEGH--EDIQSDASSDRAA---ADKRGMRYRHDNN
MDM12_TALSN       IKDICDPFVDFYEESDSSE----DEDGEG--HDAESDTSSDRAADSTADKRDMRYGHDDR
MDM12_AJECG       IRDLSDPFPDFYEDDD------ENFSDSS--EEGSPTREPVDRYGNRV--DSWQANSPG-
MDM12_AJECN       IRDLSDPFPDFFEDDD------ENFSDSS--EERSPTREPVDRYGNRV--DSWQANSPG-
MDM12_AJEDR       IRDLCDPFPDFYEEDDN-----ENFSESS--EEQSPTREPVDRYGSKV--ESWQANSPG-
MDM12_BLAGS       IRDLCDPFPDFYEEDDN-----ENFSESS--EEQSPTREPVDRYGSKV--ESWQANSPG-
MDM12_PARBP       IRDLTDPFPDFYEDGD------EDLSVSS--EEQSPMREQADRYRERI--DSWQTNSPG-
MDM12_PARBD       IRDLTDPFPDFYEDGD------EDLSVSS--EEQSPMREQADRYRERI--DSWQANSPG-
MDM12_PARBA       IRDLTDPFPDFYEDGD------EDLSVSS--EEQSPMREQADRYRERI--DSWQTNSPG-
MDM12_COCIM       IKDLCDPFEDFYEEDEDNEIGDGEVSDI---QDRSPKPRPSSAGNERSAADAWQAEHPA-
MDM12_UNCRE       IKDLCDPFEDFYEEDE----GDEDFSDD---QDGAPKHPPTIA-TERSGAGTWQAEHPS-
MDM12_ARTOC       VRDICDPFNDFYEEDE----DGEDLSESSVSDEPAPSSQGLSQSTPNGDAGSSNSSSNG-
MDM12_BOTFB       LKDICDPLPDFYEDIDDDYVEDDEDEENSENSQTDEENEVAKTLRERRR-----------
MDM12_SCLS1       LKDICDPLPDFYEDLDDDDGGSDEDDEGSNSCQTDEENEAAKTLRERRK-----------
MDM12_CHAGB       LKDITDPLPDFYEDHVDSDVASDDSEGEEDAVDNNLAPPSQGERHQRTDDSEALGGDV--
MDM12_MAGO7       LKDITDPLPDFYEEDPDVDYD-DEDEDVEETHDYEERRSEAAASPARSGDDGLFGGQRGD
MDM12_PHANO       IKDICDPLPDFYEEDEDYPDNEDDDDDEAGLDSNPRNKCITRKGTNFKS-----------
MDM12_PYRTR       IKDICDPLPDFYEDDEDYPDEEGDEAENEAEDATPGAGDKLRDSSNPSNRPSRDSQSRER
D5G665_TUBMM      IKELCDPYPEFYEDDDDE----CSDSDSADIDNGNVGGEDEQDYLLKLERERRRRERRD-
MDM12_SCHJY       IQDICDPDPRLYEETLYSD-----------------------------------------
MDM12_SCHPO       IQEIGDPDPQFYENEAFEL-----------------------------------------
MDM12_COPC7       LVDLRDIYRDFLEDDEDDS----STSPVKVTEGQLDAH---------GGEDDD---G---
MDM12_LACBS       LVDLRDIYRDFLEDDEEGS----DRGPVKVTEG---------------AEDEE---G---
MDM12_POSPM       LVDLRDIYRDFLEDDEDAE----DVEKEAVKESQ-------------WTDEED---D---
MDM12_CRYNJ       VKDIRDVWRVFDQGDDEGD----FAEEEKQREKEREERDKLRNEALKSSLDGE---R---
MDM12_MALGO       VIHIGHVWREFREAAVHAS----SASDKYNARATTPPRMPMRLRTFRQYDDNDLPTSVH-
E3KPX8_PUCGT      IVDIRDVSRGFRIADGESH----PSS----------------------------------
MDM12_YEAS6       LKEITDPLDEFYDSIREEADQE--------------------------------------
MDM12_YEAS7       LKEITDPLDEFYDSIREEADQE--------------------------------------
MDM12_YEAST       LKEITDPLDEFYDSIREEADQE--------------------------------------
MDM12_YEAS1       LKEITDPLDEFYDSIREEADQE--------------------------------------
MDM12_ZYGRC       LREISDPLDELYRGLNED------------------------------------------
MDM12_CANGA       LREISSPLQDFYDAVNEEYEED--------------------------------------
MDM12_VANPO       LRQITDPVQDFYDAINEELQMS--------------------------------------
MDM12_ASHGO       LKQIDNPLDDFYEALRLEG-----------------------------------------
MDM12_KLULA       LKQMDDPLDEFYSYLLQEGDIS--------------------------------------
MDM12_LACTC       LREISDPLDEFYNHIEKEELPK--------------------------------------
MDM12_CANAL       IRHIGDPFEEFYEDENNLGV---------MNEANNDSKDE---HLKNHGDGINKDSGYNS
MDM12_CANAW       IRHIGDPFEEFYEDENILGA---------MNEANNDSKDE---HLKNHGDGINKDSGYNS
MDM12_CANDC       IRHIGDPFEEFYEDEDNLGA---------TNETNHNLNDERSTMGKSQENGIHKDNAYNS
MDM12_CANTT       IRHIGDPFDEFYEDTTDSPE---------TEQP----KEE--------------------
MDM12_LODEL       IRHIGDPFEEFYANPDDGDGDGNNDEEVLKDKSTKLKNRQAVNIIPNKAGATHEADIIND
MDM12_DEBHA       IRHIGDPFDDFYEDEGDDDEK---------ERKNVYMQQG--------------------
MDM12_PICST       IRHIGDPFDEFYEDENDEGSSG-------PERVSSNSNMN--------------------
MDM12_PICGU       IRDIGDTFEDFYEDEDGPRNAG-------APTTTATSGMG--------------------
MDM12_CLAL4       IRHIGNPFDEFYKRNVPEEE---------AKKGQLPVSPE--------------------
MDM12_KOMPG       IRDIGKPFDDFYDIEEERAGTG--------------------------------------
F4NT33_BATDJ      IEDICDPLADFYIQEDPAFEY---------------------------------------
MDM12_YARLI       IKHISDPFPEFYAEEEAAADSHYLPPLHPPQQRRS-------------------------
                  : .:      :                                                 

MDM12_ASPFU       -------TAVNHSLRDPFPDGFPT---------------SPLRSPLG--EHLNPHFLPRA
MDM12_ASPFC       -------TAVNHSLRDPFPDGFPT---------------SPLRSPLG--EHLNPHFLPRA
MDM12_NEOFI       -------TAVNHSLRDPFPDGFPT---------------SPLRSPLG--EHLNPHFLPRA
MDM12_ASPCL       -------SAMNHGLRDPFHEGFPP---------------SPLRSPLG--EHLNPHFLPRA
MDM12_ASPFN       -------MAMNRPLRDPFDEAFHS---------------STLRSPM---EHLNPHFLPRA
MDM12_ASPOR       -------MAMNRPLRDPFDEAFHS---------------STLRSPM---EHLNPHFLPRA
MDM12_ASPTN       -------VTMNQPLRDPFDEGFHP---------------SPLRSPM---EHLNPHFLPRA
MDM12_ASPNC       -------NAINHSLRDPFTEGFQP---------------SALRSPIALSDHLNPHF--RS
MDM12_PENRW       -------SFSHHPYPG---EGFQP---------------SALRSPLG--DHLNPHFMPRA
MDM12_EMENI       ------PVTSHHALRDPFDEDFRQHT------------SSPLRSPIALGDHLNPHFLPRA
MDM12_TALMQ       GHDEHGTNHHDHLRTSQWVTGEIDGHHQ--------SAQSPLRSPIGLGDHLNAQF--RS
MDM12_TALSN       GNNGHIPNHHDHLRTSQWVAGGTDGH----------STQSPLRSPIGLGDHLNAHF--RS
MDM12_AJECG       ----GPGGQMYES---NQPLRMPAWEEH--------TGISPLRGPMNFGD-INPYLFPRS
MDM12_AJECN       ----GPGGQMYGRVGFNQPLRMPEWEEH--------TGISPLRGPMNFGD-INPYLFPRS
MDM12_AJEDR       ----SLEDHMQGRMGFNGPLRMPPGEEN--------TGISPLRSPMNFGD-INPYLFPRS
MDM12_BLAGS       ----SLEDHMQGRMGFNGPLRMPPGEEN--------TGISPLRSPMNFGD-INPYLFPRS
MDM12_PARBP       ----GLEVQMSGRMGFGHPLQLAPDEDG--------SRLHPLRSPINLGD-INPYLFPRS
MDM12_PARBD       ----GLEVQMSGRMGFGHPLQLAPDEDG--------SRLHPLRSPINLGD-INPYLFPRS
MDM12_PARBA       ----SLEGQMSGRMGFGHPLQLAPDEDG--------SRLHPLRSPINLGD-INPYLFPRS
MDM12_COCIM       ----FLDDRLCGRIEPHDVPIPSKEDP---------LASRPIRSPMSFGDPLNPYFFPRA
MDM12_UNCRE       ----FVAGRLPGGIESRDIPAPSKEDL---------LASRPMRSPMSFGESLNPYFFPRA
