CLUSTAL format seed alignment for MF_03112

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ASNA_ENTDS        ----------------------MSLSPPNNLEHIITSQTLKWVFVGGKGGVGKTTTSCSL
ASNA_ENTHI        ----------------------MSLNPPNNLEHIITSQTLKWVFVGGKGGVGKTTTSCSL
GET3_CANAL        ----------------------MDFELEPSLEELIKQDTLKWIFVGGKGGVGKTTTSSSI
GET3_YEAST        ----------------------MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSI
ASNA_GIAIC        --------------------------MLPSLHDILDQHTYKWIFFGGKGGVGKTTTSSSF
ASNA_DICDI        -------------------MADDE--FEPTIENIINSEKLKWIFVGGKGGVGKTTTSCSV
F0ZQ05_DICPU      -------------------MSEEEELYEPTIQNIIDSD-LKWIFIGGKGGVGKTSTSCSI
D3B3Z0_POLPP      --------MSTTTTTTTTTNTGDFDDYEPTINNLLEKDTLKWIFVGGKGGVGKTTTSCSI
ASNA_HUMAN        ---MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
I3M8X1_ICTTR      ---MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
G1M0I7_AILME      ---MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
ASNA_BOVIN        ---MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
ASNA_MOUSE        ---MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
G3V9T7_RAT        ---MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
H0X6E2_OTOGA      ---MAAGVAGWGAEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSL
ASNA_DANRE        ---MAASVE------DEFEDAPDVEPLEPTLKNIIEQKSLKWIFVGGKGGVGKTTCSCSL
H3AKV5_LATCH      ---MAAAVE------DEYEDAPDVEPLEPTLTNIIDQKSLKWIFVGGKGGVGKTTCSCSL
ASNA_XENTR        ---MAAPAD------DEFEDAPDVEPLEPTLSNVIDQRSLRWIFVGGKGGVGKTTCSCSL
ASNA_NEMVE        ---MA----------EVRPAADDFESLEPSIKNIVEQDSLKWIFVGGKGGVGKTTCSCSI
ASNA_AEDAE        -------------------MDTDFEPLAPSLENIIDQETLKWVFVGGKGGVGKTTCSCSL
ASNA_ANOGA        -------------------MEDEFEPCEPTLQNIIDQASLKWVFVGGKGGVGKTTCSCSL
E0VDM0_PEDHC      ------MAALEEKNGDVNMNEGEFMPLEPSLQNVIDQTSLRWIFVGGKGGVGKTTCSCSL
ASNA_DROME        -------------------MADNLEPLEPSLQNLVEQDSLKWIFVGGKGGVGKTTCSSSL
ASNA_DROPS        -------------------MVDNLEPLPASLQNLVEQDSLKWIFVGGKGGVGKTTCSSSL
E9GRY6_DAPPU      ---------------MASNIEEEFLQLDPTLNNVIEQSTLRWIFVGGKGGVGKTTCSCSL
ASNA_CAEBR        ---------------------MADDQLEGSIKNILEQKSLKWVFVGGKGGVGKTTCSCSL
ASNA_CAEEL        ----------------------MSDQLEASIKNILEQKTLKWIFVGGKGGVGKTTCSCSL
GET3_EMENI        --------------MSSTAIVHDDDLMEPTLQSIVNQKTLRWIFVGGKGGVGKTTTSCSL
GET3_ASPFU        --------------MSSTAVVHGDDLMEPTLQSILSQKTLRWIFVGGKGGVGKTTTSCSL
GET3_AJECG        --------------MSSTAMVSGDDSLEPTLQSLLDQKTLRWVFVGGKGGVGKTTTSCSL
GET3_PHANO        --------------MASAALIDSD--MEPTLQPILDQKTLRWIFVGGKGGVGKTTTSCSL
GET3_NEUCR        --------------MSTAVINADDDHMEPTLQSILDQRSLRWIFVGGKGGVGKTTTSCSL
GET3_SCLS1        --------------MSTAVINTDDDQLEPTLQSILDQKSLRWIFVGGKGGVGKTTTSCSL
C7YRA2_NECH7      ----------------MAAVISADDALEPSLQSLLDQRSLRWIFVGGKGGVGKTTTSCSL
D5GGF4_TUBMM      --------------MSSVFVDSDLDPLEPTLQSILDQKSLRWIFVGGKGGVGKTTTSCSL
GET3_YARLI        ---------------------MDEDSPAPSLQNIIDQDSLRWIFVGGKGGVGKTTTSCSL
GET3_COPC7        ---------------MSE------ELLPPTLQNILDQKSLKWIFCGGKGGVGKTTTSCSL
GET3_CRYNJ        ---------------MSDL-----EPLDPTLQNILDQKSLKWIFCGGKGGVGKTTTSCSL
GET3_USTMA        ---------------MSSAAVV-EDALEPTLQNILDQKTLKWLFVGGKGGVGKTTTSCSL
E3KVY1_PUCGT      ---------------MADDEV---PALEPSLQNILDQKSLKWIFCGGKGGVGKTTTSCSL
I1CEA3_RHIO9      ---------------MSDMSDDDFQPLEPTLQNILDQDSLHWIFVGGKGGVGKTTSSCSL
F4NRV5_BATDJ      ---------------MDDDL----EKLEGTLQNVLDQEDLRWIFVGGKGGVGKTTTSCSL
GET3_SCHPO        ---------------------MSFDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSL
