CLUSTAL format seed alignment for MF_03111

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COQ41_PARTE      -----------------------------------------------------------M
COQ42_PARTE      -----------------------------------------------------------M
COQ4_DICDI       ------------------------------------------MNSSSNIIYKSFKNSKIF
COQ4_MOUSE       ----------------------------------------MATLLLL----RSLRLHRSL
COQ4_RAT         ----------------------------------------MATLLL-----RSQRLHRSL
COQ4_HUMAN       ----------------------------------------MATLLR-----PVLRRLCGL
COQ4_XENLA       ----------------------------------------MKILLSCLRFSPVWRGPRSA
COQ4_XENTR       ----------------------------------------MSGLLRYLHCSPAWRVLRPA
COQ4_DANRE       ----------------------------------------MRGLPG-----AFLGSFKTS
COQ4_DROSE       ------------------------------------------MMQRCL-RLQKPLALRRG
COQ4_DROSI       ------------------------------------------MMQRCL-RLQKPLALRRG
COQ4_DROME       ------------------------------------------MMQRCL-RLQKPLALRRG
COQ4_DROYA       ------------------------------------------MMQRCL-RLPKPLALRRG
COQ4_DROER       ------------------------------------------MMQRCL-RLPKLLALRRD
COQ4_DROAN       ------------------------------------------MMQRCVWRLQMPLALRRG
COQ4_DROPE       ------------------------------------------MMQRCW-RLTVPLA-KRG
COQ4_DROPS       ------------------------------------------MMQRCW-RLPVPLG-KRG
COQ4_DROWI       ------------------------------------------MMQRLR-------LARRG
COQ4_DROGR       ------------------------------------------MMQRCW--QISLPLARRR
COQ4_DROMO       ------------------------------------------MMQQLR--RISLPRLQRH
COQ4_DROVI       ------------------------------------------MMQRSW--QSWRRGLTLG
COQ4_AEDAE       -----------------------------------------MLRQTAFRSMKLNRTPGRY
COQ41_CULQU      ------------------------------------------MFLRRVHPVRLGHASQRS
COQ4_ANOGA       ---------------------------------MFVRKSCYSLINATRRCLRYRQLSSTT
COQ4_BOMMO       --------------------------------------------------MYLRKPIQKI
COQ4_CAEEL       ------------------------------------------------------------
COQ4_YEAST       ------MLRLSLLRSTATLPVKCQ------RRGLILPAAAMYTLGSLIFGKEARLADAME
COQ4_YEAS1       ------MLRLSLLRSTATLPVKCQ------RRGLILPAAAMYTLGSLIFGKEARLADAME
COQ4_YEAS7       ------MLRLSLLRSTATLPVKCQ------RRGLILPAAAMYTLGSLIFGKEARLADAME
COQ4_YEAS6       ------MLRLSLLRSTATLPVKCQ------RRGLILPAAAMYTLGSLIFGKEARLADAME
COQ4_CANGA       -----MLQSTKVTKSVLTNVLRVEQ-----RRGFLLSGAAVALGSTYIFGRDAKLADAMD
COQ4_LACTC       ------MIRTSFKHSIETRNQLLH------RRHFVV--AAALTVGNFVFGRDARLADAMD
COQ4_ZYGRC       ------MLRLGVSRTPINRQFVGYE----QRRHFIV--ASALTLGGFVFGKRAKLADAME
COQ4_VANPO       MLSRISSVRIGTQVRQLANPVVNQSSQVLQTRQFYV--AAALTVGSMIFGKQNKLADSIA
COQ4_ASHGO       ------MLRGKATVAAAQP-----------RRTFVL--AGMLSLGQLVIGREARLADAMA
COQ4_KLULA       ------MFTVSKKSLQASRNAFSPLNN--SKRTIVF--TAIAAFGDLLIGKDVRLADAME
COQ4_CANAW       ------MLKSTVNNTRI--KCGHID----QRRNYLFTTLAGTVLGSFLWSKNNVLASKME
COQ4_CANAL       ------MLKSTVNNTRI--KCGHID----QRRNYLFTTLAGTVLGSFLWSKNNVLASKME
COQ4_CANDC       ------MLKSTVSNTRI--KCCRID----QRRNYLFTALASSALGSFLWSKNNVLASKME
COQ4_CANTT       ------MLRTAIRNNV------QVS----QKRTYIMSTIASTFLGSILFSKNNQLASKME
COQ4_LODEL       MLTSQKVSRVLLHSSFL--KTPVST----QSRSFVFTTIATTLFGSVLWSKNNVLASKME
COQ4_DEBHA       ----MHILQACKGMEHRSISSLIVN----QKRQFLLTA-TATLVGSMIMNENNRLANKME
COQ4_PICST       -----MFARSALGRSDQLVTALNS-----QKRQFVLTA-ATTALGSLLFSEDNRLASQME
COQ4_CLAL4       -----MISRSIFSKS----VSLQRS----QNRSFLLTA-ASAVFGSMIFNENNQLASKME
COQ4_PICGU       ------MFSIVSSRP----KSLVRP----NSRSIVLPA-LVA-LTSIIFSKDNRLADKME
COQ4_KOMPG       ------------------MLIVQQF----QKRSFIIPSLISS--GLSYLSKDIRLADKME
COQ4_ASPFN       -----------------------------------------------MSVLRR-R-GALS
COQ4_ASPOR       -----------------------------------------------MSVLRR-R-GALS
COQ4_ASPNC       -----------------------------------------------MTVLRT-RSAVQH
COQ4_ASPTN       -----------------------------------------------MSILGR-RGAAIV
COQ4_EMENI       -----------------------------------------------MSHLRKLRAAAPS
COQ4_ASPFC       -----------------------------------------------MSVLGR-RGAGLA
COQ4_ASPFU       -----------------------------------------------MSVLGR-RGAGLA
COQ4_NEOFI       -----------------------------------------------MSVLGR-RGAGLA
COQ4_ASPCL       -----------------------------------------------MSLLGR-RGAGLA
COQ4_PENRW       -----------------------------------------------MSVLGR-RGA-IE
COQ4_TALMQ       -----------------------------------------------MPPPPRTALLAAS
COQ4_TALSN       -----------------------------------------------MPPTPRTALLTVS
COQ4_COCIM       -----------------------------------------------MAIAKSVRARAVG
COQ4_COCP7       -----------------------------------------------MAIAKSVRARAVG
COQ4_UNCRE       -------------------------------------------------MATPTSVRIAG
COQ4_ARTOC       ------------------------------------------------------------
COQ4_AJECG       ---------------------------------------------------------MLT
COQ4_AJECN       ---------------------------------------------------------MLT
COQ4_AJEDR       -------------------------------------------------MTPAVTQTILT
COQ4_BLAGS       -------------------------------------------------MTPAVTQTILT
COQ4_PARBD       -------------------------------------------------MPPTVRQGIRT
COQ4_PARBP       -------------------------------------------------MPPTVRQGIRT
COQ4_PARBA       -------------------------------------------------MPPAVRQGMRT
COQ4_BOTFB       -------------------------------------------------MSLSPRLYTQV
COQ4_SCLS1       -----------------------------------------------MSLSLSPGLYTQA
COQ4_PHANO       -------------------------------------------------------MAKRV
COQ4_PYRTR       -------------------------------------------------------MAKHV
COQ4_MAGO7       -----------------------------------------------MNSSPARAVRALV
COQ4_NEUCR       -----------------------------------------------MEVTALRRSAALV
COQ4_PODAN       -----------------------------------------------MEVT-LKRSAALA
COQ4_YARLI       -----------------------------------------------------------M
COQ4_SCHPO       -----------------------------------------------MFYLNAHLEINKV
COQ4_SCHJY       ------------------------------------------------------------
COQ4_COPC7       ----------------------------------------------MLGRRSVSLLRGLT
COQ4_LACBS       ----------------------------------------------MLSSARARLPISLC
COQ4_CRYNJ       --------------------------------------------MTLAIPLELSLFDPTS
COQ4_LEIIN       ------------------------------------------------------------
COQ4_LEIMA       ------------------------------------------------------------
COQ4_LEIBR       ------------------------------------------------------------
COQ41_TRYCC      ------------------------------------------------------------
COQ42_TRYCC      ------------------------------------------------------------
COQ4_TRYB2       ------------------------------------------------------------
COQ4_PLACH       ------------------------------------------------------------