MDM12_ARTOC       ----DGGGNTNSRVGYFQRRYPSGEYAG--------DFPQPLMSPINLGESFNPYLFPRA
MDM12_BOTFB       -LDRVERTANGSSHVSTPPAYIDTRYPG-------------LRSMQASGDTGSP-FL-GV
MDM12_SCLS1       -MDRVERTANGSSNVSNPPSYTDTRYPG-------------LRSMQASGDNGSP-FL-GV
MDM12_CHAGB       ------RNLGHLPPHLMFGSPGGPGGPG--------------MGSLRNGDMGSP-FM-RV
MDM12_MAGO7       GMNKLDRVASSSSSSVGRGSAPRPGAPPQTPTKSNININTRMRGEVPPQDLTSP-FL-GV
MDM12_PHANO       -------VAISLVARQFETSHQ------------------------------------SA
MDM12_PYRTR       GRGAEGPVGRSIDHNQLRPSQPPARPST-------------KRSSLAPNELGSPFFP-GA
D5G665_TUBMM      -----DGYTIGGARSPPPGLNPPPYTPDG-------RTGIPFRSPFT--PGIPDTFPGRV
MDM12_SCHJY       ------------------------------------------------------------
MDM12_SCHPO       ------------------------------------------------------------
MDM12_COPC7       -----------YEWVPRRAAAREYYTEGG---------GHGGNGSHLPMHLRHPPLRSSP
MDM12_LACBS       -----------FEWV-----------------------GEYDRGASIP------------
MDM12_POSPM       -----------FEWIS----------------------RKAVRGKGLPQDV---------
MDM12_CRYNJ       -----------YELVDRYSST-----------------EGTSSFEYQPEYDIHEQHGDDY
MDM12_MALGO       ------------------------------------------------------------
E3KPX8_PUCGT      ------------------------------------------------------------
MDM12_YEAS6       ---------TEENNDNKEDSEH--------------------------------------
MDM12_YEAS7       ---------TEENNDNKEDSEH--------------------------------------
MDM12_YEAST       ---------TEENNDNKEDSEH--------------------------------------
MDM12_YEAS1       ---------TEENNDNKEDSEH--------------------------------------
MDM12_ZYGRC       ------------------------------------------------------------
MDM12_CANGA       ---------NETSSEMHG------------------------------------------
MDM12_VANPO       ---------AEEETEGSDDEG---------------------------------------
MDM12_ASHGO       ------------------------------------------------------------
MDM12_KLULA       ---------K--------------------------------------------------
MDM12_LACTC       ---------DKIPEESDS------------------------------------------
MDM12_CANAL       QNLDDED--EDDEDDDEDDED-------------EEEEDEDDYDDHDLGTINEGISLLNF
MDM12_CANAW       QNLDDED--EDDEDDDEDDED-------------EEEEDEDDYDDHDLGTINEGISLLNF
MDM12_CANDC       QNFDDDD--DDDEGVDEDD-------------------DDDEYDDHDLGTINEGISLLNF
MDM12_CANTT       --YTGDD--DDDDDDDEDD--------------------ESDDDGPGLSTISEGIHLLNF
MDM12_LODEL       HDYGDEDDIDDDYDNDSDDYDDDENDGLHDHGEDEENEESSQYDEDRLSNITEGLSLVEL
MDM12_DEBHA       ---VSED--TNSSDDDEDD-------------------EYDGDRSNDLSIITEDPNIHTF
MDM12_PICST       ---TKET--NYMSSDDEDD-------------------DEDNDLSTILSTIAEDSHLNSF
MDM12_PICGU       ---ESD------SSDDEDT-------------------RDGLTGEVTLSETTE-------
MDM12_CLAL4       -----------LSGSDSDS-------------------SEEEPAINNLDSTNQQ------
MDM12_KOMPG       EGDEDDGRVAPTSTPMKHQTS---------------------------------------
F4NT33_BATDJ      --------EHDHIQSHSYNSRQ--------------------------------------
MDM12_YARLI       --------APSTPHIHTNTTN---------------------------------------
                                                                              

MDM12_ASPFU       STPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-NPFASGWSDSGM---
MDM12_ASPFC       STPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-NPFASGWSDSGM---
MDM12_NEOFI       GTPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-NPFASGWSDSGM---
MDM12_ASPCL       GTPGI-------PGGTSNLGYHLMSLGG--LSGTQTPLAAVAGG-NPFASGWSDSGM---
MDM12_ASPFN       GTPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-TPFANGWTDPGM---
MDM12_ASPOR       GTPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-TPFANGWTDPGM---
MDM12_ASPTN       GTPGI-------PGGTSTIGYHLMSLGG--LSGTQTPLAAVAGG-TPFANGWTDHNL---
MDM12_ASPNC       GTPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-SPFAGGWNDSGMM--
MDM12_PENRW       STPGI-------PGGTSTLGYHMRSLGG--LSGTQTPLAAVAGG-TSFASGWSDSGM---
MDM12_EMENI       GTPGI-------PGGTSTLGYHLMSLGG--LSGTQTPLAAVAGG-SPFTTNWTDPSPM--
MDM12_TALMQ       TTPNIL------PGVTSNLGYHLM-MGN--LSGTQTPLVAVAGGGTPFGTGWPDAVM---
MDM12_TALSN       TTPNIL------PGVTSNLGYHLM-MGN--LSGTQTPLAAVAGG-TPFGPGWPDAVM---
MDM12_AJECG       GTPGI-------PGGTSNLGYY-MPLSG--LSSSQTPLGAVARG-NPFSGGWPDA-----
MDM12_AJECN       GTPGI-------PGGTSNLGYY-MPLSG--LSNSQTPLGAVARG-NPFSGGWPDA-----
MDM12_AJEDR       RTPGI-------PGGTSNLGYY-MPLSG--LSGSQTPLGTVARG-SPFSGGWPDV-----
MDM12_BLAGS       RTPGI-------PGGTSNLGYY-MPLSG--LSGSQTPLGTVARG-SPFSGGWPDV-----
MDM12_PARBP       GTPGI-------PGGTSNLGYF-MPLSG--LSGSQTPLRAVTRG-NPFSGGWPDSPLE--
MDM12_PARBD       GTPGI-------PGGTSNLGYF-MPLSG--LSGSQTPLRAVTRG-NPFSGGWPDSPLE--
MDM12_PARBA       GTPGI-------PGGTSNLGYF-MPLSG--LSGSQVPLRAVTRG-NPFSGGWPDSPLE--
MDM12_COCIM       GTPGI-------PGGTSNLGYYYMPLGG--ISGTQTPLSSVPRG--PFSPGLRDASVF--
MDM12_UNCRE       GTPGI-------PGGTSNLGYY-MPLGG--MSGTQTPLASVPRG--PFSPGLRDSSVY--
MDM12_ARTOC       GTPGI-------PGGTSNLGYYNMPRGG--LSGTQTPLASVA------SVARGGPLSL--
MDM12_BOTFB       STPGI-------PGGTSNLSYFHSQLAS-GLSGTQTPLAAVAGAHL--PQGWP-------
MDM12_SCLS1       STPGI-------PGGTSNLSYFHSQLAS-GFSGTQTPLAAVAGAHL--PQGWP-------
MDM12_CHAGB       STPGI-------PGGTSNLHYFHSHLGG-GLSGTQTPLAAVAGAQHLSTANW--LEGHGH
MDM12_MAGO7       STPGIL------SGGTSNFSYFHSHLASSGLSGTQTPLAAVAGAQLGGPPQWNGLRSTGR
MDM12_PHANO       LTPGI-------PGGTSNINYFHLPLSA-GLSGATTPLAAVAGAQL---QGWL-------
MDM12_PYRTR       LTPGI-------PGGTSNMNYFHLPLSA-GLSGAATPLAAVAGAQL---HSWL-------
D5G665_TUBMM      GVAGVTTPLFHRGGSSSNLHYFHSALSS-GFTGTNTPTLPAFQSPTSPGPTENQP-----
MDM12_SCHJY       --------------DSSSLDDEESDRE----EENMTELPPYGAT----------------