B9IC86_POPTR      -----------------<MSTADI--PEGTVRNILEQDTLKWVFVGGKGGVGKTTCSSIL
B9GPT9_POPTR      ------------------MATTDI--PDGTVRNILDQDTLKWVFVGGKGGVGKTTCSSIL
F6I363_VITVI      ------------------MASDQE--LSGTVQNILDQESLKWVFVGGKGGVGKTTCSSIL
Q949M9_ARATH      -------------------MAADL--PEATVQNILDQESLKWVFVGGKGGVGKTTCSSIL
C5X622_SORBI      ------------MASAAVVDAGDA--PEPTVRNLLDQDSLKWVFVGGKGGVGKTTCSSIL
A9RXS6_PHYPA      ------------------MAEDDLPAPEASVQNVLEQTDLKWIFVGGKGGVGKTTCSCML
A9T6J9_PHYPA      ------------------MAEDDLPMPEATVQNVLEQTDLKWIFVGGKGGVGKTTCSCML
B7G933_PHATC      --------------------MDDLDLPDPSLKNIIDQTTLQWVFVGGKGGVGKTTTSCCL
B8BXF4_THAPS      --------------MTDAYDYDDEDLPDPSLKNILEQESLQWIFVGGKGGVGKTTTSCCL
D0NW99_PHYIT      ------------------MADEVVDVPEASLRNLVAQKSLQWIFVGGKGGVGKTTTSCCL
H3G8W6_PHYRM      ------------------MADQVADVPEASLRNLVAQQSLQWIFVGGKGGVGKTTTSCCL
ASNA1_PARTE       ----------------------MQQQVEPTLKNVLENQTLKWIFVGGKGGVGKTTTSSSL
ASNA2_PARTE       --------------------------MEPTLKNILENPSLKWIFVGGKGGVGKTTTSSSL
I7M036_TETTS      ------------------------MDQERTLKNLLEKKTLKWIFVGGKGGVGKTTTSSSL
ASNA_BABBO        -------------MVEITEVIEPEWQTRNDIQNLVNQKTLQWVFVGGKGGVGKTTISSSI
ASNA_THEPA        -------------MEESSMESDNGLNLRNDVKNLVEQETYKWIFVGGKGGVGKTTISCSL
ASNA_CRYPI        ---------------MSTAYFDADCDLEPSLKSLFSLKTLKWIFVGGKGGVGKTTTSCSI
ASNA_TOXGV        ---------------------MEDLELEGSLKELFETPSLRWIFVGGKGGVGKTTTSCAV
ASNA_PLABA        MSKAGSDVSSISCSLSLDSDSCEDEYYETNLNKLIENTSLNWIFVGGKGGVGKTTTSCSI
ASNA_PLAYO        MSEGGSDVSSLSCSLSLDSDSCEDEFYETNLNKLIENTSLNWIFVGGKGGVGKTTTSCSI
ASNA_PLACH        MSKAGSDASSISCSLSLDSDSCDDEFYETNLNKLIENTSLNWIFVGGKGGVGKTTTSCSI
ASNA_PLAKH        MSD----ADSLSCSLTLESDEYDEEEYDTNLSKLLENKTLNWIFVGGKGGVGKTTTSCSI
ASNA_PLAVS        MSD----ADSLSCSLTLESDEYDEEEYDTNLSKLLENKTLNWIFVGGKGGVGKTTTSCSI
ASNA_PLAF7        MSED--ESNSVSCSLSLESDGYSDEEYDTNLNKLIENESLNWIFVGGKGGVGKTTTSCSI
ASNA_LEIIN        --------------------------MDPTLTELLHAN-LEWIFVGGKGGVGKTTTSCAL
ASNA_LEIMA        --------------------------MDPTLKELLHAN-LEWIFVGGKGGVGKTTTSCAL
ASNA_LEIBR        --------------------------MDPTLTELLHSN-LQWIFVGGKGGVGKTTTSCAL
ASNA_TRYCC        ------------------------MSLEPTLRDLLHSK-LQWIFVGGKGGVGKTTTSCAL
                                                :  :.     .*:* *********: *. .

ASNA_ENTDS        GVLIANR----------NPQKKVLIISTDPAHNTSDAFDIKFGA-EPKAVPGVP-NLSVM
ASNA_ENTHI        GVLIADR----------NPQKKVLIISTDPAHNTSDAFDIKFGA-EPKVVPGVP-NLSVM
GET3_CANAL        AVQLALQ----------HPNDEFLLISTDPAHNLSDAFCQKFGK-DARKVEGLS-NLSCM
GET3_YEAST        AIQMALS----------QPNKQFLLISTDPAHNLSDAFGEKFGK-DARKVTGMN-NLSCM
ASNA_GIAIC        SVLMAET----------RPNEKFLLLSTDPAHNISDAFDQKFGK-APTQVSGIP-NLYAM
ASNA_DICDI        AIQLS------------KVKESVLLISTDPAHNLSDAFGQKFTK-SPTLVEGFT-NLFAM
F0ZQ05_DICPU      AIQLS------------KVKESVLLISTDPAHNLSDAFGQKFTK-NPTLVEGFK-NLFCM
D3B3Z0_POLPP      AIQLA------------KVKESVLLISTDPAHNLSDAFGQKFTK-HPSLVNGFP-NLFCM
ASNA_HUMAN        AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
I3M8X1_ICTTR      AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
G1M0I7_AILME      AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
ASNA_BOVIN        AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
ASNA_MOUSE        AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
G3V9T7_RAT        AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
H0X6E2_OTOGA      AVQLS------------KGRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