COQ4_PLAYO       ------------------------------------------------------------
COQ4_PLAKH       ------------------------------------------------------------
COQ4_PLAVS       ------------------------------------------------------------
COQ4_PLAF7       ------------------------------------------------------------
COQ4_CRYPI       ------------------------------------------------------------
                                                                             

COQ41_PARTE      LRDLINN-------------HKPLKNNFERLSTLFQ------------------------
COQ42_PARTE      RHQCI---------------QIPFKVNL--------------------------------
COQ4_DICDI       LNKQCII-------------NNGLKLNKKYFTTTSTKENNNNNNNKNPKFIENNLFQKGL
COQ4_MOUSE       RPRTRPA-----------------------VDVPLRAGSH-GARLLYPDHIPTTPLQKML
COQ4_RAT         RHRTRPT-----------------------VDVLLRAASH-GARLLYPDHIPTTPLQKML
COQ4_HUMAN       PGLQRPA-----------------------AEMPLRARSD-GAGPLYSHHLPTSPLQKGL
COQ4_XENLA       ACVMQGGK-------LQRFQSYNTAEEGIEEDIQFAATNQESSSLLYPDHIPTNAVQKLL
COQ4_XENTR       APGMQGG----------RFRSNYAAEEGIEEEIQFAAARQEDPSSLYSDHIPTNAVQKLL
COQ4_DANRE       YGYLSQR-------------------------LYGVLTEEKYDGRLYPSHIPTSTVQKAI
COQ4_DROSE       LHLAQ------------------VNSQAVTTEAPEAEPLDAFERQYLKERIEISPFQRLF
COQ4_DROSI       LHLAQ------------------VNSQAVATEAPEAEPLDAFERQYLKERIEISPFQRLF
COQ4_DROME       LRLAQ------------------ANSQAVATEAPEAEPLDAFERQYLKERIEISPFQRLF
COQ4_DROYA       LHVAQ------------------VNGQAVATEAPEAEPQDAFERQYLKERIEISPFQRVF
COQ4_DROER       LHLAQ------------------VERQAVVTEAPEAEPQDAFERQYFKERIEISPFQRVF
COQ4_DROAN       LASGE------------------AKNQGV---SPEAEPLDSFERQYLKDRIEISPFQRVI
COQ4_DROPE       LAVVT------------------HTRQAVVSDNPEAENLDGFEQQYLKERIEITTFQRML
COQ4_DROPS       LAVVT------------------HTRQAVVSDNPEAENLDGFEQQYLKERIEITTFQRML
COQ4_DROWI       LALSA------------------VRRQTVV---PEEEPLDAYEREHLKHRIEITPFQRML
COQ4_DROGR       LIPSL------------------TSK-RTAATEAPLDELDAFEREYLKQRIQITPFQRLL
COQ4_DROMO       VTLSL------------------LSRCGSTSTDVPPEELDAFERDYLQQRIQITTFQRLL
COQ4_DROVI       LASRR------------------SYVASVEAPSTPPEELDAFERDYLKQRIEITPFQKLL
COQ4_AEDAE       FTTAENM-------------DTGSSQSPPDTEQK-MQPMDEFTKEFLKNQIKLTELQRVI
COQ41_CULQU      LTTTKSR-------------NESTTTTVEAPQAAPSPPPDAFTEEFLRNQIKVTELQRVI
COQ4_ANOGA       AGTVGTT-------------APTANISLNDEPQPAAAEMDEFTKEFLRNRIEVSDIQRLI
COQ4_BOMMO       KSEVQ--------------------IRLIRYYTASENAKVTYHEEMQNNFIATNIFQKAL
COQ4_CAEEL       ----------------------------------------MSAQKLYASHVPLAPLSRML
COQ4_YEAST       RGELHNK-----------NVDYAKEAEERTELRIRALANTRPMEPRYNGHVPLHRYEKLL
COQ4_YEAS1       RGELHNK-----------NVDYAKEAEERTELRIRALANTRPMEPRYNGHVPLHRYEKLL
COQ4_YEAS7       RGELHNK-----------NVDYAKEAEERTELRIRALANTRSMEPRYNGHVPLHRYEKLL
COQ4_YEAS6       RGELHNK-----------NVDYAKEAEERTELRIRALANTRPMEPRYNGHVPLHRYEKLL
COQ4_CANGA       RGELHNK-----------NEDYAKLRAERTEQRIKALSNNRPMEPRYEGHVPLYLHEKML
COQ4_LACTC       NGELHNK-----------NEDYKAKAEELKEQRLRSIANSRPMKPCYEGHVPLYPHERVL
COQ4_ZYGRC       NGELHNK-----------NNDDEAIRKDRMDKRLKKLSETRPIKPRYEGHVPLYPHERML
COQ4_VANPO       NGEVHDK-----------TVDYEARHQEALEKRLKTLTDTRPMKPRYEGHIPLNLHEKLL
COQ4_ASHGO       RGDLHNK-----------NEDYQAKQLQELEARLQGLRNTRPSAPRYEGHVPLWWHEKAL
COQ4_KLULA       KGNLHNK-----------NGEYEHKMEQRTQERLNALRNTRPIEPNYEGHVPLWWYERMM
COQ4_CANAW       NGELHY------------HDPNLKFNKKLFN---GKPPFER-RTPDYPGHVPLYNFEKVL
COQ4_CANAL       NGELHY------------HDPNLKFNKKLFN---GKPPFER-RTPDYPGHVPLYNFEKVL
COQ4_CANDC       NGELHY------------HDPNLTFNKKLFN---GKPPFER-RAPDYPGHVPLYNFEKVL
COQ4_CANTT       NGELHMP-----------KDPTLSYLNNNNSNNQAEPYFKR-REPDYPGHVPLYNYEKFL
COQ4_LODEL       NHELHY------------NDPNDKYRKLLEK--KRGPAFTR-AAAEYPGQVRLYNYEKFL
COQ4_DEBHA       KGQLHY------------KDANAIF-NKALE-AQESKYFSR-SKSNYPGHVPLFTFEKLL
COQ4_PICST       KGLLHN------------KNAEN---SASIP-NTANKFFSR-PEAEYPGHVPLYTFEKML
COQ4_CLAL4       RGELHY------------DDPNASLNEKKVS-PASNKYFSR-RESEYPGHVPLYGIEKFM
COQ4_PICGU       SGKLHY------------KDVNSTF-------NVDKPYKSR-SKPNYPGHVPLNAFEKLL
COQ4_KOMPG       DGELHF--------------PKTEFEKSQNT---SRPLFQR-PEPNYPGHVPLYNFEKLL
COQ4_ASPFN       LRELS-----------------LSTPVTVVSCRARSFSVNNRPPPKYPGHVPLNFVERGA
COQ4_ASPOR       LRELS-----------------LSTPVTVVSCRARSFSVNNRPPPKYPGHVPLNFVERGA
COQ4_ASPNC       ARELNN--------------FLSCAAPLSLRSHSRPISGFNRPPPNYPGHVPLNFVERGA
COQ4_ASPTN       ARELP----------------LPASSSSILASHPRAFSIFSRPQPKYPGHVPLNAIERGA
COQ4_EMENI       VREVA--------------------LWSRQSPYSRSFSSHNRPSPKYPHHVPLGFFEKGF
COQ4_ASPFC       ARGAT------------------LAPLATASYLIRPFSALNRPPPKYPGHVPLTFFERGA
COQ4_ASPFU       ARGAT------------------LAPLATASYLIRPFSALNRPPPKYPGHVPLTFFERGA
COQ4_NEOFI       ARGPT------------------LAPLATASYLIRSFSALNRPPPKYPGHVPLTFLERGA
COQ4_ASPCL       ARGLT------------------PASPAIAAY-VRPFSAVNRPPPKYPGHVPLTFLERGA
COQ4_PENRW       LRALT------------------ASSNLSAST-LRPFSVLNRPPPNYPGHVPLTTIERGA
COQ4_TALMQ       SRCLK-------------------CYEIGLKYASRNFSALNRPLPNYPGHVPLNRIERGV
COQ4_TALSN       NRCLQ-------------------CHEIGLKYSFRSFSALNRPPPSYPGHVPLTRIERGV
COQ4_COCIM       LRSLR--------------------VLCAQRSVAREFSVLNRPQPNYPGHIPLTPIERGA
COQ4_COCP7       LRSLR--------------------VLCAQRSVAREFSVLNRPQPNYPGHIPLTPIERGA
COQ4_UNCRE       FRSLQ--------------------ALCAQRTVTRNFSLLNRPAPNYPGHIPLTPVERGV
COQ4_ARTOC       MSRLK--------------------IPSQLLRGGRGFSVLSRPAANYAGHVPLTPVERCT
COQ4_AJECG       KRALR------------------TTDPYRRVL-SRGFSVLNRPSPNYPGHVPLTTLERGA
COQ4_AJECN       KRALR------------------TTDPYRRVL-SRGFSVLNRPSPNYPGHVPLTTLERGA
COQ4_AJEDR       VRIAR------------------PHG-YGYVLLSRGFSALNRPPPNYPGHIPLTTIERGA
COQ4_BLAGS       VRIAR------------------PHG-YGYVLLSRGFSALNRPPPNYPGHIPLTTFERGA
COQ4_PARBD       VGTLR------------------VTRPSSYVLSSREFSVLNRPPPNYPGHIPLTTIERGA
COQ4_PARBP       VGTLR------------------VTRPSSYVLSSREFSVLNRPPPNYPGHIPLTTIERGA
COQ4_PARBA       VGTLR------------------VTRPSSYVLSSREFSVLNRPPPNYPGHIPLTTIERGA
COQ4_BOTFB       SRLPR-----------------ELLTACSITLATRSFSVLHRPAPNYPGHVPLTSIERGG
COQ4_SCLS1       ARLPR-----------------ELLTVCSITIATRSFSVLHRPTPNYPGHVPLTSIERSG
COQ4_PHANO       CVGDLR----------KLAGSVSTPSRCILPPHARCFSVLNRPPPNYEGHIPLTVIERLG
COQ4_PYRTR       RMHQLQ----------KLT-LRSLPPASVLVSSSRCFSVLNRPPPNYEGHIPLTRTERLG
COQ4_MAGO7       QSQSRQ----------RPTLERACLSCATVVHARRCFSVLDRPPPNYPGHVPLTRVERAG
COQ4_NEUCR       ARASSQ-NAIRPAVCAAISSTSPTPPTQIQTQQTRQFSALNRPPPNYPGHVPLTRLERFG
COQ4_PODAN       RQTTPLLRPLRPVATYPSNNNNNNNPTPQQRRPYSLFSSLTRPPPNYPGHVPLSFVEKTA
COQ4_YARLI       FRTVP--------------------KTTLLAPIQRRTLLNGNYPKAYPEHVPLTCLGRAV
COQ4_SCHPO       VDVVMSL-------------SKKFLKPSVASNQLRLLFTAAERKVNYPGHVPLSPLQRIF
COQ4_SCHJY       ------------------------------------MFFPNARPVNYPGHIPLSPLQRMF
COQ4_COPC7       ELPV-----------------SSRAHTALRALSVPQTRRNVATKPNYEGHIPLNWFENAL
COQ4_LACBS       SFSLPFAR--------LPNTLSRYQETWQRLPGRTHPTRSIRTTPAYEGHIPLNWFENAV
COQ4_CRYNJ       ADFLVPL-------------ISFSAYFSVKSFTMRPCPRLLTRKLNYPGHIPLSPAQNAL
COQ4_LEIIN       ------------------------------------------------------------
COQ4_LEIMA       ------------------------------------------------------------
COQ4_LEIBR       ------------------------------------------------------------