MDM12_SCHPO       --------------ANQELEGDQCSRNN--VSPVLTDLPPYAA-----------------
MDM12_COPC7       TDTFSS-------LGHSMGMTMPVGLDMWTGHGALFHHQGSGGSPALAHGGPILRSPS--
MDM12_LACBS       ------------------------------------------------------------
MDM12_POSPM       ------------------------------------------------------------
MDM12_CRYNJ       RIRGRR-------PLSYTFGYPHDRLAVHRSSSSRSFIPFPFDHPPPALHIPSTPGLN--
MDM12_MALGO       ------------------------------------------------------------
E3KPX8_PUCGT      ------------------------------------------------------------
MDM12_YEAS6       ------------------------------------------------------------
MDM12_YEAS7       ------------------------------------------------------------
MDM12_YEAST       ------------------------------------------------------------
MDM12_YEAS1       ------------------------------------------------------------
MDM12_ZYGRC       ------------------------------------------------------------
MDM12_CANGA       ------------------------------------------------------------
MDM12_VANPO       ------------------------------------------------------------
MDM12_ASHGO       ------------------------------------------------------------
MDM12_KLULA       ------------------------------------------------------------
MDM12_LACTC       ------------------------------------------------------------
MDM12_CANAL       N--------ENSTTPSANS-----FAGSAAPPLPPPLNPSRDSFHSILHPYGVNSIIGAT
MDM12_CANAW       N--------ENSTTPSANS-----FAGSAAPPLPPPLNPSRDSFHSILHPYGVNSIIGAT
MDM12_CANDC       N--------DSSTTPSGNS-----FGGSIAPLPPPPLNPSRDSFHSILHPYGVNSIIGAT
MDM12_CANTT       N--------RTGSPLP-----------DATPLSPRPMNRSRDSFQSILHPFGVN--IGPT
MDM12_LODEL       L--------ASASTPKRTSPQRPPLISPRGEVTQQTLSKPKEPFQSILNPYGVTSVLNQG
MDM12_DEBHA       TSEAD--RSRLASPP---RPPLTDLRRSRASSDPFSLIMGNNNLNYMHNYNMNYVGLGNL
MDM12_PICST       SHSSTLYHSHEQSPPPGPAPTPPLLLRSRTSLDPISYIMANTSLNYLHNYNINNIGLGH-
MDM12_PICGU       --------SKTQFAPQPLHPIPTKLRRSHTTS-AATPLSSHAHLNSLYAYNLTNVGLGTL
MDM12_CLAL4       -------------------------DFTPLLPEVDSLRRQNQESKHFNNFNMNNVGLGHM
MDM12_KOMPG       ------------------------------------------------------------
F4NT33_BATDJ      ------------------------------------------------------------
MDM12_YARLI       ------------PIDRGIASYFHPLGSAPLMSGLRTPLNIPSWA----------------
                                                                              

MDM12_ASPFU       -----------------GPGNRGRSE--THAGMQHPRAEPEIDTSNSTSRPSTANTLPSH
MDM12_ASPFC       -----------------GPGNRGRSE--THAGMQHPRAEPEIDTSNSTSRPSTANTLPSH
MDM12_NEOFI       -----------------GPGNRGRSE--RHAGMKHQRAEPEIDTSNSTSRPSTANTLPSH
MDM12_ASPCL       -----------------GFGNRGRSE--RQGPIPQHRPEPEIDTSNSTSRPSTANTLPSH
MDM12_ASPFN       -----------------GASSRGHPSISGPTAVHPSRMEADIDTSNPTSRPSTSSTLPSH
MDM12_ASPOR       -----------------GASSRGHPSISGPTAVHPSRMEADIDTSNPTSRPSTSSTLPSH
MDM12_ASPTN       -----------------GPGNRGHASGPAAGAMRQHRPE-DIDSSNPTSRPSTSSTLPSH
MDM12_ASPNC       -----------------GPGNRGRPP-PPIFTAHQSRPEADIDSSNPTSRPSTSSTLPSH
MDM12_PENRW       -----------------GVGPRSQAA---RPAGPHHLAEPDLDTTNSTSRPSTANTLPSH
MDM12_EMENI       -----------------GQGNKTGIR-----PSPLHRADADIDSSNPASRPSTASTHPSG
MDM12_TALMQ       -----------------HGGSQLAGQPHGRGRGREENNNNNLDTGSPS-RPSTANTNPTQ
MDM12_TALSN       -----------------NQGSRMTDHTTGRTR-REDHNKN--ETGSPS-RPSTAHTNPTQ
MDM12_AJECG       ------------------------------HGARPSRRRSEAEPDSAQSRPSTANTGNTL
MDM12_AJECN       ------------------------------HGARPSRRRSEAEPDSAQSRPSTANTGNTL
MDM12_AJEDR       ------------------------------HGARPSRRRSEVEPDSAQSRPSTANTGNTL
MDM12_BLAGS       ------------------------------HGARPSRRRSEVEPDSAQSRPSTANTGNTL
MDM12_PARBP       -----------------NE---SRMG----HGQGPPRRRSEVNVDAIQSRPSTVNTGNTL
MDM12_PARBD       -----------------NE---SRIG----HGQGPPRRRSEVNVDAIQSRPSTANTGNTL
MDM12_PARBA       -----------------NE---KRIG----HGQGPPRRRSEVDVDAIQSRPSTANTGNTL
MDM12_COCIM       -----------------GEPSNSQRP----NPSGPARRQSEIDIDTGNSRPSTADTLDSL
MDM12_UNCRE       -----------------GDIHNPPAR----DYPRPVHRQTDTDIDSGHSRPSTADTLNSI
MDM12_ARTOC       -----------------AEGWPPPAR----QRERARSSDADVDSPQSRSRPSTSSTRQRT
MDM12_BOTFB       -------------------DRPSPSLHLSALRNQSHTPLSHTASE-RSMTPPQIAD-LNQ
MDM12_SCLS1       -------------------DRPSPSLHMSALRNQSHTSLSHTASE-RPMTPPQIAD-LSQ
MDM12_CHAGB       SSSVPNLTHFGNPG--GAGTSPRRQPERNHSRNPSQGSISVADLNPNSLAPPSSST-LGV
MDM12_MAGO7       GSGRRRSLAAASQGLDGEGFTPSHSRTSSTVSNADLQTASLGGFG-GHLTPTSFLR-SGQ
MDM12_PHANO       -------------------DNPYGRPSTPTNMRRLRHAASFNSLT---LTPQSHPDPSSR
MDM12_PYRTR       -------------------DNPH-RPSTPTNMR-LRHAASVNSLT---LTPQSHPDPTSR
D5G665_TUBMM      -------------------------------RSSSTSSLPSRPSTSDSGGPISSLNITDP
MDM12_SCHJY       --------------------------ENGVHKKDSTDVNMNHTQTSNQQSPQNIAESNIH
MDM12_SCHPO       ------------------------------EHPFSRLAYFNPAFNSPGILSASGLTSPIP
MDM12_COPC7       ------------------------------PSTPFPVVHTPPLGRTPTAAYRSSSALDPD
MDM12_LACBS       -------------------------------------------------ATNVTSSLDTR
MDM12_POSPM       ------------------------------PAYHLLPPHMRYGRGVPMDMFASTPSLRPT
MDM12_CRYNJ       ------------------------------PSLVSHPISARFSRRPMSIAASAAPRPTPR
MDM12_MALGO       ----------------------------------------------GGADADSIASEHEE
E3KPX8_PUCGT      ------------------------------------------------------------
MDM12_YEAS6       ------------------------------------------ICPDRTIANHEGPKDDFE
MDM12_YEAS7       ------------------------------------------ICPDRTIANHEGPKDDFE
MDM12_YEAST       ------------------------------------------ICPDRTIANHEGPKDDFE
MDM12_YEAS1       ------------------------------------------VCPDRTIANHEGPKDDFE