ASNA_DANRE        AVQLA------------AVRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYD-NLFAM
H3AKV5_LATCH      AVQLS------------KVRESVLIISTDPAHNISDAFDQKFSK-VPTKVKGYE-NLFAM
ASNA_XENTR        AVQLS------------RVRESVLIISTDPAHNISDAFDQKFSK-VPTKVRGYD-NLFAM
ASNA_NEMVE        AVQLA------------LTRRSVLIISTDPAHNISDAFDQKFSK-VPTLVKGFQ-NLYAM
ASNA_AEDAE        AVQLA------------KVRESVLIISTDPAHNISDAFDQKFTK-VPTKVNGFN-NLFAM
ASNA_ANOGA        AIQLA------------QKRESVLIISTDPAHNISDAFDQKFTK-VPTKVNGFD-NLFAM
E0VDM0_PEDHC      AVQLS------------KVRDSVLIISTDPAHNISDAFDQKFSK-IPTKVNGFN-NLYAM
ASNA_DROME        AVQLS------------KVRESVLIISTDPAHNISDAFDQKFTK-VPTKVNGFD-NLFAM
ASNA_DROPS        AVQLA------------KVRESVLIISTDPAHNISDAFDQKFTK-VPTKVNGFD-NLFAM
E9GRY6_DAPPU      SVQLA------------RVRETVLIISTDPAHNISDAFDQKFSK-VPTKVKGFE-NLFAM
ASNA_CAEBR        AAQLS------------KVRGRVLLISTDPAHNISDAFCQKFTK-TPTLVEGFT-NLFAM
ASNA_CAEEL        AAQLS------------KVRERVLLISTDPAHNISDAFSQKFTK-TPTLVEGFK-NLFAM
GET3_EMENI        AIQLA------------KARKSVLLISTDPAHNLSDAFGQKFGK-EARLVDGFT-NLSAM
GET3_ASPFU        AIQLA------------KVRKSVLLISTDPAHNLSDAFGQKFGK-EARLVDGYS-NLSAM
GET3_AJECG        AIQLA------------KVRKSVLLISTDPAHNLSDAFGQKFGK-EARLVDGFD-NLSAM
GET3_PHANO        AIQLA------------KHRKSVLLISTDPAHNLSDAFNQKFGK-DARLINGFD-NLSAM
GET3_NEUCR        AIQLA------------KVRRSVLLISTDPAHNLSDAFSQKFGK-EARLIDGFD-NLSAM
GET3_SCLS1        AIQLA------------KVRRSVLLISTDPAHNLSDAFSQKFGK-EARLINGFE-NLSAM
C7YRA2_NECH7      AIQLA------------RVRRSVLLISTDPAHNLSDAFSQKFGK-EARLVNGFD-NLSAM
D5GGF4_TUBMM      AIQLA------------KVRDSVLLISTDPAHNLSDAFNQKFGK-EARKIEGFE-NLSAM
GET3_YARLI        AIQLA------------KNRESVLLISTDPAHNLSDAFGQKFGK-DARPVNGID-NLHCM
GET3_COPC7        AIQLA------------KVRESVLLISTDPAHNLSDAFGQKFSK-DATKVNGFD-NLFAM
GET3_CRYNJ        AVQLA------------ACRESVLLISTDPAHNLSDAFSQKFGK-DATKVNGFD-NLYAM
GET3_USTMA        AIQLS------------KVRESVLLISTDPAHNLSDAFGQKFGK-EATKVNGFD-NLSAM
E3KVY1_PUCGT      AVQLA------------SCRESVLLISTDPAHNLSDAFCQKFGK-DATLVNGFE-NLYAM
I1CEA3_RHIO9      AVQLS------------KVRESVLLISTDPAHNLSDAFGQKFSK-EATLVNGFN-NLYAM
F4NRV5_BATDJ      ATQLA------------KVRESVLLISTDPAHNLSDAFGQKFSK-NPQLINGYT-NLYAM
GET3_SCHPO        AIQMS------------KVRSSVLLISTDPAHNLSDAFGTKFGK-DARKVPGFD-NLSAM
B9IC86_POPTR      SILLA------------QVRSSVLIISTDPAHNLSDVFQQRFTK-TPTLVNGFS-NLYAM
B9GPT9_POPTR      SILLA------------QVRSSVLIISTDPAHNLSDAFQQRFTK-TPTLVNGFG-NLYAM
F6I363_VITVI      SILLS------------RVRSSVLIISTDPAHNLSDAFQQRFTK-APTLVNGFS-NLYAM
Q949M9_ARATH      AICLA------------SVRSSVLIISTDPAHNLSDAFQQRFTK-SPTLVQGFS-NLFAM
C5X622_SORBI      SVLLA------------GVRQSVLVISTDPAHNLSDAFQQRFTK-FPTLVRGFT-NLYAM
A9RXS6_PHYPA      AVLLA------------QVRESVLLISTDPAHNLSDAFCQKFTK-SPSMVNGFG-NLFAM
A9T6J9_PHYPA      ALLLS------------QVRESVLLISTDPAHNLSDAFCQKFTK-SPSMVNGFS-NLFAM
B7G933_PHATC      GVQLA------------KSRTKVLLVSTDPAHNLSDAFCQKIGR-EPTPIHGFD-NLCAM
B8BXF4_THAPS      GTQLA------------KHRKKVLIVSTDPAHNLSDAFCQKIGR-EPTPIQGFT-NLSAM
D0NW99_PHYIT      SIQLA------------AQREKVLIVSTDPAHNLSDAFGQKFTR-EPTPVNGFS-NLAVM
H3G8W6_PHYRM      AIQLA------------AQREKVLIVSTDPAHNLSDAFGQKFTR-EPTPVNGFS-NLAVM
ASNA1_PARTE       ATLFA------------KSGKRTIIISTDPAHNLSDCFDQKIGS-QPTQIKGIE-NLSAM
ASNA2_PARTE       ATLFA------------KSGKKTIIISTDPAHNLSDCFDQKIGG-QPILIKGID-NLSAM
I7M036_TETTS      ATLLA------------QNGVKVLIISTDPAHNLCDCFDQKFSGKEPTPVAGIE-NLWGM
ASNA_BABBO        ATALA------------ETRESVLLLSTDPAHSLSDAFGQKFTH-EPRLVNGFT-NLYAM
ASNA_THEPA        SSILS------------ERRESVLLLSTDPAHSLSDAFNQKFTD-TPTLVNGYE-NLYAM