COQ41_TRYCC      ----------------------------------------MLKSGFYLLGGVVGAASSLP
COQ42_TRYCC      ----------------------------------------MLKSGFYLLGGVVGAASSLP
COQ4_TRYB2       ------------------------------------MQSRVVSSAVMFLGGIAGAVKSLP
COQ4_PLACH       --------------------------------------MNNFAKIFQSNWIDLNKLGKLE
COQ4_PLAYO       --------------------------------------MSNFAKIFQSNWIDLNKLGKLE
COQ4_PLAKH       --------------------------------------MYNFVKIFRSNFIDINAANKLE
COQ4_PLAVS       --------------------------------------MHNFAKIFRSNFIDINAANKFE
COQ4_PLAF7       --------------------------------------MYNFVKIFQSNFIDINKLSKFE
COQ4_CRYPI       ---------------------MNKFTNLLIKRTASSLKGGDFRELFRKNYIPITQFEKVL
                                                                             

COQ41_PARTE      ----CAINAYKYPLNG-NHLSQLGELSG-YYCVKDIHQRMLQHPVGQRILIDKPRVTPET
COQ42_PARTE      --------LNKYFISG-NHLSQLGELSG-YYCVKDIHQRMLQHPIGQRILNDKPRVTPQT
COQ4_DICDI       LTIGSAFVAFINPGRG-DMVATLGEMTG-GCAIKSMKQKMMLDPIGRQLLKEKPRIKEST
COQ4_MOUSE       LAAGAAGMALYNPYRH-DMVAVLGETTG-CHTLKFLRDQMKKDPEGAQILQERPRISLST
COQ4_RAT         LAAGAAGMALYNPYRH-DMVAVLGETTG-CHTLKFLRDQMKKDPEGAQILQERPRISLST
COQ4_HUMAN       LAAGSAAMALYNPYRH-DMVAVLGETTG-HRTLKVLRDQMRRDPEGAQILQERPRISTST
COQ4_XENLA       LSAGSAVMALYDPYRH-DMVAVLGETTG-AVALRKLRDQMRRDPEGLQILQERPRISTST
COQ4_XENTR       LSAGSAVMALYDPYRH-DMVAVLGETTG-AVALRKLRDQMRRDPEGLQILQERPRIRMST
COQ4_DANRE       LAVGSGVAALKNPYRH-DMVAVLGETTG-HQTLIKLRDRMRNDPEGSTILLERPRIRLST
COQ4_DROSE       LGAGSSIAALLNPRRH-DMIACLGETTG-EDALWTILDTMQASEEGQRIMADKPRIHTST
COQ4_DROSI       LGTGSSIAALLNPRRH-DMIACLGETTG-EDALWTILDTMQASEEGQRIMADKPRIHTST
COQ4_DROME       LGAGSSIAALLNPRRH-DMIACLGETTG-EDALWTILDTMQASEEGQRIMADKPRIHTST
COQ4_DROYA       LGAGSSIAALLDPRRH-DMIACLGETTG-EDALLTILDTMQASEEGQRIMADKPRIHTST
COQ4_DROER       LAAGSSIAALLDPRRH-DMIACLGETTG-EDALWTILDSMQASEEGQRIMADKPRIHTST
COQ4_DROAN       LGAGSSIAALLDPRRH-DMIACLGETTG-EGALENILDTMQASEEGQRIMAEKPRIHTST
COQ4_DROPE       LGAGSSIAAILDPRRH-DMIACLGETTG-EDALWNIMDTMHESEEGQRIMVEKPRIHTST
COQ4_DROPS       LGAGSSIAAILDPRRH-DMIACLGETTG-EDALWNIMDTMHESEEGQRIMVEKPRIHTST
COQ4_DROWI       LGAGSSVAAILDPRRH-DMIACLGETTG-EGALWNILDTMEASEEGQRILIDKPRIHTST
COQ4_DROGR       LGAGSSLASLLDPHRH-DMIACLGETTG-ENALWNILDTMQASEEGRRILVEKPRINTRT
COQ4_DROMO       LGAGSSIASLLNPHRH-DMIACLGETTG-ENALLNILDTMQASEEGRRILVEKPRINTKT
COQ4_DROVI       LGAGSSIASLLDPHRH-DMIACLGETTG-ESALWNILDSMQATEEGRRILKDKPRINTKT
COQ4_AEDAE       LSAGSSIAALVDPRRH-DMIACLGETTG-VPALENIRDQMRNSDEGRQILEDKPRINTRT
COQ41_CULQU      LGVGSSLAALVNPRRH-DMIACLGETTG-VPALDAIRRQMLASDEGRQILADRPRINTRT
COQ4_ANOGA       LSAGSSVAALVDPRRH-DMIACLGETTG-REALEKILHYMRSTEEGQRILVEKPRINTRT
COQ4_BOMMO       LTCGSAVIALLDPHRG-DMIACLGEVTG-ENAIKYMHSKMLQTEEGQDILKNKPRINSKT
COQ4_CAEEL       LGIGSAVTAISDPKRG-DMVAAMGETTAIGPVLENIRKRMESDVVGKRLLLEKPRISNGT
COQ4_YEAST       LFAISGWNSFFHPEDG-YNIVQLGEATALPVFLENLKQTMLSDSSGRRILKEQPNITTEI
COQ4_YEAS1       LFAISGWNSFFHPEDG-YNIVQLGEATALPVFLENLKQTMLSDSSGRRILKEQPNITTEI
COQ4_YEAS7       LFAISGWNSFFHPEDG-YNIVQLGEATALPVFLENLKQTMLSDSSGRRILKEQPNITTEI
COQ4_YEAS6       LFAISGWNSFFHPEDG-YNIVQLGEATALPVFLENLKQTMLSDSSGRRILKEQPNITTEI
COQ4_CANGA       LFAISGIRAFFHPENG-INIVQLGEATAFPIFLENLKQTMLADETGRRILRDQPNVRTDI
COQ4_LACTC       LFITSGLKSYFHPEDG-ENIVQLGEASAFTPFLERLKNTMLSDKTGRRILREQPDITSES
COQ4_ZYGRC       LFAISGLKSFFHPEDG-NNIVKLGESSAFPFVLESLKQCMLGDETGRRILREQPNITSDT
COQ4_VANPO       LFVISGIRSYYHPENG-VNIVQLGEATALPFILEDLKKTMLSDETGRRILREKPNVRTET
COQ4_ASHGO       LFGISGLRSFFHPENG-MNIVQLGEAAAIPCFLESLRRTMLSDATGRRILREQPNISEPD
COQ4_KLULA       LFGISGLKSYFHPENG-ENIVQLGEATALPCFLESLKRTMLLDKTGRRILQDRPNITSES
COQ4_CANAW       MFLGSSMGAFFHPEEN-KYIVALGESTAITPILQNLRHKMLSDPVGRTILREKPRMTSDS
COQ4_CANAL       MFLGSSMGAFFHPEEN-KYIVALGESTAITPILQNLRHKMLSDPVGRTILREKPRMTSDS
COQ4_CANDC       MFLGSSMGAFFHPEEN-KYIVALGESTAITPILQHLRHKMLSDPVGRTILREKPRMTSDS
COQ4_CANTT       MFLGSSIGSFFHPEEN-KYIVALGESTAIEPILKKLQKTMLSDEIGRQILKEKPRITSTS
COQ4_LODEL       MFLGSSIGSFFHPEEN-KYIVALGESTAIEPVLKRLQHAMLSDPTGRQILRERPRITSTS
COQ4_DEBHA       MIAGSSLGAYLHPERN-EFIVALGESTAITPVLTKLQTQMLSDPVGRQILRERPRITSTS
COQ4_PICST       MFLGSSVGAYTHPERN-EFIVALGESTAITPVLRRLQHQMLSDPVGRQILRERPRMTSTS
COQ4_CLAL4       MFIGSGLGSFFHPENN-ANIVALGESTAIEPVLRKLQRQMLSDPVGRQILREKPRMTSTS
COQ4_PICGU       MMAGSSIGSYLHPERN-EFIVGLGESTAFTPVLRRLQRQMLSDPVGRQILRERPRITSES
COQ4_KOMPG       MFLGSSIGAFVNPTNN-NFIVSLGESTAFPWVLNRLRTQMLNDPSGRQILKERPHMTSKS
COQ4_ASPFN       LAVGSAVGALLNPRRA-DLIAACGEATATPYFIYRLRDAMLSDPTGRQILRERPRITSET
COQ4_ASPOR       LAVGSAVGALLNPRRA-DLIAACGEATATPYFIYRLRDAMLSDPTGRQILRERPRITSET
COQ4_ASPNC       LAVGSAVGALLNPRRA-DLIAACGEATATPYFIYRLRDAMLSDPTGRQILRDRPRITSET
COQ4_ASPTN       LAVGSAVGALMNPRRA-DLIAACGEATATPYFIYRLRDAMLSDPTGRQILRDRPRITSTT
COQ4_EMENI       LAVGSAVGALLNPRRA-DLIATLGEVTATPYFIYRLRDAMLQDPTGRQILRDRPRITSQT
COQ4_ASPFC       LAVGSAVGSLMNPRRA-DLIAALGEATATPYFIYRLRDAMLSDPTGRRILRDRPRITSET
COQ4_ASPFU       LAVGSAVGSLMNPRRA-DLIAALGEATATPYFIYRLRDAMLSDPTGRRILRDRPRITSET
COQ4_NEOFI       LAVGSAVGSLMNPRRA-DLIAALGEATATPYFIYRLRDAMLSDATGRRILRDRPRITSET
COQ4_ASPCL       LAVGSAVGSLLNPRRA-DLIAACGEATATPYFIYRLRDAMLSDPTGRRILRDRPRITSET
COQ4_PENRW       LALGSAIGSLINPRRA-DLIAALGEATATPFFIYRLRDAMLSDPTGRRILRDRPRITSET
COQ4_TALMQ       LAIGSAFGSLINPYRH-DLIAALGEATATPYFIYRLRDAMLSNPTGRRILRDRPRITSET
COQ4_TALSN       LAIGSAFGSLLNPRRH-DLIAALGEATATPYFIYRLRDAMLSSPTGRRILRDRPRLTSET
COQ4_COCIM       LAIGSAVGSLLNPRRG-DLIATVGETTATPFFIYRLRDAMLADPTGRRILRDRPRITSQT
COQ4_COCP7       LAIGSAVGSLLNPRRG-DLIATVGETTATPFFIYRLRDAMLADSTGRRILRDRPRITSQT
COQ4_UNCRE       LAIGSAVGSLLNPRRG-DLIATLGETTATPFFIYRLRDAMLSNPTGRRILRDRPRITSQT
COQ4_ARTOC       MAVGSAIGSLLNPRRH-DLIATLGETTATPYFIYRLRDAMLSDPTGRRILRDRPRITSQT
COQ4_AJECG       LAVGSAIGSLINPRRA-DLIAALGEATATPYFIYRLRDVMLSDPTGRRILRNQPSINSQT
COQ4_AJECN       LAVGSAIGSLINPRRA-DLIAALGEATATPYFIYRLRDVMLSDPTGRRILRNKPSINSKT
COQ4_AJEDR       LAVGSAIGSLLNPRRG-DLIAALGEATATPYFIYRLRDAMLSDPTGRRILRDRPRISSKT
COQ4_BLAGS       LAVGSAIGSLLNPRRG-DLIAALGEATATPYFIYRLRDAMLSDPTGRRILRDRPRISSKT
COQ4_PARBD       LAVGSAIGSLLNPRRA-DLIAALGEATATPYFIYRLRDAMLSNPTGRRILRDRPRISSKT
COQ4_PARBP       LAVGSAIGSLLNPRRA-DLIAALGEATATPYFIYRLRDAMLSNPTGRRILRDRPRISSKT
COQ4_PARBA       LAVGSAIGSLLNPRRA-DLIAALGEATATPYFIYRLRDAMLSNPTGRRILRDRPRISSKT
COQ4_BOTFB       LAVGSAVMAFFNPYRA-DLIAACGEATATPYFIYRLRDAMLSSPTGRRILRDRPRISSKT
COQ4_SCLS1       LAVGSAIMAFFNPYRA-DLIAACGEATATPYFIYRLRDAMLSSPTGRRILRDRPRISSKT
COQ4_PHANO       LAVGSGLGSFLDPRRA-DLIASFGEATAQPHFIYKLRDRMLLNPTGRRILRDRPRLTSTS
COQ4_PYRTR       LALGSGIGSFLDPQRG-DLIASFGEATAQPYFIYKLRDRMLLNPTGRRILRDRPRLTSTS
COQ4_MAGO7       LAVGSGLWSLLDPRRG-DLIAAFAEATATPYFVPRLRDAMLASPTGRRILRDRPRITSSS
COQ4_NEUCR       LFVGSGLISLADPLRG-DLIASFAEATATPYFIYRLRDAMLSHPTGRRILRQRPRITSQS
COQ4_PODAN       LAIGSGLISLKNPRRG-DLIATFAETTSTPYFIYRLRDAMLSSPTGRRILRDRPRITSTS
COQ4_YARLI       LAVGSGFGTFFDSRRG-DLVATLGEATAQPYFIYKLREQMLKDPTGRRLLREQPRMTSKS
COQ4_SCHPO       LVAGSAIMGLKAPWRGGDMISVLGDASGQPFFLHRLLNKMLVDKTGREILKDKPRMTSKS
COQ4_SCHJY       LVAGSAIMGLKAPWRG-DMIAVLGDASGQPFFLRRLRDKMLANETGRRILKEQPRMTSKS
COQ4_COPC7       LTAGAAYMSITDPRRG-DMVAALGETTAGPT-VSWLRDQMLASPEGRQILKDRPRITSST