MDM12_ZYGRC       -----------------------------------------------------------E
MDM12_CANGA       -------------------------------------------------RDGQNVGESGE
MDM12_VANPO       ------------------------------------------------YGGDRVRNRGID
MDM12_ASHGO       ---------------------------------------------------ASIGGRD--
MDM12_KLULA       ---------------------------------------------------EAAKDKN--
MDM12_LACTC       -------------------------------------------------GCQSADGENGD
MDM12_CANAL       G--------------------------------------------AGSETPTNILNQNYL
MDM12_CANAW       G--------------------------------------------AGSETPTNILNQNYL
MDM12_CANDC       G--------------------------------------------AGSETPTNILNQNYL
MDM12_CANTT       ----------------------------------------------GSETPTNLLNQSYF
MDM12_LODEL       SNAAKNTTATSIAA--------------------------GTTAANGVGTLKDIFDQNNF
MDM12_DEBHA       N---------------------------------------ATGTHTGTDTPTNILNQNPY
MDM12_PICST       -------------------------------------------APSGTETPTTILNQNAL
MDM12_PICGU       NL--------------------------------------NSATPSGRDTPTQILNQMRT
MDM12_CLAL4       D----------------------------------------------LDTPTNFFNPHAY
MDM12_KOMPG       ----------------------------------------------GSSDQTDASNPISP
F4NT33_BATDJ      ----------------------------------------NIDTTAASEQISVSDGIGHH
MDM12_YARLI       -----------------------------------TNGHTRTSSRLPLNTPIEAEIVESV
                                                                              

MDM12_ASPFU       PS--GSSKNSGQAATGRNDHPSLHAGEHLEDSVT------------------------QG
MDM12_ASPFC       PS--GSSKNSGQAATGRNDHPSLHAGEHLEDSVT------------------------QG
MDM12_NEOFI       PS--SSSKNSGQGATGRNDHPSLHAGEHIEDPVA------------------------PG
MDM12_ASPCL       LS--ESNNLNADGATGRNERGSLHNGDPLADHTC------------------------SG
MDM12_ASPFN       PS--ASNQPSGDATTGKEHGSLAEDE-HLDDPMTS-----------------------GH
MDM12_ASPOR       PS--ASNQPSGDATTGKEHGSLAEDE-HLDDPMTS-----------------------GH
MDM12_ASPTN       PS--GSNRNSGD-------GSHPEEE-HLDDPAEP-----------------------DH
MDM12_ASPNC       PS--GSNKNNGDGAGGPDHGSHPEEHGHLDDPTS------------------------EE
MDM12_PENRW       PSLGHSGSSGSNPHTSDPTDAPQPSIETSDDPAAE-----------------------GH
MDM12_EMENI       SN----RSSHPDGHPEHNDDPISSSENPLLQNQP--------------------------
MDM12_TALMQ       LSHGQSAAGSSSNNTSNDPTVIYNDHASSTTATAHGLHEG-----REKQAPTSIIDQE-S
MDM12_TALSN       LSHGRSAA-SSSNNTSNDPTVIYNDHTSSTTATTYGLHEGGD---RPRDKHGHRIDQEEP
MDM12_AJECG       PSRDSMSISDPHHSHASQGMP-NNQGQALEPNIPP------------------TSPNHPL
MDM12_AJECN       PSRDSMSVSDPHHCHASQGMS-NNQGQVLEPNIPP------------------TSPNHPL
MDM12_AJEDR       LSRGSMSSGDPRHSHHSQGVPGSDHGQVLEPNMPP------------------TSSDPPL
MDM12_BLAGS       LSRGSMSSGDPRHSHHSQGVPGSDHGQVLEPNMPP------------------TSSDAPL
MDM12_PARBP       FSRGSVSTGDPRHSHSSQTVLANNPGQAPEANDSP------------------VSAVPPL
MDM12_PARBD       FSRGSVSTGDPRHSHSSQTVLANNPGQAPEANDSP------------------VSAVPPL
MDM12_PARBA       LSRGSVSTGDPRHSHPSQTLLANNPGQVPDANDSP------------------VSAVPPL
MDM12_COCIM       NIHG-IPDPVL--PRSSDDAHPNVLP-------------------------------RRD
MDM12_UNCRE       NSQR-ISNPALSHPHSSNESHPDT----------------------------------RD
MDM12_ARTOC       STDGGTPHDSAEIPESESVITGHL-----------------------------------D
MDM12_BOTFB       QSLREKASVSTLAASS-STTRPATRDGVPEATIPEEHAG-----------------ESEE
MDM12_SCLS1       QSIREKASASTLAVSS-STTGPVTRGGATEKTIPEEQTS-----------------EGEE
MDM12_CHAGB       PSLKEKHSTTPAPGSATALSG----------SNEQQQQQ-----------------QPQD
MDM12_MAGO7       QTLREKHSVSTLAPTSVGTSRPPTRDLTTTMSTAQEDGQGGDGNCESSSAAAAGNEQNES
MDM12_PHANO       PSSRHQHDDERRRSLAESDDA----------SSQHGY--------------------DRT
MDM12_PYRTR       PSSRHQHDEGKRQSFAGSDDG----------ASPHGY--------------------TRT
D5G665_TUBMM      PSVGSSAQEPLHTPTSEDSRAR------------------------------------GS
MDM12_SCHJY       KS--------------------------------------------------------VP
MDM12_SCHPO       ES--------------------------------------------------------RP
MDM12_COPC7       SS-----FLNQPVFPS-------------------------------------------Q
MDM12_LACBS       SD-----QPDDQKAPL-------------------------------------------L
MDM12_POSPM       RDIVSVTFPLRVRNGS-------------------------------------------R
MDM12_CRYNJ       RRPIE-PSSTSPSPPA-------------------------------------------H
MDM12_MALGO       SLSRWSDTESETGTCD-------------------------------------------S
E3KPX8_PUCGT      -----------SPECS-------------------------------------------S
MDM12_YEAS6       APVVMP------------------------------------------------------
MDM12_YEAS7       APVVMP------------------------------------------------------
MDM12_YEAST       APVVMP------------------------------------------------------
MDM12_YEAS1       APVVMP------------------------------------------------------
MDM12_ZYGRC       PDSITP------------------------------------------------------
MDM12_CANGA       EAVVEK------------------------------------------------------
MDM12_VANPO       TQTVFP------------------------------------------------------
MDM12_ASHGO       ------------------------------------------------------------
MDM12_KLULA       ------------------------------------------------------------
MDM12_LACTC       LLPEVQ------------------------------------------------------
MDM12_CANAL       SSRVLP-----------------------KISVK--------------------------
MDM12_CANAW       SSRVLP-----------------------KISVK--------------------------
MDM12_CANDC       SSRVLP-----------------------KISVK--------------------------
MDM12_CANTT       SSR--------------------------RVSIK--------------------------