ASNA_CRYPI        ASRLA------------EERESVLILSTDPAHNLSDAFVQKFSN-APTLVNGYK-NLYAM
ASNA_TOXGV        AAQLA------------KTRESVLIISTDPAHNISDAFTQKFSN-TPTLVNGFD-NLYAM
ASNA_PLABA        AIQLA------------KKRESVLLLSTDPAHNTSDAFNQKFTN-KPTLINSFD-NLYCM
ASNA_PLAYO        AIQLA------------KKRESVLLLSTDPAHNTSDAFNQKFTN-KPTLINSFD-NLYCM
ASNA_PLACH        AIQLA------------KKRESVLLLSTDPAHNTSDAFNQKFTN-KPTLINSFD-NLYCM
ASNA_PLAKH        AVQLA------------KRRESVLLLSTDPAHNTSDAFNQKFTN-QPTLINSFD-NLYCM
ASNA_PLAVS        AVQLA------------KRRESVLLLSTDPAHNTSDAFNQKFTN-QPTLINSFD-NLYCM
ASNA_PLAF7        AVQLS------------KRRESVLLLSTDPAHNTSDAFNQKFTN-QPTLINSFD-NLYCM
ASNA_LEIIN        ATLFATTPISDAASPGGTRPRRVLLISTDPAHNLSDAFNQRFGP-HPTPVKGLEESLAAM
ASNA_LEIMA        ATLFATTPISDAASPGGTRPRRVLLISTDPAHNLSDAFNQRFGP-HPTPVKGLEESLAAM
ASNA_LEIBR        ATLFATTPISDAAAPDGTRPRRVLLISTDPAHNLSDAFNQRFGP-QPTPVKGLEDTLAAM
ASNA_TRYCC        ATLFASTPVHDAVT-NTTRPRRVLLISTDPAHNLSDAFSQKFGK-TPVPVNGMEETLFAM
                  .  ::                  :::******. .* *  ::    .  : .   .*  *

ASNA_ENTDS        EVDVKDAMKGMFDGVEQGTNQNGEFGLLSE----------ITGMVG------MFKSVPGI
ASNA_ENTHI        EIDVKDAMKGVFDESEQGTNQNGGFGLLSE----------LTGMMG------MLKSVPGI
GET3_CANAL        EIDPEAAMSDLQQQAQQYNND-----PNDP----------LKSIMN-----DMTGSIPGI
GET3_YEAST        EIDPSAALKDMNDMAVSRANNNGSDGQGDD----------LGSLLQGGALADLTGSIPGI
ASNA_GIAIC        EVDASNEMKSAVEAVQKETGSAADNDAESKSEGDMFG--GLNDLITCASSFIKDGTFPGM
ASNA_DICDI        EIDPTPD------QLAPEFMETQSDG---------------------FNLQEFTAAIPGI
F0ZQ05_DICPU      EIDPTPD------QLAPEFIESQGDG---------------------FNLQEFTSAIPGI
D3B3Z0_POLPP      EIDPTPD------HDAPEFINKQNGGG-------------------LMDFQELAMSIPGV
ASNA_HUMAN        EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
I3M8X1_ICTTR      EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
G1M0I7_AILME      EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
ASNA_BOVIN        EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
ASNA_MOUSE        EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
G3V9T7_RAT        EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
H0X6E2_OTOGA      EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
ASNA_DANRE        EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
H3AKV5_LATCH      EIDPS--------LGVAELPDEFFE----ED---------NMLSMGKKMMQEAMSAFPGI
ASNA_XENTR        EIDPS--------LGVAELPDEIFE----ED---------NMLSMGKKMMQEAMSAFPGI
ASNA_NEMVE        EIDPN--------LGFSNLPEDYFE----GP---------DMMSMGKAMISELLGAFPGI
ASNA_AEDAE        EIDPN--------VGLNELPDEYFEG---EN---------SAMKLSKGVFQEIIGALPGI
ASNA_ANOGA        EIDPN--------VGISELPDEYFED---EA---------SPLNVGKGMLQEVIGTLPGI
E0VDM0_PEDHC      EIDPN--------VGFHDLPEEYFEN---ES---------EAMKLSKGIMQEIIGAFPGI
ASNA_DROME        EIDPN--------AGLNELPEEYFDG---EN---------EALRVSKGVMQEMINALPGI
ASNA_DROPS        EIDPN--------AGLNELPEEYFEG---EN---------EALRVSKGVMQEMINALPGI
E9GRY6_DAPPU      EIDPN--------VGFNELPDDYFEG---EN---------NFWRANRGLMQEIFGAFPGI
ASNA_CAEBR        EIDSNPSGEGVEMANIEEMLQNAAQNEGGSG---------NGFAMGKDFLQQFAGGLPGI
ASNA_CAEEL        EIDSNPNGEGVEMGNIEEMLQNAAQNEGGSG----------GFSMGKDFLQSFAGGLPGI
GET3_EMENI        EVDPN--------GSLQDLLANGEGQGDDPM---------AGLG-VGNMMQDLAFSIPGV
GET3_ASPFU        EIDPN--------GSIQDLLASGDSQGDDPL---------AGLG-MGNMMQDLAFSIPGV
GET3_AJECG        EIDPN--------GSIQDLLSTGGDQADDPM---------AGLG-LGGMMQDLAFSIPGV
GET3_PHANO        EIDPN--------GSIQDLLAGGGESGEDAM---------AGLGGMGNMMQDLAFSIPGV
GET3_NEUCR        EIDPN--------GSIQDLLA-GQGENEGAG---------D-MGGVGGMMQDLAFAIPGI