COQ4_LACBS       LAVGSAFMSLADPRRG-DMVAALGETTAGPT-LPSLRDRMLDSIEGRRVLMQRPRVNSST
COQ4_CRYNJ       LAVGSGVVGVLDVTRG-DLIASLSEST-AGIFLPALHEKMKMTPEGRQIMKDRPEITNK-
COQ4_LEIIN       -----------------------------------MKNCMMADQRGRSILKHQPVVGDEA
COQ4_LEIMA       -----------------------------------MKNCMMADQRGRSILQYQPIVGDEA
COQ4_LEIBR       -----------------------------------MKNCMMADQRGRSILKHQPVVGDEV
COQ41_TRYCC      AFVAATTRSIWDPVNA--DDVAAVGEITALTALGHMKQSMMSDRTGRMILRTQPRVTDET
COQ42_TRYCC      AFLAATTRSIWDPVNA--GDVAAVGEITALTALEHMKQSMMSDRTGRMILRTQPRVTDET
COQ4_TRYB2       AFVTSSFGAIVDPEDG--RGSAAFAEITALTALHHMQRLMMADEMGRSILKERPQVTDET
COQ4_PLACH       IFLKTISGIYKAPNRT--HLLAHAADISSFYAVKNIYEYMKNDDEGKVILKNKPLLIRQD
COQ4_PLAYO       IFLKTILGIYKAPNRT--HLLAHAADISSFYAVKNIYEYMKNDDEGKEILKNKPLLIRQD
COQ4_PLAKH       IFLKTILRIYKTPART--HLLAHAADISAIYAVREIYNYMKNDEEGRIILKEKPLLIRQD
COQ4_PLAVS       IFLKTILRIYKTPART--HLLAHAADISAIYAVRQIYNYMKNDEEGRTVLKEKPLLIRQD
COQ4_PLAF7       IFLKTIFRIYSSPGRT--HLLAHAADISAKYAVRKIYEYMRTDEEGIRILKEKPLLIRQD
COQ4_CRYPI       LSVTSCVEGLKNPTDS-NSVACITELTS-NRALRRLQILMNSTPDGRRIIKNRPLIDSSK
                                                    :   *     *  ::  :* :    

COQ41_PARTE      FKVEELLKLNQNTFGQHSSLIQSYQYGKFMRDRDFSSSERPIVKYIPDLELAYVYQRYKE
COQ42_PARTE      FKIEELLKLDENTFG--------HQYGKFMKDRDFSSGERPIVKYIPDLELAYVYQRYKE
COQ4_DICDI       YPLNIHLLPSTTFGG---------AYYRWMKEHGYSPDERTEVTLIQDEDDAYVMQRYRE
COQ4_MOUSE       LDLSKLQSLPEGSLG--------REYLRFLDVNKVSPDTRAPTRFVDDEELAYVIQRYRE
COQ4_RAT         LDLSKLQSLPEGSLG--------REYLRFLNANKVSPDTRAPTRFVDDEELAYVIQRYRE
COQ4_HUMAN       LDLGKLQSLPEGSLG--------REYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYRE
COQ4_XENLA       LDMQALREMQDGTLG--------REYARFLDVNRVTPDTRMPVKFVDDEELAYVAQRYRE
COQ4_XENTR       LDFQTLREMPDGTFG--------REYARFLDVNHVTPDTRMPVKFVDDEELAYVAQRYRE
COQ4_DANRE       LDLSNMSALPDGTLG--------REYLRFLEENRVTPDTRAEVKFVDNEELAYVMQRYRE
COQ4_DROSE       IDFKYLETLPPDTFG--------AAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROSI       IDFKYLETLPPDTFG--------AAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROME       IDFKYLETLPPDTFG--------AAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROYA       IDFKYLETLPPDTFG--------AAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROER       IDFKYLETLPPDTFG--------AAYVKFLKDNQVTPDSRMAVRFLEEPKLAYLMTRYRE
COQ4_DROAN       IDFKLLESLPADSFG--------AAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROPE       IDFKRLESLPADTFG--------AAYVKFLKDNKVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROPS       IDFKRLESLPADTFG--------AAYVKFLKDNKVTPDSRMAVRFLEDPKLAYLMTRYRE
COQ4_DROWI       IDFKRLETLPPDTFG--------AAYVKFLKDNNVTPDSRMPVRFLEDPKLAYLMTRYRE
COQ4_DROGR       IDLKRLEAMPPDTFG--------ATYAKFLKDNNVTPDTRMEVHFLDDPKLAYVMTRYRE
COQ4_DROMO       IDLKSLEALPSDSFG--------FAYAKFLKDNNVTPDSRMEVRFLEDPKLAYIMTRYRE
COQ4_DROVI       IDFKRLEALPPNTFG--------ATYAKFLKDNKVTPDSRMEVRFLEDPKLAYIMTRYRE
COQ4_AEDAE       VNMDALKKLPENTFG--------YQYVSFMEKYEITPDSRMEVKFMDDPELAYVMTRYRE
COQ41_CULQU      VDMAALKALPETSFG--------HQYVHFLEKHDITPDSRAEVRFMDDPELAYVMTRYRE
COQ4_ANOGA       VDMEALKKMPEHTFG--------YTYVKFMEDNNITPDSRMEVRFLDEPGLAYVMTRYRE
COQ4_BOMMO       IAFETLSQMPENSLG--------RVYADFMKDNNITADSRLPVQFIADPELAYVMQRYRE
COQ4_CAEEL       IDRKWLRQLPDGTLG--------KLYSNFLDRLNTSPDARPTVKYIDNLEHLYVMQRYRE
COQ4_YEAST       LHMDKLAKLPHNTFG--------YVYYQWLKRENVSPDTRAPVKFIDDPMHAYIFKRYRQ
COQ4_YEAS1       LHMDKLAKLPHNTFG--------YVYYQWLKRENVSPDTRAPVKFIDDPMHAYISKRYRQ
COQ4_YEAS7       LHMDKLAKLPHNTFG--------YVYYQWLKRENVSPDTRAPVKFIDDPMHAYIFKRYRQ
COQ4_YEAS6       LHMDKLAKLPHNTLG--------YVYYQWLKRENVSPDTRAPVKFIDDPMHAYIFKRYRQ
COQ4_CANGA       LDMDKLSKLPKNTFG--------YTFYKWLEKEKVSPDTRAPVTYIDDPIHAFVFKRYRQ
COQ4_LACTC       LDMDRLKKMAPNTLG--------HSYYKWLIKEGVSPDTRAPVKYIDDPTHAYIFKRYRQ
COQ4_ZYGRC       LDMDRLKKMDKNSLG--------YTYYTWLITEGVSPDTRAPVKYIDDPLQAFIFKRYRQ
COQ4_VANPO       LDMDKLSKMPKNTFG--------YTFYSWLKKEGVSPDTRAPVKYIDDPDHAFIFKRYRQ
COQ4_ASHGO       LDMDKLAQLPTNTLG--------HTFYRWLRKEGVTPDTRAPVTYIDDPVHAYIFKRYRQ
COQ4_KLULA       LDMERLSKMDKNSVG--------YTYYKWLMKEGVSPDTRAPVTYIDDPVHAFIFKRYRQ
COQ4_CANAW       LNLTYLRSLPDNTIG--------KNYVNWLDKEHVSPDTRVAVRYIDNEELAYIYQRYRE
COQ4_CANAL       LNLTYLRSLPDNTIG--------KNYVNWLDKEHVSPDTRVAVRYIDNEELAYIYQRYRE
COQ4_CANDC       LNLTYLRSLPDNTIG--------KNYVNWLDKENVSPDTRVPVRYIDNEELAYIYQRYRE
COQ4_CANTT       LNLDYLRSLPDNTIG--------KNYINWLDKEGVSPDTRVQVKYIDNEELSYIFQRYRE
COQ4_LODEL       LDLDYLRSLPDNTIG--------KSYITWLDREGVSPDTRVPVRYIDNEELAYIFQRYRE
COQ4_DEBHA       LDLDKLRELPDNTIG--------KTYVNWLDREGVSPDTRVPVKYIDDEELAYIYQRYRE
COQ4_PICST       LDLEHLRELPDNTIG--------KTYVKWLDKEGVSPDTRVEVKYIDNEELAYIYQRYRE
COQ4_CLAL4       LNLDHLRALPKNTLG--------HTYVSWLDREGVSPDTRVPVRFIDNEELAYIYQRYRE
COQ4_PICGU       LDLDYLRSLPKNTIG--------SAYIQWLDREGVSPDTRVPVRYIDDEELAYIYQRYRE
COQ4_KOMPG       LNLDELKNYPDNSLG--------KSYFLWLEREGVSPDTRVPVKYITDPELAFVFQRYRE
COQ4_ASPFN       LPLPYLRSLPENSVG--------RTYAAWLDREGVSPDTRDNVQYIDDEECAYVMQRYRE
COQ4_ASPOR       LPLPYLRSLPENSVG--------RTYAAWLDREGVSPDTRDNVQYIDDEECAYVMQRYRE
COQ4_ASPNC       LKLPYLRSLPENTVG--------RTYATWLDREGVSPDTRDNVQYIDDEECAYVMQRYRE
COQ4_ASPTN       LPLPYLRSLPENSVG--------RTYAAWLDREGVSPDTRDEVKYIDDEECAYVMQRYRE
COQ4_EMENI       LPLPYLRSLPENSVG--------RTYATWLDREGVSPDTRDNVQYIDDPECAYVMQRYRE
COQ4_ASPFC       LKLPYLRTLPENSVG--------RTYATWLDREGVSPDTRNSVKYIDDEECAYVMQRYRE
COQ4_ASPFU       LKLPYLRTLPENSVG--------RTYATWLDREGVSPDTRNSVKYIDDEECAYVMQRYRE
COQ4_NEOFI       LKLPYLRTLPENSVG--------RTYATWLDREGVSPDTRDSVKYIDDEECAYAMQRYRE
COQ4_ASPCL       LPMSYLRSLPENSVG--------RTYATWLDREGVSPDTRNSVKYIDDEECAYVMQRYRE
COQ4_PENRW       LNMTHLRTLPENSVG--------RTYAKWLDREGVSPDTRDNVQYIDNEECAYVMQRYRE
COQ4_TALMQ       LKLPYLRNLPENSVG--------WTYAKWLDKEGVTPDSRDSVQYIDDEECAYVMQRYRE
COQ4_TALSN       LKLPYLRSLPENSVG--------RTYAKWLDREGVSPDTRDSVQYIDDEECAYVMQRYRE
COQ4_COCIM       LSLPYLRSLPKNTVG--------YTYATWLDREGVSPDTRSSVQYIDDEECAYVMQRYRE
COQ4_COCP7       LSLPYLRNLPKNTVG--------YTYATWLDREGVSPDTRSSVQYIDDEECAYVMQRYRE
COQ4_UNCRE       LSLPYLRSLPPNTVG--------YTYAAWLDREGVSPDTRSSVQYIDDEECAYVMQRYRE
COQ4_ARTOC       LSLPYLRSLPPTSLG--------ATFASWLDREGVSPDTRSRVRYIDDEECAYVMQRYRE
COQ4_AJECG       LSVEYLRSLSPNTVG--------RTYVDWLDREGVGPDTRAKVQYIDDKECAYVMQRYRE
COQ4_AJECN       LSVEYLRSLSPNTVG--------RTYVDWLDREGVGPDTRAKVQYIDDKECAYVMQRYRE
COQ4_AJEDR       LSIEYLRSLPPNTVG--------RTYVGWLDREGVGPDTRAPVQYIDDEECAYVMQRYRE
COQ4_BLAGS       LSIEYLRSLPPNTVG--------RTYVGWLDREGVGPDTRAPVQYIDDEECAYVMQRYRE
COQ4_PARBD       LSVEYLRSLPPNSVG--------RTYVNWLDREGVGPDSRETVRYIDDEECAYVMQRYRE
COQ4_PARBP       LSVEYLRSLPPNSVG--------RTYVSWLDREGVGPDSRETVRYIDDEECAYVMQRYRE
COQ4_PARBA       LSVEYLRSLPPNSVG--------RTYVSWLDREGVGPDTRETVRYIDDEECAYVMQRYRE
COQ4_BOTFB       LSMPRLRALPPNTVG--------RCYAEWLDREGVSPDTRDSVKYIDDEECAYVMQRYRE
COQ4_SCLS1       LSMQHLRTLPTNAVG--------RCYADWLDREGVSPDTRDSVKYIDDEECAYVMQRYRE
COQ4_PHANO       LDIPRLRQLPPNTLG--------YVYALWLDREGVSPDTRATVQYIDDEECAYVMQRYRE
COQ4_PYRTR       LDIPRLRNLPPNTVG--------YAYAAWLDREGVSPDTRAAVQYIDDEECAYVMQRYRE
COQ4_MAGO7       LDLPRLRSLPQGTVG--------ATYVAWLDREGVTPDTRAHVRYVDDEECAYVLQRYRE
COQ4_NEUCR       LNIPYLRSLPPNTVG--------RTYIDWLDREGVSPDTRSAVRYIDDEECAYVMQRYRE