MDM12_LODEL       SSRVIP-----------------------KIKTKEESVSGDQQQ-------GKQTGKANE
MDM12_DEBHA       ATLKSNPSSYYKNKDPSKFSGSDTHKNGFRLTSK--------------------------
MDM12_PICST       TNAKNS-----------------------RVISS--------------------------
MDM12_PICGU       GPNSPP--------------------ISNTPISS--------------------------
MDM12_CLAL4       RLHSNS-------------------VGR--------------------------------
MDM12_KOMPG       STSHDH------------------------------------------------------
F4NT33_BATDJ      GSAIYKEPS------------------------------------------------LSF
MDM12_YARLI       RESTAPRTP---------------------------------------------------
                                                                              

MDM12_ASPFU       QLPLPPRMRER------------RPEDFQVLCHVKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_ASPFC       QLPLPPRMRER------------RPEDFQVLCHVKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_NEOFI       HLPLPPRMRER------------RPEDFQVLCHVKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_ASPCL       HLPLPPRMRER------------RPEDFQVLCHAKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_ASPFN       PLRLPPRMRER------------RPEDFQVLCHAKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_ASPOR       PLRLPPRMRER------------RPEDFQVLCHAKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_ASPTN       PFRFP-KMRER------------RPEDFQVMCRAKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_ASPNC       PLRFP-RMRER------------RPEDFQVLCHAKY-AGDVRLSLTAEILLDYPMPSFVG
MDM12_PENRW       SLPIPPRMRER------------RPEDFQVLCHAKY-AGDVRMSLTAEILLDYPMPSFVG
MDM12_EMENI       ----PPRMRER------------RPEDFQILCHVKY-AGDIRLSLTAEILLDYPMPSFVG
MDM12_TALMQ       PPSPTPHMRER------------RPEDFQVICRVKY-AGDVKLSLTAEILLDYPMPSFVG
MDM12_TALSN       PPSPTPHMRER------------RPEDFQVICRVKY-AGDVKLSLTAEILLDYPMPSFVG
MDM12_AJECG       DDTPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_AJECN       DDTPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_AJEDR       DDLPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_BLAGS       DDLPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_PARBP       SGTPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_PARBD       SGTPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_PARBA       SGTPPRRMREQ------------KAEDFQVFCRTKY-AGNISLSLTAEILLDYPMPSFVG
MDM12_COCIM       NSPAPRRVREK------------RPEDLQVLCRLRY-NGNIRLSLTALVLLDYPMPNFVG
MDM12_UNCRE       HSPPPRRMHEK------------KPDDLQVLCQLRY-NGNIRLSLTAQVLLDYPMPSFVG
MDM12_ARTOC       SALPTRRMREQ------------KPDDFQVLCRLQY-SGNMRLSITAQILLDYPMPSFVG
MDM12_BOTFB       STSPPRRFREP------------KVEDLQTVFRVRY-SGNIRLSLTVDILLDYPMPSFVG
MDM12_SCLS1       PTSPPRRFREP------------KPEDLQTVFRVRY-SGNIRLSLTVDILLDYPMPSFVG
MDM12_CHAGB       NDDGHPRWREQ------------RIDDMQAVFRIRY-AGDVKLLLTADILLDYPMPSFVG
MDM12_MAGO7       DSSDRTKYRER------------RIEDMQAVFRIKY-AGDVKLLLTADILLDYPMPSFVG
MDM12_PHANO       PSVSPHPMREK------------SPEDIQVVAHVQY-SGDIKMSLTAEILLDYPMQSFVG
MDM12_PYRTR       PSASPHRMHEK------------SPEDIQVVTHVQY-SGNIKMSLTAEILLDYPMPSFVG
D5G665_TUBMM      SSSAIPRLTEP------------RDQDTQIMARVRY-SGDIRLELTAELLLEYPITNFVA
MDM12_SCHJY       NSAETPSFLRN------------SIGDVQIIAHVQY-SGNMTMSMEACLAVNYPSKDFAM
MDM12_SCHPO       STPMDNHQERD------------RSNDFQVTAHVSY-DGDANLSLEAVLSMNYPNSEFAV
MDM12_COPC7       QPQQQQPQQEN------------NHPNLQLHLQVNW-HSNLRITITTSLLINYPSPMFMS
MDM12_LACBS       PP----PPAEN------------PHPNLQLHLHVNW-HSNLRITLTTSLLINYPSPMFMS
MDM12_POSPM       PPHQPDGQEPN------------PHPNLQLHLHITW-NSNLRLTLTTSLLINYPSPMFMS
MDM12_CRYNJ       PAGLPPKVSSS------------SIPSLQLHLRLSH-ASDLHLTLLTSLQVNYPSALFMA
MDM12_MALGO       SSLWEEQTRLS------------DIPSLQMHLSVQWLTSTMRLSLTTSLKIAYNNDTIMS
E3KPX8_PUCGT      APTIKPDEDGH------------SQPSLQIHLRLTY-DGNLRLRFSTALVLNHPAAEFMS
MDM12_YEAS6       -----------------------SPNDIQFLLEVEY-KGDLLVTIGADLVLNYPVEKFMT
MDM12_YEAS7       -----------------------SPNDIQFLLEVEY-KGDLLVTIGADLVLNYPVEKFMT
MDM12_YEAST       -----------------------SPNDIQFLLEVEY-KGDLLVTIGADLVLNYPVEKFMT
MDM12_YEAS1       -----------------------SPNDIQFLLEVEY-KGDLLVTIGADLVLNYPVEKFMT
MDM12_ZYGRC       -----------------------SPNDIQFLVEVEY-KGDLLVTLAADLVLNYPSDNFMT
MDM12_CANGA       -----------------------KETDTQFLIEFEY-KGDMSLTLTAELVLNYPVERFMT
MDM12_VANPO       -----------------------SANDVQFLVEMEY-NGNMSITVTAEMVLNYPSKKFMA
MDM12_ASHGO       -------------------------TDVQFLMEVDY-KGDMLIELSAELVLNYPSPNFMQ
MDM12_KLULA       -------------------------TDVQLLVELDY-KGDMSIELSADLVLNYPSPQFMI
MDM12_LACTC       -----------------------AESDLQFLVEVDY-KGDMRIGVSAELALNYPSPSFMT
MDM12_CANAL       --QKQPHHDD---------------NDIQLIVEINY-KGDMHINLLVNLLVNYPSPNFIS
MDM12_CANAW       --QKQPHHDD---------------NDIQLIVEINY-KGDMHINLLVNLLVNYPSPNFIS
MDM12_CANDC       --QKQPHHDD---------------NDIQLIVEINY-KGDMHINLLVNLLVNYPSPNFIS
MDM12_CANTT       --QKQPLYDE---------------NDIQLIVEFNY-KGNLHMNILVNLLVNYPSPNFIS
MDM12_LODEL       KGQKHKHEHEEEQGSDKQNAKNKASDDVQLILEINY-KGNLYIDLLVTLLVNYPSPNFIS
MDM12_DEBHA       --EPCSTRGE---------------NDIQLIAEVKY-NGDLHLELTVNLLVNYPSPNFIS
MDM12_PICST       --LQKTTRGE---------------NDIQIIAEIEY-SGNLHVDLIVNLLVNYPSPNFIS
MDM12_PICGU       --SKKSKRGE---------------NDVQIIAEVKY-KGNLHIEVTVDLFLNYPSQHFVT
MDM12_CLAL4       --NESVKKND---------------NDIQFILEIDY-KGDVALEIVVNLLVNYPSAHFIT
MDM12_KOMPG       ------------------------ENDMQFVTEIKY-DSDICVEVAAQLLMNYPAEKFIS
F4NT33_BATDJ      DSTNNLRYVQLPP----------QDTDAQLELNVRY-HGNMRLSISTELIVNQPTPAFMV
MDM12_YARLI       EEREQQPVPED------------REDDLQVLFRVKY-TGDIRIGVEATLRLNYPSDDVVL
                                            . *         .   : . . : :      .  