GET3_SCLS1        EIDPN--------GSIQELM--GQAE-EGEG---------P-AAGMGGMMQDLAFAIPGI
C7YRA2_NECH7      EIDPN--------GSIQDMLA-GQGDADDVN---------AAAGGLGGMMQDLAFAIPGI
D5GGF4_TUBMM      EIDPN--------GSIQELIEGAEGS----------------QNPLGNMMQDLAFSIPGV
GET3_YARLI        EIDPS--------GSIQEMIEQAQSAGGA-------------GAGMTNMMQDIAFSIPGV
GET3_COPC7        EIDPT--------SAIQEMVEQSDSNG-----------------MMGSMMQDLAFAIPGV
GET3_CRYNJ        EIDPN--------GSLQEMIESSDQTG-----------------GMGGMMQDLAFAIPGV
GET3_USTMA        EIDPN--------SSIQEMIEQSDSQGG----------------AMGSMMQDLAFAIPGV
E3KVY1_PUCGT      EIDPN--------SSLQEMVEQSESQGGG---------------GMGGMMQDLAFAIPGV
I1CEA3_RHIO9      EIDPT--------SSIQEMIEQSEQNN-----------------PMGGMMQDLAYAIPGV
F4NRV5_BATDJ      EIDPT--------GSIQEMIETQDAGT-------------------QSQLQDLAFAIPGV
GET3_SCHPO        EIDPN--------LSIQEMTEQADQQNPN--------------NPLSGMMQDLAFTIPGI
B9IC86_POPTR      EVDPNVEND-----DIGGNEGMDS------------------------LFSELSNAIPGI
B9GPT9_POPTR      EVDPNVEND-----DIGGSEGMDS------------------------LFSELANAIPGI
F6I363_VITVI      EVDPSVENE-----ELPG-DGMDN------------------------LFSELANAIPGI
Q949M9_ARATH      EVDPTVETD-----DMAGTDGMDG------------------------LFSDLANAIPGI
C5X622_SORBI      EIDPKVEND-----DLSN-EGMEG------------------------FLSELTNAIPGV
A9RXS6_PHYPA      EVDPTVESEDLE--DQANGLGMGG------------------------FVSELANAIPGI
A9T6J9_PHYPA      EVDPTVESEDLE--EQANGLGMGG------------------------FVSELANAIPGI
B7G933_PHATC      EIDASQEAESEI-EATDDNDVFGQ------------------------MFNDLQNSIPGI
B8BXF4_THAPS      EIDATEDLDKMQ-RSMEDATGAGSDDDA---------------SGIQSLMTELTNSIPGI
D0NW99_PHYIT      EIDPNVDLEEMNGDGVQDNSGMAS------------------------FMKDLTNSIPGI
H3G8W6_PHYRM      EIDPNVDLEEMNADGVQDNSGMAS------------------------FMKDLTNSIPGI
ASNA1_PARTE       EIDPTVDPDK---LKLPTLQGFMNDQ------------------ATKSLLSELISSVPGI
ASNA2_PARTE       EIDPTVDPDK---LKLPTLQGFMNDQ------------------ATKSLLSELISSVPGI
I7M036_TETTS      EIDPTIDPNS---LNFPDFEGFETDQS------------------TKNFLSEIISQVPGI
ASNA_BABBO        ELNTSQII-----DGLDGLRETHS---------------------FLKNVPDILMMLPGI
ASNA_THEPA        ELDVTRVA-----DTGFGLNETKM---------------------FLQTIPELFQMLPGI
ASNA_CRYPI        ELDASYQQ-----AVEFKLKEENS--------------------LFSKFLPDLISALPGI
ASNA_TOXGV        EIDSRYQE-----TFDFKMSNLPSAEAA--------------SFSLTSLLPEMLQAVPGI
ASNA_PLABA        EIDTTFSE-----DTAFKINKSDF---------------------FNSIIPELLQSFPGI
ASNA_PLAYO        EIDTTFSE-----DTAFKINQSNF---------------------LNSIIPELLQSFPGI
ASNA_PLACH        EIDTTFSE-----DTAFKINKSDF---------------------LNSIIPELLQSFPGI
ASNA_PLAKH        EIDTTYSE-----NTAFKLNKTEF---------------------FDSIIPELLQSFPGI
ASNA_PLAVS        EIDTTYSE-----NTAFKLNKTEF---------------------FDNIIPELLQSFPGI
ASNA_PLAF7        EIDTNYSE-----NTAFKLNKKEM---------------------FDNILPELLHSFPGI
ASNA_LEIIN        EVDPKNFTHGALMSSLTGTKRDGSASSLPEEAAADAAQHTTTFARIGAVLKEAARTMPGI
ASNA_LEIMA        EVDPKNFTHGALMSSLTGAKSDGSASSLSAEAEADAAQHTASFARIGAVLKEAARTMPGI
ASNA_LEIBR        EVDPKNFTHGALMSSLTGANSGGSASSLSREAEADAVEQTASFARIGAVLKEAARTMPGI
ASNA_TRYCC        EVDPTTFTHGGFGAML------GFPGHIATDADA-----PSPFAALGNILKEAAGTLPGI
                  *::                                                     .**:

ASNA_ENTDS        DEAIAFSKIINQAQQM------------NYDLVLFDTAPTGHTLRFLSLPSVLRDMLEKV
ASNA_ENTHI        DEAIAFSQIINQAQQM------------NYDLVLFDTAPTGHTLRFLSLPTLLRDMLEKV
GET3_CANAL        DEALSFMEVLKHIKNQKVNESDDSKDKISYRTIIFDTAPTGHTLRFLQLPSTLQKLLGKF
GET3_YEAST        DEALSFMEVMKHIKRQEQGEGE------TFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKF
ASNA_GIAIC        DEMWSFINLIKLIDTN------------EYSTVIFDTAPTGHTLRFLELPETVNKVLEIF
ASNA_DICDI        DEAMSFAEVMKLVKSL------------EFSVVVFDTAPTGHTLRLLSIPSLLDKGINKF
F0ZQ05_DICPU      DEAMSFAEVMKLVKSL------------EFSVVVFDTAPTGHTLRLLSIPSLLDKGLNKF
D3B3Z0_POLPP      DEAMSFAEVMKLVQDM------------KFSVIVFDTAPTGHTLRLLSIPSLLDKGIAKF
ASNA_HUMAN        DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
I3M8X1_ICTTR      DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
G1M0I7_AILME      DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
ASNA_BOVIN        DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
ASNA_MOUSE        DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
G3V9T7_RAT        DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
H0X6E2_OTOGA      DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
ASNA_DANRE        DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
H3AKV5_LATCH      DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
ASNA_XENTR        DEAMSYAEVMRLVKGM------------NFSVVVFDTAPTGHTLRLLNFPTIVERGLGRL
ASNA_NEMVE        DEAMSFAEVMRLVNSM------------DFSTVIFDTAPTGHTLRLLSFPSVIEKSLGKI
ASNA_AEDAE        DEAMSYAEVMKLVKAM------------NFSVVVFDTAPTGHTLRLLSFPQVVEKGLGKL
ASNA_ANOGA        DEAMSYAEVMKLVKAM------------NFSVVVFDTAPTGHTLRLLSFPQVVEKGLGKL
E0VDM0_PEDHC      DEAMSYAEVMKLVKSM------------NFSVVVFDTAPTGHTLRLLSFPQVVEKGLGKL
ASNA_DROME        DEAMSYAEVMKLVKGM------------NFSVVVFDTAPTGHTLRLIAFPQVVEKGLGKL
ASNA_DROPS        DEAMSYAEVMKLVKGM------------NFSVVVFDTAPTGHTLRLIAFPQVVEKGLGKL
E9GRY6_DAPPU      DEAMSYVEVMKLVQGM------------NFSVVVFDTAPTGHTLRLLAFPSVVEKGLSKL
ASNA_CAEBR        DEAMSFGEMIKLIDSL------------DFDVVVFDTAPTGHTLRLLQFPTLLEKVFTKI
ASNA_CAEEL        DEAMSFGEMIKLIDSL------------DFDVVVFDTAPTGHTLRLLQFPTLLEKVFTKI
GET3_EMENI        DEAMSFAEVLKQVKSL------------SYEVIVFDTAPTGHTLRFLQFPTVLEKALAKL
GET3_ASPFU        DEAMSFAEVLKQVKSL------------SYEVIVFDTAPTGHTLRFLQFPTVLEKALAKL
GET3_AJECG        DEAMSFAEVLKQVKSL------------SYEVIVFDTAPTGHTLRFLQFPTVLEKALAKL
GET3_PHANO        DEAMSFAEVLKQVKSM------------SYEVIIFDTAPTGHTLRFLQFPTVMEKALSKV
GET3_NEUCR        DEAMSFAEVLKQVKSL------------SYETIIFDTAPTGHTLRFLQFPSVLEKALAKV
GET3_SCLS1        DEAMSFAEVLKQVKSL------------SYETIIFDTAPTGHTLRFLQFPTVLEKALAKV
C7YRA2_NECH7      DEAMSFAEVLKQVKSL------------SYETIIFDTAPTGHTLRFLQFPTVLEKALAKV
D5GGF4_TUBMM      DEAMSFAEVLKQVKSL------------SYSTIVFDTAPTGHTLRFLQFPAVLEKALSKI
GET3_YARLI        DEAMSFAEVLKQVKST------------SYSVIIFDTAPTGHTLRFLTFPTVLEKALGKI
GET3_COPC7        DEAMSFAEIMKHVKSM------------QYSVIVFDTAPTGHTLRFLSFPTVLEKALGKL
GET3_CRYNJ        DEAMGFAEIMKHVKSM------------EFSVIVFDTAPTGHTLRFLSFPSVLEKALGKL
GET3_USTMA        DEAMGFAEIMKHVKSM------------EYSVIVFDTAPTGHTLRFLSFPSVLEKALAKF
E3KVY1_PUCGT      DEAMGFAEIMKHVKSM------------KYSVIVFDTAPTGHTLRFLSFPAVLEKALGKL
I1CEA3_RHIO9      DEAMGFAEVMKQVKTM------------SYSVVVFDTAPTGHTLRFLSFPTVLEKALAKI
F4NRV5_BATDJ      DEAMSFAEVMKLVKSM------------DYSCIVFDTAPTGHTLRFLSFPGVLDNALGKF
GET3_SCHPO        DEALAFAEILKQIKSM------------EFDCVIFDTAPTGHTLRFLNFPTVLEKALGKL
B9IC86_POPTR      DEAMSFAEMLKLVQTM------------GYSCIVFDTAPTGHTLRLLQLPSTLEKGLQKV
B9GPT9_POPTR      DEAMSFAEMLKLVQTM------------DYSCIVFDTAPTGHTLRLLQFPSTLEKGLQKV
F6I363_VITVI      DEAMSFAEMLKLVQTM------------DYSVIVFDTAPTGHTLRLLQFPSTLEKGLAKM
Q949M9_ARATH      DEAMSFAEMLKLVQTM------------DYATIVFDTAPTGHTLRLLQFPATLEKGLSKL
C5X622_SORBI      DEAMSFAEMLKLVQTM------------DYSVVVFDTAPTGHTLRLLQFPATLEKGLEKM