COQ4_PODAN       LNLPYLRSLPPNTVG--------HTYISWLDREGVSPDTRSPVRYIDDEECAYVMQRYRE
COQ4_YARLI       LDLDKLRNMKVGSIG--------RTYVEWLDKEGVSPDTRAQVRYIDDPECAYVMQRYRE
COQ4_SCHPO       LNLPFLRTLPPNTLG--------KIYVDWIDKEHVGPDTRSPTRFVDDPEEAYVMQRYRE
COQ4_SCHJY       LNLPHLRTLPPNTLG--------RIYVDWIDKEHVTPDSRAPTRYVDDPEEAYVMQRYRE
COQ4_COPC7       VDMDKLAQMPEGTFG--------RAYINWLERCGVTPDTREPVHYIDDPELAYVMQRYRE
COQ4_LACBS       IDLNKLAHYPEGTFG--------RAYVTWLERCGVTPDTREPVHYIDDPELAYVMQRYRE
COQ4_CRYNJ       -TIEKLKELKRGTLG--------REYVEWLGGGGLEPESRAPVQYIDSPLLAYTMLRYRQ
COQ4_LEIIN       LEFSR--GLAPSTFG--------FRYAAYMDRNHFLPSGRTAVKHIADPTLAYVMTRYRQ
COQ4_LEIMA       LEFSR--GLAPSTFG--------FRYAAYMDRNHFLPSGRTAVKHIADPTLAYVMTRYRQ
COQ4_LEIBR       LEFSR--GLAPSTFG--------FRYAAYMDRNHFLPSGRAAVKHIADPTLAYVMMRHRQ
COQ41_TRYCC      LEFAS--RQPPGTFG--------HRYAQFMKFNRFTPNGRTPVAHIADPTLAYVMQRQRE
COQ42_TRYCC      LEFAS--RQPPGTFG--------HRYAQFMKFNRFTPNGRTPVAHVADPTLAYVMQRQRE
COQ4_TRYB2       LEFAK--TQPEGTFG--------YRYAAFMKRNNFLPSGRAPILHVSDPTLAYVMLRYRQ
COQ4_PLACH       IQFNELKKLPKNTLG--------YKYMEFLEAYKLHAHDREAAHFFDDINYSYILTRYRQ
COQ4_PLAYO       IQFNELKKLPKNTLG--------YKYMEFLETYKLHAHDREVAHFFDNINYSYILTRYRQ
COQ4_PLAKH       IQFNELKKLPKNTLG--------YKYMEFLETYKLHAHDREVSHFFTDLNYSYILTRYRQ
COQ4_PLAVS       IQFNELKKLPKNTLG--------YKYMKFLETYKLHAHDREVSHFFTDLNYSYILTRYRQ
COQ4_PLAF7       ICFNELKKLPKNTLG--------YKYMEFLETYKLHAHDREVSHFIKDINESYILTRYRQ
COQ4_CRYPI       YSIKDLMAFPDDSLG--------RRYGEFLTTYNLEIN-RDPVRYVNSEDLAYVLTRFRQ
                               *          :  ::         *     . .    :   * ::

COQ41_PARTE      IHDFIHVLLMYDVSVYDEIVVKWYEMAQLGLPSATLSAFVGSFK----------------
COQ42_PARTE      IHDFIHVLLMYDVSVYDEIVVKWFEMAQLGLPSATLSAFVGSFK----------------
COQ4_DICDI       VHDFWHVLAGVRPDFQGEVAIKWFEFLQTGLPMNAIGSIIGPLR----------------
COQ4_MOUSE       VHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPIR----------------
COQ4_RAT         VHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPVR----------------
COQ4_HUMAN       VHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIR----------------
COQ4_XENLA       VHDLMHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGAAFGPLR----------------
COQ4_XENTR       VHDLMHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGAAFGPLR----------------
COQ4_DANRE       VHDLLHTLLGMPTNMLGEVAVKWFEAAQTGLPMCILGAALGPLR----------------
COQ4_DROSE       CHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROSI       CHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROME       CHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROYA       CHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROER       CHDLIHTVLDMPTNMLGEVSVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROAN       CHDLIHTVLGMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROPE       CHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROPS       CHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROWI       CHDLIHTVLNMPTNMLGEVAVKWVEALNTNLPMCYGGAVFGAVR----------------
COQ4_DROGR       CHDLVHAVLNMPTNMLCEVTVKWVEALNTGLPMCYGGAVFGAVR----------------
COQ4_DROMO       CHDLVHAVLDMPTNMLCEVTVKWVEALNNGLPMCYGAAVFGAVR----------------
COQ4_DROVI       CHDLVHAALDMPTNMLCEVAVKWVEALNTGLPMCYGAAVFGAVR----------------
COQ4_AEDAE       THDLVHTVFGMPTNMLGEVAIKWVEAINIGLPMCYGGAIFGAFR----------------
COQ41_CULQU      VHDLVHTVLGMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGA------------------
COQ4_ANOGA       THDMVHAILDMPTNMLGEVTVKWVEALNTGLPMCYGGAVFGAFR----------------
COQ4_BOMMO       VHDLVHASLFMKTNMLGEVTVKWVEGIQTKLPMCIGGGIWGAAR----------------
COQ4_CAEEL       THDFTHIALEQKTNMLGEVTVKYFEGIQYGLPMCVTGGIFGGAR----------------
COQ4_YEAST       CHDFYHAITNMPIIIEGEITIKALEGANLGVPMAILGGILAPLR----------------
COQ4_YEAS1       CHDFYHAITNMPIIIEGEITIKALEGANLGVPMAILGGILAPLR----------------
COQ4_YEAS7       CHDFYHAITNMPIIIEGEITIKALEGANLGVPMAILGGILAPLR----------------
COQ4_YEAS6       CHDFYHAITNMPIIIEGEITIKALEGANLGVPMAILGGILAPLR----------------
COQ4_CANGA       CHDFYHALNDLPIIIEGEIIVKALESANMGIPMATLGWMLAPLR----------------
COQ4_LACTC       CHDFYHAVNDLPIIIEGEIAVKALEAANIGVPMAALGALLAPLR----------------
COQ4_ZYGRC       CHDFYHAINGLPIIIEGEIAIKALEAANMGIPMAALGALLAPLR----------------
COQ4_VANPO       CHDFYHSLNDLPIIIEGEIAVKALEAANMGIPMAALGTLLAPLR----------------
COQ4_ASHGO       CHDFYHAITGLPIIIEGEIAVKALEAANIGVPMAALGALLAPLR----------------
COQ4_KLULA       CHDFYHAINDLPIIIEGEIAVKAFEASNIGVPMAALGALLAPLR----------------
COQ4_CANAW       CHDFYHAITGLPIIIEGEIAVKVFEFANIGIPMSGLGALFAPLR----------------
COQ4_CANAL       CHDFYHAITGLPIIIEGEIAVKVFEFANIGIPMSGLGALFAPLR----------------
COQ4_CANDC       CHDFYHAITGLPIIIEGEIAVKVFEFANIGIPMSGLGALFAPLR----------------
COQ4_CANTT       CHDFYHAITGLPIIIEGEISVKVFEFMNIGIPMTGLGALFAPLR----------------
COQ4_LODEL       CHDFYHAITGLPIIIEGEISVKVLEYMNIGIPMSGLGALFAPLR----------------
COQ4_DEBHA       CHDFYHSITGLPIIIEGEIAVKILEFMNIGIPMSGLGALFAPLR----------------
COQ4_PICST       CHDFYHAITGLPIIIEGEISVKVFEYMNIGIPMSGLGALFAPLR----------------
COQ4_CLAL4       CHDFYHAITGLPIIIEGEIAVKVLEFMNMGILMPGLGALLAPLR----------------
COQ4_PICGU       CHDFYHAITGLPIIIEGEIAVKVLEFTNIGIPMSGLGGLFAPLR----------------
COQ4_KOMPG       CHDFYHTITGLPIVREGEIALKLFEFMNLGIPMTGLGALFAPIP----------------
COQ4_ASPFN       CHDFYHAVTGLPTFVEGEIALKAFEFLNTLIPMTGLSM-FAAVR----------------
COQ4_ASPOR       CHDFYHAVTGLPTFVEGEIALKAFEFLNTLIPMTGLSM-FAAVR----------------
COQ4_ASPNC       CHDFYHAVTGLPIFVEGELALKAFEFLNTLIPMTGLSL-FASVR----------------
COQ4_ASPTN       CHDFYHAVTGLPIFVEGELALKAFEFLNTLIPMTGLSM-FAAVR----------------
COQ4_EMENI       CHDFYHAVTGLPTFVEGELALKAFEFLNTLIPMTGLSM-AASVR----------------
COQ4_ASPFC       CHDFYHAVTGLPTFVEGELALKAFEFLNTLIPMTGLSI-FAFVR----------------
COQ4_ASPFU       CHDFYHAVTGLPTFVEGELALKAFEFLNTLIPMTGLSI-FAFVR----------------
COQ4_NEOFI       CHDFYHAVTGLPIFVEGELALKAFEFLNTLIPMTGLSI-FAFVR----------------
COQ4_ASPCL       CHDFYHAVTGLPIFVEGELALKAFEFLNTLIPMTGLSI-FAFVR----------------
COQ4_PENRW       CHDFYHAVTGLPIFVEGELALKALEFLNTLLPMTGLSL-FAFVR----------------
COQ4_TALMQ       CHDFYHAVTGLPTMVEGELALKAFEFLNTVLPMTGLSL-AAVVR----------------
COQ4_TALSN       CHDFYHAVTGLPTMVEGELALKAFEFLNTVIPMTGLSL-AAAIR----------------
COQ4_COCIM       CHDFYHAVTGLPIVVEGEIALKAFEFMNTLIPMTGLSV-FAAIR----------------
COQ4_COCP7       CHDFYHAVTGLPIVVEGEIALKAFEFMNTLIPMTGLSV-FAAIR----------------
COQ4_UNCRE       CHDFYHAVTGLPIMVEGEIALKAFEFLNTLIPMTGLSV-FAAVR----------------
COQ4_ARTOC       CHDFYHAVTGLPIVVEGELALKIFEYMNTGLPMTGLSA-AAVVR----------------
COQ4_AJECG       CHDFYHAITGLPVVVEGEIALKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_AJECN       CHDFYHAITGLPVVAEGEIALKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_AJEDR       CHDFYHAITGLPVVVEGEVALKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_BLAGS       CHDFYHAITGLPVVVEGEVALKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_PARBD       CHDFYHAVTGLPIVVEGEVALKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_PARBP       CHDFYHAVTGLPIVVEGEVALKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_PARBA       CHDFYHAVTGLPIVVEGEVSLKTFEFANTLLPMTGLSM-FAVMR----------------