MDM12_ASPFU       LPLKLNVTGITFDGVAVIAYIRKRVHFCFLSAED--ADALIGPEQQQQRE----------
MDM12_ASPFC       LPLKLNVTGITFDGVAVIAYIRKRVHFCFLSAED--ADALIGPEQQQQRE----------
MDM12_NEOFI       LPLKLNVTGITFDGVAVIAYIRKRVHFCFLSAED--ADALIGSEQQQQQE----------
MDM12_ASPCL       LPLKLNVTGITFDGVAVVAYIRKRVHFCFLSAED--ADALIGSEQQQ--E----------
MDM12_ASPFN       LPLKLNVTGITFDGVAVIAYIRKRVHFCFLSAED--ADALIGSDQQE-------------
MDM12_ASPOR       LPLKLNVTGITFDGVAVIAYIRKRVHFCFLSAED--ADALIGSDQQE-------------
MDM12_ASPTN       LPLKLNITGVTFDGVAVVAYIRKRVNFCFLSAED--ADALIGADDQE-------------
MDM12_ASPNC       LPLKLNVTGITFDGVAVVAYIRKRVHFCFLSSED--ADALIGSDQPD-------------
MDM12_PENRW       LPLKLNVTGITFDGVAVVAYIRKRVHFCFLSAED--ADALLGSEQSQGSQ----------
MDM12_EMENI       LPLKLNVTGITFDGVAVIAYIRKRVHFCFLSPED--AEALVGSGSYS-------------
MDM12_TALMQ       LPLKLNITGITFDGVAVVAYIRRRAHLCFLSPED--ADALLGDEEEDINHQQR-------
MDM12_TALSN       LPLKLNITGITFDGVAVVAYIRRRAHLCFLSPED--ADALLGDED-DIQHPSY-------
MDM12_AJECG       LPLKLNITGLTFDAVAVIAYIRRRIHFCFLSPED--ADTLMGPET---------------
MDM12_AJECN       LPLKLNITGLTFDAVAVIAYIRRRIHFCFLSPDD--ADTLMGPET---------------
MDM12_AJEDR       LPLKLNITGLTFDAVAVIAYIRRRIHFCFLSPED--ADALIGPEI---------------
MDM12_BLAGS       LPLKLNITGLTFDAVAVIAYIRRRIHFCFLSPED--ADALIGPEI---------------
MDM12_PARBP       LPLKLNITGLTFDAVAVLAYIRRRIHFCFLSPED--AYALIGPET---------------
MDM12_PARBD       LPLKLNITGLTFDAVAVLAYIRRRIHFCFLSPED--AYALIGPET---------------
MDM12_PARBA       LPLKLNITGLTFDAVAVLAYIRRRIHFCFLSPED--ADALIGPET---------------
MDM12_COCIM       LPLKLNITGLTFDGVAVVAYIRKRVHFCFLSPED--ADTLFGADD--TNEA---------
MDM12_UNCRE       LPLKLNITGLSFDGVAVVAYIRKRVHFCFLSPED--ADTLLGSEE--SNET---------
MDM12_ARTOC       LPLKLNITGFTFDGVAVVAYIRKRIHVCFLSPED--ADTLLGADDKMASTE---------
MDM12_BOTFB       IPVKLNITGLSFDGVAVLAYIRKRAHFCFLSPED--AYAAIGADEKDADAS---------
MDM12_SCLS1       IPVRLNITGLSFDGVAVLAYIRKRAHFCFLSPED--AYAAIGADEKEAGGS---------
MDM12_CHAGB       IPVRLSITGLTFDGVGVLAKIRKRVHFCFLSPED--AAAAVGGDGEEGLSSPG-------
MDM12_MAGO7       IPVRLSITGLTFDGVGVVAHIRKRVHFCFLSPED--ALAAVGSASGKEAGDGD-------
MDM12_PHANO       IPLKLNITGLTFDGVALLAYIKRRAHFCFLSPDD--AEALVGSDAGFNGLQTD-------
MDM12_PYRTR       IPLKLNITGLTFDGVAILAYIKKRAHFCFLSPDD--ADALVGSDIGFNGLQTD-------
D5G665_TUBMM      LPVRLLVTGCKFDGLACLAYIRRRAHFCFIDEEQ--TPDLGDGEG---------------
MDM12_SCHJY       LPFTLQLSDIVLDGTLVVALIASHVHVCFVDTLE--HNRG--------------------
MDM12_SCHPO       LPFKLSFIRISIDAIAVLAKMGKRTHLCFVDTLL--HGTG--------------------
MDM12_COPC7       LPIKLSVTGLVFNGELAVAYEGQRRRVHVCILDD--LDPYGPAGDRPKREVDP-------
MDM12_LACBS       LPIKLSVTGLIFIGELAVAYEGERRRVHLCILDD--LDPYGPAGDR--------------
MDM12_POSPM       LPIKLSVTGLLFNGEVVVAYEGERRRVHFETPPE--ADEDMPAAAA--------------
MDM12_CRYNJ       LPLKLSITGFQLNADIVMAYSGEKNRVHLTIVDD--ESNPAHKEDK--------------
MDM12_MALGO       LPISLVVTGMELFAQAIVALDGVHRCVYLSLSED--STEECAPDGLRAVH----------
E3KPX8_PUCGT      LPLRATVVGVGFDAEIILAIEGDRSKFHLSLLEP--PHSE-LPLYEDSVE----------
MDM12_YEAS6       LPVKLSISDIGLHSLCIVACLSKQLFLSFLCDV---SDPALDDNQTVLDP----------
MDM12_YEAS7       LPVKLSISDIGLHSLCIVACLSKQLFLSFLCDV---SDPALDDNQTVLDP----------
MDM12_YEAST       LPVKLSISDIGLHSLCIVACLSKQLFLSFLCDV---SDPALDDNQTVLDP----------
MDM12_YEAS1       LPVKLSISDIGLHSLCIVACLSKQLFLSFLCDV---SDPALDDNQTVLDP----------
MDM12_ZYGRC       LPVKLTISNVGLHSLCLVAHLSKHLLISFLCDI---SDVDLDGNESLLDP----------
MDM12_CANGA       LPLKISISNIGLHSLCLVSYLAKQVFISMLCDV---SDPVLDDVDCVLDP----------
MDM12_VANPO       LPIRLTISNIGFHTLCLIAFLSKQLFFSFLCDV---TDPILDEDDSILDQ----------
MDM12_ASHGO       LPVKLTISDIGIHSLCLVAYLQRQLFISFLCDVS---DPALDNVESPLDS----------
MDM12_KLULA       LPVKLRISDIGMHCLCLLAYLKKQLFISFLCDV---SDPLLENDKLQVDP----------
MDM12_LACTC       LPVKLSITDLGIHALCLVAYISKQLFVSFLCDV---ADPILDARESLIDL----------
MDM12_CANAL       LPIKLHITDIVIHSIATIAYLKKSVFLSFLCDV---DDTFPDFDSN--VQTPTSTT----
MDM12_CANAW       LPIKLHITDIVIHSIATIAYLKKSVFLSFLCDV---DDTFPDFDSN--VQTPTSTT----
MDM12_CANDC       LPIKLHITDIVIHSIATIAYLKKSVYLSFLCDV---DDAFPDFDSNNNAQTPTSTT----
MDM12_CANTT       LPIKLHITDIEIHSIATIAYLKKAVFLSFLCDVN--DETIPEFNNS--------------
MDM12_LODEL       LPIKLHVTDLVIHTIATIAYLKHAVYVSFLCDVNDEADGFSGASSNASTPNVTGTTSGGG
MDM12_DEBHA       LPIKLHVTDLVIHSIITIAYLKNSVFFSFLCDV---NDINSDYFTSSTQNSTPEHMGAT-
MDM12_PICST       LPIKLHITDIVIHSIATIAYLKKAVYFSFLCDI---NESTPDYFSTSSSSSVSTSTAAPA
MDM12_PICGU       LPIKLHITGFEIHSLICIAYLQNAVYFSFLCDVS--DDSQADYFNGAHME----------
MDM12_CLAL4       LPIKLKITDLVIHSLAAVAYLENSVFISFLCDL---NDADSDYFTSASMHRRSDAHSRGS
MDM12_KOMPG       LPVRLKLSDLLIHTLAVVAYVNHRVFISLLCDIS--ENEDTDNTESHSGN----------
F4NT33_BATDJ      LPLALTLTGFSFDGTAVIAYLGYAINFCFKEPLD--------------------------
MDM12_YARLI       LPMKLHLSHININSLAIMAYIKKSIYLSVICDLDD-SDHAVARTG---------------
                  :*.   .    :     ::       . .                               