A9RXS6_PHYPA      DEAMSFAEMLKLVQTM------------DYSVIVFDTAPTGHTLRLLQFPSTLEKGLEKV
A9T6J9_PHYPA      DEAMSFAEMLKLVQTM------------DYSVIVFDTAPTGHTLRLLQFPSTLEKGLEKV
B7G933_PHATC      DEAMSFSELMKQVQQL------------DFDVVVFDTAPTGHTLRLLSFPTILEKAFAKV
B8BXF4_THAPS      DEAMSFSELMKQVQNM------------DYDVVVFDTAPTGHTLRLLSFPTILEKAFGKL
D0NW99_PHYIT      DEAMSFAELMKQVQNM------------DYSVIVFDTAPTGHTLRLLSFPTALDKAFDKI
H3G8W6_PHYRM      DEAMSFAELMKQVQNM------------DYSVIVFDTAPTGHTLRLLSFPTALDKAFDKI
ASNA1_PARTE       DEAMSFAELMNSVDEM------------KYDLIIFDTAPTGHTLRLLNFPNIMEKGLNKL
ASNA2_PARTE       DEAMSFAELMNSVDEM------------KYDLIIFDTAPTGHTLRLLNFPNIMEKGLNKL
I7M036_TETTS      DEAMSFSALIKSLDKY------------NFDVVVFDTAPTGHTLRLLNFPNLLEKGIEKI
ASNA_BABBO        DEALSFVELMQSVQSR------------RFSVTIFDTAPTGHTLKFLKLPDVLEKILDSL
ASNA_THEPA        DEALSFSELLQSVQSM------------KYSVIVFDTAPTGHTLKFLNLPDTLDKLLESF
ASNA_CRYPI        DEALGFATLMQSVKSM------------SYSVIVFDTAPTGHTLRLLSFPSLLEKGLSKL
ASNA_TOXGV        DEALSFAELMQNVQSM------------KYSVIVFDTAPTGHTLRLLAFPDLLERGLKKL
ASNA_PLABA        DEALCFAELMQSIKNM------------KYSVIVFDTAPTGHTLRLLAFPDLLKKALGYL
ASNA_PLAYO        DEALCFAELMQSIKNM------------KYSVIVFDTAPTGHTLRLLAFPDLLKKALGYL
ASNA_PLACH        DEALCFAELMQSIRNM------------KYSVIVFDTAPTGHTLRLLAFPDLLKKALGYL
ASNA_PLAKH        DEALCFAELMQSIKNM------------KYSVIVFDTAPTGHTLRLLAFPELLKKALGYL
ASNA_PLAVS        DEALCFAELMQSIKNM------------KYSVIVFDTAPTGHTLRLLAFPELLKKALGYL
ASNA_PLAF7        DEALCFAELMQSIKNM------------KYSVIVFDTAPTGHTLRLLAFPDLLKKALGYL
ASNA_LEIIN        DEISVFAEILHYVRTL------------SYDLLIFDTAPTGHTLRLLALPQTLNSTFDKL
ASNA_LEIMA        DEISVFAEILHYVRTL------------FYDLLIFDTAPTGHTLRLLALPQTLSSTFDKL
ASNA_LEIBR        DEISVFAEILHYVRTL------------SYDLLIFDTAPTGHTLRLLALPQTLNSTFDRL
ASNA_TRYCC        DELSVFAEILRGVQQL------------SYDVVIFDTAPTGHTLRLLALPHTLNSTMEKL
                  **   :  ::.                  :   :**********::: :*  :   :  .

ASNA_ENTDS        IKLQELFGPMMSQFGGIIG---T--------------NIN-FNELKPKMED---------
ASNA_ENTHI        IKLQDSFGPMMSQFGGMMG---M--------------NIN-FNELKPKMEH---------
GET3_CANAL        QQLSGKLGPMMSMLGG------G--------------GQG-QQDMFAKLNE---------
GET3_YEAST        GEITNKLGPMLNSFMG------A--------------GN---VDISGKLNE---------
ASNA_GIAIC        TRLKDNMGGMLSMVMQTMG---L--------------SQNDIFGLIDKTYP---------
ASNA_DICDI        LSMQQNFSGIFNAVSGMMGGN-----------------APSLENMEGKIQS---------
F0ZQ05_DICPU      LSMQNNFSGILSAVSGMMGGN-----------------VPTAEGIESKLQT---------
D3B3Z0_POLPP      --MDNNLSGLFSTFGNVVGSE-----------------HSP-EQINSKISS---------
ASNA_HUMAN        MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
I3M8X1_ICTTR      MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
G1M0I7_AILME      MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
ASNA_BOVIN        MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
ASNA_MOUSE        MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
G3V9T7_RAT        MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
H0X6E2_OTOGA      MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
ASNA_DANRE        MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
H3AKV5_LATCH      MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
ASNA_XENTR        MQIKNQISPFISQMCNMLGLG-----------------DMNADQLASKLEE---------
ASNA_NEMVE        LSLKNSISPFISQFGSLLGMQ-----------------DLNADQMTSKLEE---------
ASNA_AEDAE        LMLKMKLAPFISQMGSLFGMQ-----------------DFNADTLTGKLEE---------