COQ4_BOTFB       CHDFYHAITGLPIVREGEVALKAFEFANTLLPMTGLSM-FAVMS----------------
COQ4_SCLS1       CHDFYHAITGLPIVREGEVALKAFEFANTLLPMTGLSM-FAVMS----------------
COQ4_PHANO       CHDFYHALVGLPVFREGEVALKAFEFANTGLPMTGLAV-FSAFT----------------
COQ4_PYRTR       CHDFYHALVGLPVFREGEVALKAFEFANTGLPMTGLAV-FSAFT----------------
COQ4_MAGO7       SHDFYHALTALPVVREGEVALKAFEFANTLLPMTGLAT-FAAFT----------------
COQ4_NEUCR       CHDFYHALTGLPIVREGEVALKAFEFANTLLPMTGFSV-FAAFT----------------
COQ4_PODAN       CHDFYHALTGLPVVREGEVALKAFEFANTLLPMTGLSV-FSLVG----------------
COQ4_YARLI       SHDFYHALTGLPIIMEGELALKAFEWANTGLPMSGLGMVLTPLK----------------
COQ4_SCHPO       SHDFYHAICNMPTNIEGELAIKWLEFVNMGLPVGALSALFGPLR----------------
COQ4_SCHJY       CHDFFHAVSQMPTNIEGELAIKWLEFINMGLPVGALSALFGPLR----------------
COQ4_COPC7       CHDFYHCICNMPVNVESELAVKYFEFANLGLPMAGLAALFGPLR----------------
COQ4_LACBS       CHDFYHCICNLPVNVESELALKYFEFANLGLPMTLLSALVGPVR----------------
COQ4_CRYNJ       THDLYHTLFSLPPTLPHELSLKVLEFSNMSLPVALLSSVFGPLR----------------
COQ4_LEIIN       CHDFVHIITGCGRSIEEELAVKIFEWKHTGLPLGLLSLLGGAPR----------------
COQ4_LEIMA       CHDFVHIITGCGRSIEEELAVKIFEWKHTGLPLGLLSLLGGAPR----------------
COQ4_LEIBR       CHDFLHVITGCGRSVEEELAVKVFEWKHTGLPLGLLSLLGGASR----------------
COQ41_TRYCC      THDFLHTCIGCGRTVEEEIIVKLLEWRHTGLPIGLLAVIGSLPW----------------
COQ42_TRYCC      THDFLHTCIGCGRTVEEEIIVKLLEWRHTGLPIGLLAVIGSLPW----------------
COQ4_TRYB2       IHDFVHAYVGLGRTIEEELAVKLFEWQHTGLPVGLMAVLGGMPW----------------
COQ4_PLACH       IHDIGHVVYNLNISIESEAALKMIELIHTKLPITLLAILVAPFMTPLYRFQYIFKDKIPP
COQ4_PLAYO       IHDIGHVVYNLNISIESEAALKMIELIHTKLPITLLAILVAPFMSPLYRFQYIFKDKIPP
COQ4_PLAKH       IHDIGHVVYNLNISIESEAALKVIELVQTKLPITALAILIAPLMTPLYRFQYIFKDSIPS
COQ4_PLAVS       IHDIGHVVYNLNISIESEAALKLIELVQTKLPITLLAILVAPFMTPIYRFQYIFKDSLPS
COQ4_PLAF7       IHDIAHVVYNLNISIEAEAALKLIELIQTKLPITLLAILIAPFMTPLYRFQYIFEHNIPS
COQ4_CRYPI       IHDILHTAFELNITVESEVTLKLFEFLHAGIPFGAIGAFMGLFITPILKVR---------
                  **: *           *  :*  *  :  :     .                       

COQ41_PARTE      ------------------------------------------------------------
COQ42_PARTE      ------------------------------------------------------------
COQ4_DICDI       ------------------------------------------------------------
COQ4_MOUSE       ------------------------------------------------------------
COQ4_RAT         ------------------------------------------------------------
COQ4_HUMAN       ------------------------------------------------------------
COQ4_XENLA       ------------------------------------------------------------
COQ4_XENTR       ------------------------------------------------------------
COQ4_DANRE       ------------------------------------------------------------
COQ4_DROSE       ------------------------------------------------------------
COQ4_DROSI       ------------------------------------------------------------
COQ4_DROME       ------------------------------------------------------------
COQ4_DROYA       ------------------------------------------------------------
COQ4_DROER       ------------------------------------------------------------
COQ4_DROAN       ------------------------------------------------------------
COQ4_DROPE       ------------------------------------------------------------
COQ4_DROPS       ------------------------------------------------------------
COQ4_DROWI       ------------------------------------------------------------
COQ4_DROGR       ------------------------------------------------------------
COQ4_DROMO       ------------------------------------------------------------
COQ4_DROVI       ------------------------------------------------------------
COQ4_AEDAE       ------------------------------------------------------------
COQ41_CULQU      ------------------------------------------------------------
COQ4_ANOGA       ------------------------------------------------------------
COQ4_BOMMO       ------------------------------------------------------------
COQ4_CAEEL       ------------------------------------------------------------
COQ4_YEAST       ------------------------------------------------------------
COQ4_YEAS1       ------------------------------------------------------------
COQ4_YEAS7       ------------------------------------------------------------
COQ4_YEAS6       ------------------------------------------------------------
COQ4_CANGA       ------------------------------------------------------------
COQ4_LACTC       ------------------------------------------------------------
COQ4_ZYGRC       ------------------------------------------------------------
COQ4_VANPO       ------------------------------------------------------------
COQ4_ASHGO       ------------------------------------------------------------
COQ4_KLULA       ------------------------------------------------------------
COQ4_CANAW       ------------------------------------------------------------
COQ4_CANAL       ------------------------------------------------------------
COQ4_CANDC       ------------------------------------------------------------
COQ4_CANTT       ------------------------------------------------------------
COQ4_LODEL       ------------------------------------------------------------
COQ4_DEBHA       ------------------------------------------------------------
COQ4_PICST       ------------------------------------------------------------
COQ4_CLAL4       ------------------------------------------------------------
COQ4_PICGU       ------------------------------------------------------------
COQ4_KOMPG       ------------------------------------------------------------
COQ4_ASPFN       ------------------------------------------------------------
COQ4_ASPOR       ------------------------------------------------------------
COQ4_ASPNC       ------------------------------------------------------------
COQ4_ASPTN       ------------------------------------------------------------
COQ4_EMENI       ------------------------------------------------------------
COQ4_ASPFC       ------------------------------------------------------------
COQ4_ASPFU       ------------------------------------------------------------
COQ4_NEOFI       ------------------------------------------------------------
COQ4_ASPCL       ------------------------------------------------------------
COQ4_PENRW       ------------------------------------------------------------
COQ4_TALMQ       ------------------------------------------------------------
COQ4_TALSN       ------------------------------------------------------------
COQ4_COCIM       ------------------------------------------------------------
COQ4_COCP7       ------------------------------------------------------------
COQ4_UNCRE       ------------------------------------------------------------
COQ4_ARTOC       ------------------------------------------------------------
COQ4_AJECG       ------------------------------------------------------------
COQ4_AJECN       ------------------------------------------------------------
COQ4_AJEDR       ------------------------------------------------------------
COQ4_BLAGS       ------------------------------------------------------------
COQ4_PARBD       ------------------------------------------------------------
COQ4_PARBP       ------------------------------------------------------------
COQ4_PARBA       ------------------------------------------------------------
COQ4_BOTFB       ------------------------------------------------------------
COQ4_SCLS1       ------------------------------------------------------------
COQ4_PHANO       ------------------------------------------------------------
COQ4_PYRTR       ------------------------------------------------------------
COQ4_MAGO7       ------------------------------------------------------------
COQ4_NEUCR       ------------------------------------------------------------
COQ4_PODAN       ------------------------------------------------------------
COQ4_YARLI       ------------------------------------------------------------
COQ4_SCHPO       ------------------------------------------------------------
COQ4_SCHJY       ------------------------------------------------------------
COQ4_COPC7       ------------------------------------------------------------
COQ4_LACBS       ------------------------------------------------------------
COQ4_CRYNJ       ------------------------------------------------------------
COQ4_LEIIN       ------------------------------------------------------------
COQ4_LEIMA       ------------------------------------------------------------
COQ4_LEIBR       ------------------------------------------------------------
COQ41_TRYCC      ------------------------------------------------------------
COQ42_TRYCC      ------------------------------------------------------------
COQ4_TRYB2       ------------------------------------------------------------
COQ4_PLACH       NFLNPNFDYTYKDDYNYIDELSLKQYVYNLTEYFHIDKIDNNIFFQKLYKYYFDNLNNSN
COQ4_PLAYO       NFLNPNFDYTYXDDYNYIDELSLKQYVYNLTEYFHIDKINNNLFFQKLYKYYFDNLNNSN
COQ4_PLAKH       NFLTPNFDYTYNDAYNYVDELSIKQYEYNLTDYFHVDKRDDQKFYSKMYQYYLDNINNSS
COQ4_PLAVS       NFLSPNFDFTYTDAYNYVDELSIKQYEYNLTDYFHVEKRNDRNFYTKMYQHYFDNINNSS
COQ4_PLAF7       NFLCPNFDYTYNDDYNYIDEMSLKQYEYYLTDYFHVEKRESQSFYYKLYKYYFDNLNNSS
COQ4_CRYPI       ------------------------------------------------------------
                                                                             

COQ41_PARTE      ---------------------------------------LNCQEK-QKLLETLPEILKRA
COQ42_PARTE      ---------------------------------------LNCQEK-QKLMETLPQILKRA
COQ4_DICDI       ---------------------------------------CSWNERNELINHMIPWAIKSS
COQ4_MOUSE       ---------------------------------------LRTQSLQVLFSELIPWAIQNG
COQ4_RAT         ---------------------------------------LRAQSLQVLFSELIPWAIQNG
COQ4_HUMAN       ---------------------------------------LGAQSLQVLVSELIPWAVQNG
COQ4_XENLA       ---------------------------------------LNNKRMQKL-GVLVPWAVQSG
COQ4_XENTR       ---------------------------------------LNNKRMKKL-GVLVPWAVQSG
COQ4_DANRE       ---------------------------------------LSVSRLQLLGQSLGLWALRNG