MDM12_ASPFU       --SAGDDHRPQSRPDSS--------------------------ASASQKRHG-GLLQEIR
MDM12_ASPFC       --SAGDDHRPQSRPDSS--------------------------ASASQKRHG-GLLQEIR
MDM12_NEOFI       --SAGDDHRPQSRPDSS--------------------------ASASQKRHG-GLLQEIR
MDM12_ASPCL       --SGGDDHRPRSGADSS--------------------------AHTSQKRQG-GLLQEIR
MDM12_ASPFN       --ARGQDDRPWSSAD----------------------------PTASPKRQG-GLLREIR
MDM12_ASPOR       --ARGQDDRPWSSAD----------------------------PTASPKRQG-GLLREIR
MDM12_ASPTN       --TRDKDDHPRSGLD----------------------------PTTSPKRQG-GLLREIR
MDM12_ASPNC       --VGAQTEYSRSGGD----------------------------ATVSAKRQG-GLLQEIR
MDM12_PENRW       --NPSDDGRPRSGGDQ---------------------------KDKELKRQG-GLLQEIR
MDM12_EMENI       --GQQETPGPSTGSSGG--------------------------GNPSPHQKGLSLLQEIR
MDM12_TALMQ       --QQQQQQHPYPTTNTSESINNNNPE----------------THPPQPRRRFGSLLQQIR
MDM12_TALSN       --STANTTTAASGSSTDNNNNNNESNDHP-------------NHPPQPRRRFGSLLQQIR
MDM12_AJECG       -------AGGGGGGDTS--------------------------EPNSSRRKPSSLLREIR
MDM12_AJECN       -------AAGSGGGDTL--------------------------EPNSPRRKHSSLLREIR
MDM12_AJEDR       -------GSG-GGEDTL--------------------------EPNSPRRKPLSLLREIR
MDM12_BLAGS       -------GSG-GGEDTL--------------------------EPNSPRRKPLSLLREIR
MDM12_PARBP       -------GGG--GGDTM--------------------------EPNSLRRKNLSLLRKIR
MDM12_PARBD       -------GGG--GGDTM--------------------------EPNSLRRKNLSLLRKIR
MDM12_PARBA       -------GAG--GGDTM--------------------------EPNSLRRKNLSLLRKIR
MDM12_COCIM       --GHLQSRDSLAGGIND--------------------------TSYSSRRPHDSLLRDVR
MDM12_UNCRE       --GYIPGINPIGGGASG--------------------------GAASSRRRDDSLLRDVR
MDM12_ARTOC       --GYHDHHNHHHSGNTN--------------------------TTGS-RRSNDSLLREIR
MDM12_BOTFB       -----------------------------------------------AGMKMGALLHEIK
MDM12_SCLS1       -----------------------------------------------GGMKMGALLHEIK
MDM12_CHAGB       --EGPSQAQGQGQGQGQGQGQGQTPGAGQQKQQKKQAGWVGS-----GNTKLGGLLQEIR
MDM12_MAGO7       --EYGDTSGGAAAAAASSSASAATTPQGVATLASPAGAAPGSDEKAGGNTRMGGLLQEIR
MDM12_PHANO       --SNGENAQP------------------------------------VQRPKIGGLLENIR
MDM12_PYRTR       --AQGQNPRP------------------------------------VQRPKIGGLLEHIK
D5G665_TUBMM      ----------------------------------------------VTRVRTKSLLKEIK
MDM12_SCHJY       -------------------------------------------------DVQSSIIKNIR
MDM12_SCHPO       -------------------------------------------------EHASSVIRDLT
MDM12_COPC7       --DTLNDTAITPPDLDEDSPP-------------------NSGRPQKPLPIGQRLLPSIF
MDM12_LACBS       ----------------------------------------------------QRLLPSIY
MDM12_POSPM       ----------------------------------------GTARAGKPLPIGQRLLPSIY
MDM12_CRYNJ       -----------------------------------------------QIPLGQRLLSNLQ
MDM12_MALGO       ------------------------------------------DARIRTRHQGQRILPFLA
E3KPX8_PUCGT      ------------------------------------------NGGKRNSSIGARILPHLF
MDM12_YEAS6       -------KGPILAATKP--------------------------------LERISIVRSMK
MDM12_YEAS7       -------KGPILAATKP--------------------------------LERISIVRSMK
MDM12_YEAST       -------KGPILAATKP--------------------------------LERISIVRSMK
MDM12_YEAS1       -------KGPILAATKP--------------------------------LERISIVRSMK
MDM12_ZYGRC       -------KGHVLSPRRS--------------------------------LERISIIRNMK
MDM12_CANGA       -------NGPVLLANKP--------------------------------LERISIIRSMK
MDM12_VANPO       -------NGPLLSSKGP--------------------------------LERISIIRSLS
MDM12_ASHGO       -------NGPAFLGSKA--------------------------------VERISLIRSIK
MDM12_KLULA       -------SGPNFMGKRA--------------------------------LERISLIRNIK
MDM12_LACTC       -------GSSAILGKKS--------------------------------LERISLIRSIK
MDM12_CANAL       -------GGNFVDYYSND---------------------------ATINKERIDIVKKIK
MDM12_CANAW       -------GGNFVDYYSND---------------------------ATINKERIDIVKKIK
MDM12_CANDC       -------GGNFVDYYSND---------------------------AAINKERIDIVKKIK
MDM12_CANTT       ---------QSIEYYTKN---------------------------NPI-----DIIKKIK
MDM12_LODEL       -----NSGGNIVDYYFS----------------------------DPNNKERIDIIKKIK
MDM12_DEBHA       -----NTGGNFVDYVSG-----------------------------PINRERIDIIKKVK
MDM12_PICST       TPTTYNSGGNFVDYIAD-----------------------------PNNRERIDIVKKIK
MDM12_PICGU       ------SGGNFVEYVSG-----------------------------TNNKERIDIIKKVK
MDM12_CLAL4       HIPP-SSGGNITDYVPS------------------------------NNKERIDVIRSVK
MDM12_KOMPG       --------LRALSSKTA---------------------------------SRIDVVKRLK
F4NT33_BATDJ      ---------------------------------------------------GNSILQDMT
MDM12_YARLI       -------------------------------------------------RERLDIIRDVK
                                                                        ::  : 

MDM12_ASPFU       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLI------------
MDM12_ASPFC       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLI------------
MDM12_NEOFI       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLI------------
MDM12_ASPCL       VESEIGRK-ENGKQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLI------------
MDM12_ASPFN       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEEMVFPSFWTFLI------------
MDM12_ASPOR       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRTFEEEMVFPSFWTFLI------------
MDM12_ASPTN       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEELVFPSFWTFLI------------
MDM12_ASPNC       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLV------------
MDM12_PENRW       VDSEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFEEELVYPSFWTFLV------------
MDM12_EMENI       VESEIGRK-EDGKQVLKNVGKVERFVLAQVRRIFDEELVFPSFYTFLI------------
MDM12_TALMQ       VDSEIGRK-ENGKQALKNVGKVERFVLDQVRRIFEDEFVFPSFWTFLV------------
MDM12_TALSN       VDSEIGRK-ENGKQALKNVGKVERFVLDQVRRIFEDEFVFPSYWTFLV------------
MDM12_AJECG       VESEIGRK-ENGKQALKNVGKLEKFVLEQVRRIFEEEFVYPSFWTFLI------------
MDM12_AJECN       VESEIGRK-ENGKQALKNVGKLEKFVLEQVRRIFEEEFVYPSFWTFLI------------
MDM12_AJEDR       VESEIGRK-ENGKQALKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_BLAGS       VESEIGRK-ENGKQALKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_PARBP       VESEIGRK-ENGKQALKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_PARBD       VESEIGRK-ENGKQALKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_PARBA       VESEIGRK-ENGKQALKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_COCIM       VESEIGRK-EDGKQVLKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_UNCRE       VESEIGRK-EDGKPVLKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_ARTOC       VESEIGRK-ESGKQVLKNVGKVEKFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_BOTFB       VESEIGQR-ENGKQVLKNVGKVEKFVLEQVRRIFEDEFVYPSFWTFLV------------
MDM12_SCLS1       VESEIGQR-ENGKQVLKNVGKVEKFVLEQVRRIFEDEFVYPSFWTFLV------------
MDM12_CHAGB       VESEIGQR-ESGRQSLKNVGKVERFVLEQVRRIFEEEFVYPSFWTFLV------------
MDM12_MAGO7       VESEIGQR-EGGKQSLKNVGKVEKFILEQVRRIFEEEFVYPSFWTFLV------------
MDM12_PHANO       VESEIGGQ-GSGKQVLKNVGKVESFVLEQVRRIFEDEFVYPSFWTFLV------------
MDM12_PYRTR       VESEIGGQ-GSGKQVLKNVGKVESFVLEQVRRIFEDEFVYPSFWTFLV------------
D5G665_TUBMM      VESEIGEK-GKGKQVLKNVGKVERFVLEQVRRIFEEEFLFPSSWTFLI------------
MDM12_SCHJY       VDSVVG---EPNKQVLKNVAKVEKFVVQKICQIVEDEFVWPSYFTLY-------------
MDM12_SCHPO       VESIIG---ESNKQLLKNVAKVEKFVSEKVKRIIEDELVWPSYITIE-------------
MDM12_COPC7       IESEIG---QADKHVLKNVTRVERFIQDVIRKTVEEELVFPNFHTLVMGDG---------
MDM12_LACBS       IESEIG---QADKHVLKNVTRVERFIQDVIRKTVEEELVFPNFHTIVMADS---------
MDM12_POSPM       IESEIG---QADKHVLKNVTRVERFIQDVIRKTIEEELVFPNFHTLVLGDSGS-------
MDM12_CRYNJ       IESEIG---HADAHVLRNVGKVERFIVDVVRKTLVDELVFPNFHTVAL------------
MDM12_MALGO       LESKVG---ESAKHVLENVGKVERFVGDMLRQWLEDELVYPHFYTLYL------------
E3KPX8_PUCGT      VETEVG---NADRHVLRNVGKVERFLTETIRSLICEEFLYPTFQTFEWD-----------
MDM12_YEAS6       IETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE-------
MDM12_YEAS7       IETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE-------
MDM12_YEAST       IETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE-------
MDM12_YEAS1       IETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE-------
MDM12_ZYGRC       IETEIGQQHSGEGSVLRSVGRLEQFLLEIFKDLLRKEVSWPSWIELDFNDDNEEDLQ---
MDM12_CANGA       IETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDFLRKELAWPSWVNLDFND----------
MDM12_VANPO       ISTEVGEEYQGDGSVLKSVGKLEQFLKEKLKDFLRKEVAWPSWINFDFYEPEDNESD---
MDM12_ASHGO       IQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDFNEDVSADVESS-
MDM12_KLULA       IHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFTPEDPEDPEEEG
MDM12_LACTC       IDSEIGEQNNVEGSVLRSVGKLEQFLLEVFRTILKKEAAWPSWINLDFNEDPSGNE----
MDM12_CANAL       IESEIGEV---ENNILRNVGKVEKFLVEQLRNILRDEIAWPSWICIDMNDDDDEEEEEEE
MDM12_CANAW       IESEIGEV---ENNILRNVGKVEKFLVEQLRNILRDEIAWPSWICIDMNDDDDEEEEEE-
MDM12_CANDC       IESEIGEV---ENNILRNVGKVEKFLVEQLRNILRDEIAWPSWICIDMNDDGDDDDDDE-
MDM12_CANTT       IESEIGEV---ESNILRNVGKVERFLVEQLRNILREELAWPSWICLDMNDDDEEEEEEE-
MDM12_LODEL       IESEIGEV---ENNILRNVGKVEKFLMEQLRAILRDEIAWPSWICVDMAENDDEEEDDDD
MDM12_DEBHA       IESEIGEA---EQNALRNVGKVERFLVEQLRNIIRDEFAWPSWVCFDLNEDDDDE-----
MDM12_PICST       IESEIGEL---ENNVLRNVGKVEKFLIEQLRNIIREELAWPSWICIDMSEDEDEEEQTPS
MDM12_PICGU       IESEIGEV---ETNVLRNVGKVEKFLVEKIRSIIREETAWPSWLCFDMSD----------
MDM12_CLAL4       IDTEIGEM---ENNVLRNVGKVEKFLVEQLRNIIRDETAWPSWICLDFNDDDDDDDDDDD
MDM12_KOMPG       VESELGSYEPDNGSILRSVGKIETFLVDTIRNLLVQEVGWPNWIEFQGV-----------
F4NT33_BATDJ      IESEIGDR---NKQVLKNVEKIERFIVQQLKSFFNDFLVFPNFHSIYLTQDDTYTECSSQ
MDM12_YARLI       IDSEIGHH-DTNGAALRNVGKVDRFIVDKIRSLLKAEIAWPSWIKVSMEDEDSDDEEGEE
                  : : :*         *..* .:: *:   .   .     :*    .              

MDM12_ASPFU       ----------------------------------------------------------
MDM12_ASPFC       ----------------------------------------------------------
MDM12_NEOFI       ----------------------------------------------------------
MDM12_ASPCL       ----------------------------------------------------------
MDM12_ASPFN       ----------------------------------------------------------
MDM12_ASPOR       ----------------------------------------------------------
MDM12_ASPTN       ----------------------------------------------------------
MDM12_ASPNC       ----------------------------------------------------------
MDM12_PENRW       ----------------------------------------------------------
MDM12_EMENI       ----------------------------------------------------------
MDM12_TALMQ       ----------------------------------------------------------
MDM12_TALSN       ----------------------------------------------------------
MDM12_AJECG       ----------------------------------------------------------
MDM12_AJECN       ----------------------------------------------------------
MDM12_AJEDR       ----------------------------------------------------------
MDM12_BLAGS       ----------------------------------------------------------
MDM12_PARBP       ----------------------------------------------------------
MDM12_PARBD       ----------------------------------------------------------
MDM12_PARBA       ----------------------------------------------------------
MDM12_COCIM       ----------------------------------------------------------
MDM12_UNCRE       ----------------------------------------------------------
MDM12_ARTOC       ----------------------------------------------------------
MDM12_BOTFB       ----------------------------------------------------------
MDM12_SCLS1       ----------------------------------------------------------
MDM12_CHAGB       ----------------------------------------------------------
MDM12_MAGO7       ----------------------------------------------------------
MDM12_PHANO       ----------------------------------------------------------
MDM12_PYRTR       ----------------------------------------------------------
D5G665_TUBMM      ----------------------------------------------------------
MDM12_SCHJY       ----------------------------------------------------------
MDM12_SCHPO       ----------------------------------------------------------
MDM12_COPC7       ----------------------------------------------------------
MDM12_LACBS       ----------------------------------------------------------
MDM12_POSPM       ----------------------------------------------------------
MDM12_CRYNJ       ----------------------------------------------------------
MDM12_MALGO       ----------------------------------------------------------
E3KPX8_PUCGT      ----------------------------------------------------------
MDM12_YEAS6       ----------------------------------------------------------
MDM12_YEAS7       ----------------------------------------------------------
MDM12_YEAST       ----------------------------------------------------------
MDM12_YEAS1       ----------------------------------------------------------
MDM12_ZYGRC       -------------------QSKDTPTTANTGTTTTN----------------------
MDM12_CANGA       ----------------------------------------------------------
MDM12_VANPO       -------------------DNQIN----------------------------------
MDM12_ASHGO       -------------------SSAEESLPHRDDAQDFSADARA-----------------
MDM12_KLULA       RENDLVADSSNDGKDIEMKSGTEETLGAGIQESVQHVSPAVTSIDQESRVNSNTSLEE
MDM12_LACTC       -------------------SSDED----------------------------------
MDM12_CANAL       ------------------SEDNDGGNSDLNDNDGKHGDGRTDETEAGE----------
MDM12_CANAW       ------------------SEDNDGGNSDLNDNDGKHGDGRTDETEAGE----------
MDM12_CANDC       ------------------VEDSNVSDGDGKDNDGKHGDGPTHEV--------------
MDM12_CANTT       ----------------------NPSESSSTTHVGS-----------------------
MDM12_LODEL       ------------------DDHDEDNEGRGRMRDTGDVDVRDHDKKED-----------
MDM12_DEBHA       ------------------SDDQEEN---------------------------------
MDM12_PICST       ------------------PDSRDSNVNSI-----------------------------
MDM12_PICGU       ----------------------------------------------------------
MDM12_CLAL4       ------------------QPSTASTQHSSHTS--------------------------
MDM12_KOMPG       ----------------------------------------------------------
F4NT33_BATDJ      HSGFNQADTGI-----------------------------------------------
MDM12_YARLI       EGDQEDEH--------------------------------------------------