COQ4_DROSE       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROSI       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROME       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROYA       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROER       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROAN       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROPE       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROPS       ---------------------------------------LRPKQRRAYLKHYLPWALENG
COQ4_DROWI       ---------------------------------------LRPKQRREYLKRYLPWAIDNG
COQ4_DROGR       ---------------------------------------LRPKQRREYLRRYLPWAIENS
COQ4_DROMO       ---------------------------------------LRPRQRREYLKRYLPWAIENS
COQ4_DROVI       ---------------------------------------LRPRQRREYLKRYLPWAIENG
COQ4_AEDAE       ---------------------------------------LRPKQRQNYLQRYLPWALRAG
COQ41_CULQU      -------------------------------------------QRQNYLRHYLPWALRMG
COQ4_ANOGA       ---------------------------------------LRTKQRQNYLRKYLPWALRTG
COQ4_BOMMO       ---------------------------------------LRPKHRQMYLKYYLPWAIRTG
COQ4_CAEEL       ---------------------------------------LLTKNRQELVDRNLPWVVEQA
COQ4_YEAST       ---------------------------------------LKKVQRKRLYNIYLPWAVRTG
COQ4_YEAS1       ---------------------------------------LKKVQRKRLYNIYLPWAVRTG
COQ4_YEAS7       ---------------------------------------LKKVQRKRLYNIYLPWAVRTG
COQ4_YEAS6       ---------------------------------------LKKVQRKRLYNIYLPWAVRTG
COQ4_CANGA       ---------------------------------------LKKAQRDRLYGTYLPWAIKTG
COQ4_LACTC       ---------------------------------------LKPVQKKRLYDVYLPWAVRTG
COQ4_ZYGRC       ---------------------------------------LKPIQKERLYDIYLPWAIRTG
COQ4_VANPO       ---------------------------------------LKSAQRQRLYEIYLPWAIRTG
COQ4_ASHGO       ---------------------------------------LRAAQRERLRNIYLPWAIETG
COQ4_KLULA       ---------------------------------------LKKVQKERLYSIYLPWAVKAG
COQ4_CANAW       ---------------------------------------LKSSQRQRLREIYYPWAIKNG
COQ4_CANAL       ---------------------------------------LKSSQRQRLREIYYPWAIKNG
COQ4_CANDC       ---------------------------------------LKPSQRQRLREIYYPWAIKNG
COQ4_CANTT       ---------------------------------------LKSSQRKRLREIYYPWAIKNG
COQ4_LODEL       ---------------------------------------LKPSQRKRLREIYYPWAIKNG
COQ4_DEBHA       ---------------------------------------LKPSQKERLYNIYYPWGFKSG
COQ4_PICST       ---------------------------------------LKKSQKERLYNIYYPWAFKSG
COQ4_CLAL4       ---------------------------------------LKPSQRERLYSIYYPWAFRSG
COQ4_PICGU       ---------------------------------------LRPKQRERLYGIYYPWAFKSG
COQ4_KOMPG       ---------------------------------------IKSSQRRRLLSVYYPWAVKNG
COQ4_ASPFN       ---------------------------------------LKPAERERFFALWLPWAVRSG
COQ4_ASPOR       ---------------------------------------LKPAERERFFALWLPWAVRSG
COQ4_ASPNC       ---------------------------------------LKPAERERLFSIYLPWALRSG
COQ4_ASPTN       ---------------------------------------LKPAERERLFSIYLPWAVRSG
COQ4_EMENI       ---------------------------------------LKPAERERLFSLYLPWAVRSG
COQ4_ASPFC       ---------------------------------------LKPAERERFFSLHLPWAVRSG
COQ4_ASPFU       ---------------------------------------LKPAERERFFSLHLPWAVRSG
COQ4_NEOFI       ---------------------------------------LKPAERERFFSLHLPWAVRSG
COQ4_ASPCL       ---------------------------------------LKPAERERFFSLHLPWAVRSG
COQ4_PENRW       ---------------------------------------MKPAEKERFLTLHLPWAIRSG
COQ4_TALMQ       ---------------------------------------LKPAERERFFKLHLPWAVRSG
COQ4_TALSN       ---------------------------------------LKPAERERFFKLHLPWAVRSG
COQ4_COCIM       ---------------------------------------LKPEEKQRFWSIHLPWAIRSG
COQ4_COCP7       ---------------------------------------LKPEEKQRFWSIHLPWAIRSG
COQ4_UNCRE       ---------------------------------------LKPEERQRFWSIHLPWAVRSG
COQ4_ARTOC       ---------------------------------------LKGAERQRFWDVYLPWAVRSG
COQ4_AJECG       ---------------------------------------LKPEEKERFWKLHLPWAVRNG
COQ4_AJECN       ---------------------------------------LKPEEKERFWKLHLPWAVRNG
COQ4_AJEDR       ---------------------------------------LKPAERERFWKLHLPWAIRSG
COQ4_BLAGS       ---------------------------------------LKPAERERFWKLHLPWAIRSG
COQ4_PARBD       ---------------------------------------LKPEERERYWELHLPWAVRSG
COQ4_PARBP       ---------------------------------------LKPEERERYWELHLPWAVRSG
COQ4_PARBA       ---------------------------------------LKPEERERYWKLHLPWAVRSG
COQ4_BOTFB       ---------------------------------------LKPAERRRFFTIYAPWAFANG
COQ4_SCLS1       ---------------------------------------LKPAERRRFFTIYAPWALTNG
COQ4_PHANO       ---------------------------------------LKKAEWRRFWDIYGPWATRNG
COQ4_PYRTR       ---------------------------------------LKKAEWRRFWDIYGPWATRNG
COQ4_MAGO7       ---------------------------------------LREGERRRFVDTYLPWAVKNG
COQ4_NEUCR       ---------------------------------------MKKSEQKRFRKIYFPWAVKNG
COQ4_PODAN       ---------------------------------------MKKKERERFWGVYGPWAVRNG
COQ4_YARLI       ---------------------------------------FKPKQRKRYFDVYLPWALYNG
COQ4_SCHPO       ---------------------------------------LNCEQASRFRRVYIPWSIRNG
COQ4_SCHJY       ---------------------------------------LNRVQASRFRRTYVPWAIRNG
COQ4_COPC7       ---------------------------------------LNAQKRNWLFTEAVPWALKCG
COQ4_LACBS       ---------------------------------------LTPQKRQRLFAEFVPWALKCG
COQ4_CRYNJ       ---------------------------------------LK--RKETWTRDWVPWALRTG
COQ4_LEIIN       ---------------------------------------LA-AAQWAHMRLYWEWASRNA
COQ4_LEIMA       ---------------------------------------LS-AAQWAHIRLYWEWASRNA
COQ4_LEIBR       ---------------------------------------LS-ATQLAHMRLFWEWASHNA
COQ41_TRYCC      ---------------------------------------LS-RQQIRNMELYFEWAEVNA
COQ42_TRYCC      ---------------------------------------LS-RQQLRNMELYFEWAEVNA
COQ4_TRYB2       ---------------------------------------LR-MDQILNMGMYNEWARANA
COQ4_PLACH       NIRGTIIYGYNNEDNNDIIFDDINNEYIFLKNPEKNYFLFKYKPRQTLLKQLYPWAYMAG
COQ4_PLAYO       HIRGTIIYGYNNENNNDIIFDDINNEYIFLKNPEKNYFLFKYKPRQTLLNQLYPWAYMAG
COQ4_PLAKH       AVRGSIIYGFENKSNNDIIYDHPNREYIFLKNLKKKHLLFQYKPRKNLLRELYPWAYMAG
COQ4_PLAVS       AVRGSIIYGFENKSSNDIIYDQPNREYIFLKNLKKKYLLFQYKPRKNLLRELYPWAYMAG
COQ4_PLAF7       HVRGSIIYGYQNKNYNDIHYDKLNNEYLYLKNNIKNYFHFQYKPRKLLLTNLYPWAYKTA
COQ4_CRYPI       --PKEIFENHNKTHVYPSKPIQIHQDCDKYLNSLEITKKEILYPKRIVIKELIPWIYKAE
                                                                             

COQ41_PARTE      NRS-------EFIMNVYFEEHINTDLTQLRKSLRLL------------------------
COQ42_PARTE      HKS-------EFIMNVYFEEHINTDITQLRKSLRLL------------------------
COQ4_DICDI       KSC-------VYLMNVKYEDHWEDDLNEFRAKLNFIPYKYLSDINQNKTTTINM------
COQ4_MOUSE       RRA-------PCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA--------------
COQ4_RAT         RRA-------PCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA--------------
COQ4_HUMAN       RRA-------PCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA--------------
COQ4_XENLA       RNA-------RCVLNFHYENRWEQSVLSLRKEIGILPLP-EIKA----------------
COQ4_XENTR       RNA-------RCVLNFYYEKRWGQSVASLREEIGILPPP-EIKA----------------
COQ4_DANRE       GRA-------RCVLSIYYERRWEQTLDELRHELNIEEPPVSLIASIKNSSSKS-------
COQ4_DROSE       KRA-------KPLMPVYWEKRWEQNIHELRSELGITVLNKA-------------------
COQ4_DROSI       KRA-------KPLMPVYWEKRWEQNIHELRSELGITVLNKA-------------------
COQ4_DROME       KRT-------KPLMPVYWEKRWEQNIHELRSELGITVLNKA-------------------
COQ4_DROYA       KRS-------KPLMPVYWEKRWEQNIHELRSELGITVLNKA-------------------
COQ4_DROER       KRT-------KPLMPVYWEKRWEQNIHDLRSELGITVLNKA-------------------
COQ4_DROAN       KRS-------KPLMPVYWEKRWEQKLQDLRAELGITVLNKV-------------------
COQ4_DROPE       KQM-------KPLMPVYWEERWEQNVNELRAELGIKLLNKV-------------------
COQ4_DROPS       KQM-------KPLMPVYWEERWEQNVNELRAELGIKLLNKF-------------------
COQ4_DROWI       KRM-------KPLMPVYWEQRWEQNLDLAKKTSPIMLPALRITRRDG-------------
COQ4_DROGR       KQM-------KPLMPIYWERRWEQNVDELRNELGIKLLQ---------------------
COQ4_DROMO       KQM-------KPLMPIYWEKRWEQKVNDLRAELGIKPFQ---------------------
COQ4_DROVI       KGM-------RPLMPIYWEQRWEQNIHELRCELGIKPLQ---------------------
COQ4_AEDAE       QRA-------RPLMCVYWEKRWEQDIEELRKELNIEVLKVD-------------------
COQ41_CULQU      RQV-------RPLMNVYWEKRWEQDMAELRQELNIEELVIN-------------------
COQ4_ANOGA       NRI-------KPLMGVYWEKRWEQDVTELRKELNIELLAP--------------------
COQ4_BOMMO       NNA-------KFLQGIYFEKRWEQDIDDFHKEMNIVRLLKK-------------------
COQ4_CAEEL       TNA-------RFFMAFDWENHFEKQLSEVQKELNITPLSVNM------------------
COQ4_YEAST       LSC-------KPLINVYWEEMLEKDVTALRKELKITLP---------PDLRTMRKERAAL
COQ4_YEAS1       LSC-------KPLINVYWEEMLEKDVTALRKELKITLP---------PDLRTMRKERAAL
COQ4_YEAS7       LSC-------KPLINVYWEEMLEKDVTALRKELKITLP---------PDLRTMRKERAAL
COQ4_YEAS6       LSC-------KPLINVYWEEMLEKDVTALRKELKITLP---------PDLRTMRKERAAL
COQ4_CANGA       LTC-------KPLINVYWEELLEKDVEELRQELGIKMP---------PDLRAMRAKRKAM
COQ4_LACTC       LSC-------EPLINVYWEELLEHDVEELRKKLRITPP---------PDLRAIRRERAQQ
COQ4_ZYGRC       LSC-------KPLINVYWEELLEKDVNELRKELGIQPP---------PNLRAIRQERSKI
COQ4_VANPO       LSC-------KPLINVYWEELLDKDVNELRKELGITPP---------PDLRKIRKERAAL
COQ4_ASHGO       LSA-------KPLINVYWEELLEHDVDQLRAELGIRVP---------PDLRLIRQEQLQR
COQ4_KLULA       LNC-------KPLINVYWEEILDKDIDELRRELNVTPP---------PDLRKIRKERAKQ
COQ4_CANAW       LFS-------KPLINVYWEKILEKDVDEFRQEMGIQQP---------PDLRNMRKEYFAK
COQ4_CANAL       LFS-------KPLINVYWEKILEKDVDEFRQEMGIQQP---------PDLRNMRKEYFAK
COQ4_CANDC       LFS-------KPLINVYWEKILEKDVNEFRQEMGIQQP---------PDLRNMRKEYFAK
COQ4_CANTT       IYS-------KPLINVYWEKILEQDVDEFRKQMGIETP---------PDLRNMRKEYFAR
COQ4_LODEL       LYS-------KPLINVYWEKILDKDINEFRREMGIEQP---------PDLRDLRKEYFAK
COQ4_DEBHA       LNS-------KPLINVYWENILEEDINEFRHKMGIEQP---------PDLRNLRKKYFEE
COQ4_PICST       LNS-------KPLINVYWENILEEDIDEFRKTMGIEQP---------PDLRNLRKEYFKK
COQ4_CLAL4       LNA-------KPLINVYWEKSLEMDVNELRRSLGIEQP---------PDLRNLRKEYFAK
COQ4_PICGU       LNS-------KPLINVYWEKILEQDINEFRRDMGIEQP---------PDLRELRRKQKKL
COQ4_KOMPG       TIC-------KPLINVYWEKIMKKDIDVLRSELGIEKP---------PDMRELRKKARSK
COQ4_ASPFN       LAS-------KELINVYWEKILEKDVDELRGELGIEKP---------PDMREIRRMIREQ
COQ4_ASPOR       LAS-------KELINVYWEKILEKDVDELRGELGIEKP---------PDMREIRRMIREQ
COQ4_ASPNC       LRS-------KELINVYWEKVLEKDVGELREELGIERP---------PDMREIRRMIRMQ
COQ4_ASPTN       LGS-------KELICVYWEKILEKDVNELRRELGIERP---------PDMREIRRMIREQ
COQ4_EMENI       LNS-------KELINVYWEKILEKDVDELRAELGIEKP---------PDMRDIRRMIRLQ
COQ4_ASPFC       LAS-------KELINVYWEEILEKDVDELRKELGIERP---------PDLREIRKLMRQQ
COQ4_ASPFU       LAS-------KELINVYWEEILEKDVDELRKELGIERP---------PDLREIRKLMRQQ
COQ4_NEOFI       LAS-------KELINVYWEEILEKDVDELRKELGIERP---------PDLREIRKLMRQQ
COQ4_ASPCL       LAS-------KELINVYWEEILEKDVDELRRELHIERP---------PDLREIRKMMRQQ
COQ4_PENRW       LGS-------KELINVYWEEVLEKDVDELRAELNIERP---------PDLREIRKMIRQQ
COQ4_TALMQ       LSS-------EELINVYWEEQLERNVDDLRTELGIETP---------PDLREIRRMMRQQ
COQ4_TALSN       LSS-------EELINVYWEEQLERNVDELRAELGIEAP---------PDLREIRRMMRQQ
COQ4_COCIM       LAS-------KELINVYWEEQLERDVNELREELNIEKP---------PDLRDIRKKVREQ
COQ4_COCP7       LAS-------KELINVYWEEQLERDVNELREELNIEKP---------PDLRDIRKKVREQ
COQ4_UNCRE       LAS-------KELINVYWEEQLERDVNELREELNIEKP---------PDLRDIRKKLREQ
COQ4_ARTOC       AGS-------KELICVYWEELLERDVGELRAELGIEVP---------PDMREMRRRHRKQ
COQ4_AJECG       LAS-------KAVINVYWEEQLERDVDELRKELGIEKP---------VDLREIRKIMRRQ
COQ4_AJECN       LAS-------KAVINVYWEEQLERDVDELRKELGIEKP---------VDLREIRKIMRRQ
COQ4_AJEDR       LAS-------KEVINVYWEEQLERDANELREELGIEKP---------ADLREIRKMMRRQ
COQ4_BLAGS       LAS-------KEVINVYWEEQLERDANELREELGIEKP---------ADLREIRKMMRRQ
COQ4_PARBD       LAS-------KEVINVYWEEELERDVNELREKLGIEKP---------PDLREIRKMMRRQ
COQ4_PARBP       LAS-------KEVINVYWEEELERDVNELREKLGIEKP---------PDLREIRKMMRRQ
COQ4_PARBA       LAS-------KEVINVYWEEELERDVNELREKLGIEKP---------PDLREIRKMMRRQ
COQ4_BOTFB       LKA-------EEVINVYWEEQLERSVEELREELGIEKP---------LDLRDIRRMEKER
COQ4_SCLS1       LKA-------DELINVYWEEQLERSVEELREELGIEKP---------LDLREIRRAEKER
COQ4_PHANO       AQS-------DDVINIYWEEELETDIDQLRTRLGIEKP---------PDLREMRKAEREA
COQ4_PYRTR       AQS-------DDVINVYWEEELETDIDKLRERLGIEKP---------PDLRAMRKAEREA
COQ4_MAGO7       LRA-------KEIINVYWEEEMETDVVDLRKALGIEPP---------PDMRDARKRERDA
COQ4_NEUCR       LRA-------KEVINVFWEEELERDVNDLRRELGVEPP---------PDLREIRKREREE
COQ4_PODAN       LRA-------KEVINVYWEEVLEKDVGELRKELGVEVP---------ADLREMRRREREE
COQ4_YARLI       FRS-------KPVINVYWEEVLEKDAEELRRDLGIEQP---------PDLRQMKKDMAKK
COQ4_SCHPO       LNA-------KTLINVYWEKELTNDIEDVRRRIRIEAA---------PPLV---------
COQ4_SCHJY       LKA-------ELLVNVYWEKELENDVDEVRQHIRLQQA---------PALSPNTP-----
COQ4_COPC7       SSA-------RSLITVYWEKRWEEQVEDMKKEFGIWDG---------PEARWSKPLNEAK
COQ4_LACBS       GSS-------RSLITVYWEERWGQNVADMKTEFGIWDP---------PEARWSKPLSEAK
COQ4_CRYNJ       REG-------RSLVTVYWEKRWEQGIGELRRELGVERNDAEGVEARWGGYRKIREVEREL
COQ4_LEIIN       PCSRHGEPAVPMYLNVPWEDMLAKEYDEVVAYTGITPL---------PQFLEKRQQH---
COQ4_LEIMA       PSSRHGEPAVPMYLNVPWEDMLAKEYDEVVAYTGITPL---------PDFLEKRQKH---
COQ4_LEIBR       PCSRHDKPAVPMYLNVPWEDMLAKEYDEVAAYTGITPL---------PVFLKKHQKQ---
COQ41_TRYCC      PNQRHGEVNIPYITNVWWEYYLDKPYEQLLADTGITPI---------DVFLQQKKGKTAL
COQ42_TRYCC      PNQRHGEVYIPYITNVWWESYLDKPYEQLLADTGITPI---------DVFLQQKKGKAAL
COQ4_TRYB2       PRQLHGKRFVSCILNVPWEWYLDKPYEQLVDDVGIVPL---------DAFLKERK-----
COQ4_PLACH       MAAT------KPLHSIHIENWL-KDIDLFRKTYNIIPL---------PDHLNLMSGIN--
COQ4_PLAYO       MAAK------KPLHSIHIENWLDKDIDIFRKTYNIIPL---------PDHLNLMSGIN--
COQ4_PLAKH       VSTT------KPLHSIHIEKWLDKDIDLFRRTYNISPL---------PDHLNLMAGIN--
COQ4_PLAVS       VSTT------KPLHSIHIEKWLDKDIDLFRRTYNISPL---------PDHLNLMAGIN--
COQ4_PLAF7       IQTN------KPLHSIYVEKWFDKDIDLFRKKYNITPL---------PSNLNLMAGIN--
COQ4_CRYPI       KKMR------HNIYTIMVEDWFPRPIADFQNYLNISPP---------PKQLQKYTRIKPM
                                .  *               .                         

COQ41_PARTE      --------------------------------------------------------
COQ42_PARTE      --------------------------------------------------------
COQ4_DICDI       --------------------------------------------------------
COQ4_MOUSE       --------------------------------------------------------
COQ4_RAT         --------------------------------------------------------
COQ4_HUMAN       --------------------------------------------------------
COQ4_XENLA       --------------------------------------------------------
COQ4_XENTR       --------------------------------------------------------
COQ4_DANRE       --------------------------------------------------------
COQ4_DROSE       --------------------------------------------------------
COQ4_DROSI       --------------------------------------------------------
COQ4_DROME       --------------------------------------------------------
COQ4_DROYA       --------------------------------------------------------
COQ4_DROER       --------------------------------------------------------
COQ4_DROAN       --------------------------------------------------------
COQ4_DROPE       --------------------------------------------------------
COQ4_DROPS       --------------------------------------------------------
COQ4_DROWI       --------------------------------------------------------
COQ4_DROGR       --------------------------------------------------------
COQ4_DROMO       --------------------------------------------------------
COQ4_DROVI       --------------------------------------------------------
COQ4_AEDAE       --------------------------------------------------------
COQ41_CULQU      --------------------------------------------------------
COQ4_ANOGA       --------------------------------------------------------
COQ4_BOMMO       --------------------------------------------------------
COQ4_CAEEL       --------------------------------------------------------
COQ4_YEAST       RKEIDAKYNSQKRATTPA--------------------------------------
COQ4_YEAS1       RKEIDAKYNSQKRATTPA--------------------------------------
COQ4_YEAS7       RKEIDAKYNSQKRATTPA--------------------------------------
COQ4_YEAS6       RKEIDAKYNSQKRATTPA--------------------------------------
COQ4_CANGA       IKRLNEKYQKN---------------------------------------------
COQ4_LACTC       RKQFKLKYERHE--------------------------------------------
COQ4_ZYGRC       RKELKMKYDAYEVGM-----------------------------------------
COQ4_VANPO       RKKFKMKYESYEKQ------------------------------------------
COQ4_ASHGO       RRSFKMKYESFEN-------------------------------------------
COQ4_KLULA       RKQFKLKYETYEK-------------------------------------------
COQ4_CANAW       KKLEKQLQGGK---------------------------------------------
COQ4_CANAL       KKLEKQLQGGK---------------------------------------------
COQ4_CANDC       KKLEKQLQGRK---------------------------------------------
COQ4_CANTT       KKLEKQGKL-----------------------------------------------
COQ4_LODEL       KRREKELKAAAAAATVTQRQRQQQRATATAANATSASSANVKPSNTAGAM------
COQ4_DEBHA       LKKKKKV-------------------------------------------------
COQ4_PICST       LKEAKKIV------------------------------------------------
COQ4_CLAL4       LKKEKRI-------------------------------------------------
COQ4_PICGU       PEPERENAN-----------------------------------------------
COQ4_KOMPG       KKQVA---------------------------------------------------
COQ4_ASPFN       KKREKER-----------------------------------------LQQSA---
COQ4_ASPOR       KKREKER-----------------------------------------LQQSA---
COQ4_ASPNC       KKREKEL-----------------------------------------MEQRGQ--
COQ4_ASPTN       KKREKER-----------------------------------------LKQAE---
COQ4_EMENI       QKREREQ-----------------------------------------QQGKSS--
COQ4_ASPFC       QKREKER-----------------------------------------LQGKS---
COQ4_ASPFU       QKREKER-----------------------------------------LQGKS---
COQ4_NEOFI       QKREKER-----------------------------------------LEGKS---
COQ4_ASPCL       QKREKER-----------------------------------------LEQQA---
COQ4_PENRW       QKREKER-----------------------------------------QQQASN--
COQ4_TALMQ       EKRAKEQ-----------------------------------------QAQGSSS-
COQ4_TALSN       EKRAKEQ-----------------------------------------QMKASGL-
COQ4_COCIM       KKAAKEA-----------------------------------------VIKS----
COQ4_COCP7       KKAAKEA-----------------------------------------VIKS----
COQ4_UNCRE       KRAARRQ-----------------------------------------Q-------
COQ4_ARTOC       KQQEKQE-----------------------------------------K-------
COQ4_AJECG       KKMAEEA-----------------------------------------AKTKKRY-
COQ4_AJECN       KKMAEEA-----------------------------------------AKTKKRY-
COQ4_AJEDR       K-AAEEA-----------------------------------------AKAKDGQ-
COQ4_BLAGS       K-AAEEA-----------------------------------------AKAKDGQ-
COQ4_PARBD       K-KAAEA-----------------------------------------AREKYQN-
COQ4_PARBP       K-KAAEA-----------------------------------------AREKYQN-
COQ4_PARBA       K-KAAKA-----------------------------------------AREKFEN-
COQ4_BOTFB       KKAQKAT-------------------------------------------------
COQ4_SCLS1       KKAQKAT-------------------------------------------------
COQ4_PHANO       QKKDK--------------------------------------EAKETMTRAAV--
COQ4_PYRTR       RKKEK--------------------------------------ETKGTMVGAAT--
COQ4_MAGO7       RRRRKQLET----------------------------------EAQQGLDAASL--
COQ4_NEUCR       KRRRKEMERMLSGRGTEDVIQKAEKEAEVVAERVKEMRNEVVEKVGEVVGSSAMRG
COQ4_PODAN       KKRRE----------------------------------------------AAARG
COQ4_YARLI       K-------------------------------------------------------
COQ4_SCHPO       --------------------------------------------------------
COQ4_SCHJY       --------------------------------------------------------
COQ4_COPC7       EAAERRSKTTQNQIY-----------------------------------------
COQ4_LACBS       AAAERH-RTAQTH-------------------------------------------
COQ4_CRYNJ       RRKGEWVDEPEDW-------------------------------------------
COQ4_LEIIN       --------------------------------------------------------
COQ4_LEIMA       --------------------------------------------------------
COQ4_LEIBR       --------------------------------------------------------
COQ41_TRYCC      ANGEAIDGK-----------------------------------------------
COQ42_TRYCC      ANGEAIDGK-----------------------------------------------
COQ4_TRYB2       -SGGLHDS------------------------------------------------
COQ4_PLACH       --------------------------------------------------------
COQ4_PLAYO       --------------------------------------------------------
COQ4_PLAKH       --------------------------------------------------------
COQ4_PLAVS       --------------------------------------------------------
COQ4_PLAF7       --------------------------------------------------------
COQ4_CRYPI       PFC-----------------------------------------------------