ASNA_ANOGA        LRLKMKLAPIITQMGSLFGVQ-----------------DFNGDTIANKLEE---------
E0VDM0_PEDHC      LRLKMKINPFLSQMSALFGLT-----------------DFNAEIFSTKMED---------
ASNA_DROME        LRLKMKVAPLLSQFVSMLGMA-----------------DVNADTLSQKLDD---------
ASNA_DROPS        LRLKMKVAPLLTQFASMLGMA-----------------DVNVDTLSQKLDD---------
E9GRY6_DAPPU      LRLKSQIGPFISQISGLIGMS-----------------NVNTDIFSNRLEE---------
ASNA_CAEBR        LSLQGMFGPMLNQFGGMFGMG-----------------GGSMNEMIEKMTT---------
ASNA_CAEEL        LSLQGMFGPMMNQFGGMFGMG-----------------GGSMNEMIEKMTT---------
GET3_EMENI        SQLSSQFGPMLNSILGARGGLP---------------GGQNLDELLQKMES---------
GET3_ASPFU        SQLSSQFGPMLNSILGARGGLP---------------GGQNIDELLQKMES---------
GET3_AJECG        SQLSSQFGPMLNSILGARGGLP---------------GGQNLDEILSKMES---------
GET3_PHANO        SQLSRQFGPMLNSFLGGGGRLP---------------NGQNIDELVEKMEA---------
GET3_NEUCR        SQLSSQYGPLLNGFLGSNGTLP---------------NGQNLNEMMEKLET---------
GET3_SCLS1        SQLSTQFGPMLNGLLGANGSLP---------------NGQNLGEMMEKLEG---------
C7YRA2_NECH7      SQLSSQYGPLVNSFLGSGGQLP---------------NGQNLNDMVEKLES---------
D5GGF4_TUBMM      SQLSGKFGPMLNGILGAQGG-P---------------GG--VDEMMQKMEG---------
GET3_YARLI        SELSGRFGPMLGSLMGGQGG-------------------PSADDMFAKLNE---------
GET3_COPC7        STLGSRFGPMISQMSSMMGG-----------------EAGSQEDMFAKLES---------
GET3_CRYNJ        STLGGKFGPMIQQMQSMFGG-----------------GAP-QEDMFAKLES---------
GET3_USTMA        STLGRSLGPMLGQFQSMLGG-----------------GGPNQEDMFAKLES---------
E3KVY1_PUCGT      STLGGRFGPMMQQFGSMMG------------------VNTNTEDMFGKLED---------
I1CEA3_RHIO9      SGLSSRFGPMVQQMSGMMG------------------VNANQEDMFSKLEE---------
F4NRV5_BATDJ      SQLGSRLGPLMQQMGPMMG------------------MDVGQEDIFGKLEG---------
GET3_SCHPO        GGLSSRFGPMINQMGSIMGV------------------NANEQDLFGKMES---------
B9IC86_POPTR      MSLKSKFGGLISQMTRLFGLDD----------------EFGEDAILGRLES---------
B9GPT9_POPTR      MSLKSKFGGLIGQMTRLFGIDD----------------EFGEDAILGRLEG---------
F6I363_VITVI      MSLKNKFGGLLNQMTRLFGVDD----------------EFGEDALLGRLEG---------
Q949M9_ARATH      MSLKSRFGGLMTQMSRMFGMED----------------EFGEDALLGRLEG---------
C5X622_SORBI      MELKNRFGGLLNQASRLFGLGD----------------ELNEDAMLGKLEG---------
A9RXS6_PHYPA      MSLKNKFGGLISQVSRMFGAGD----------------EFGEDALLGKVEN---------
A9T6J9_PHYPA      MSLKSKFGGLIGQVSRMFGAEN----------------EFGEDALLGKVEN---------
B7G933_PHATC      WELKDRFGGLIGQATALMSGGNN--------------PAAAQEQLLGKLEE---------
B8BXF4_THAPS      MDLKDRFGGLIGQASALFGGGS---------------PDQVQAALLGRLEE---------
D0NW99_PHYIT      LSLKNQFSGMFSQVSALLGGAL-----------------PSQEMLLGKLEQ---------
H3G8W6_PHYRM      LSLKNQFSGMFSQVSALLGGAL-----------------PSQEMLLGKLEQ---------
ASNA1_PARTE       VQLRYNFQNLASQFQGLFGSQEE--------------FDQQMNQMFSKIET---------
ASNA2_PARTE       VQLRYNFQNLASQFQGLFGSQEE--------------FDQQMNQMFSKIET---------
I7M036_TETTS      IALKNKFQGILSSIAG----------------------QQNFDKLFGDLEE---------
ASNA_BABBO        LKLENTMGGLLQLFSSMTK------------------AQMSQNELFDKIKL---------
ASNA_THEPA        LKVESLCGVAMKLFSALNN------------------SLP-KEEIFQKLKR---------
ASNA_CRYPI        FSIKQNMSGALQLINSVSG------------------NAIEEETLNSKLED---------
ASNA_TOXGV        STFKDKIQSALQMLNAVSG------------------QQIQEQDFAAKIEN---------
ASNA_PLABA        INLKEKLKGTLSMLQSLTN------------------NEMEFEGMYDKINH---------
ASNA_PLAYO        INLKEKLKGTLNMLQSLTN------------------NEMEFEGMYDKINH---------
ASNA_PLACH        INLKEKLKGTLNMLQSLTS------------------NEMEFEGMYDKINH---------
ASNA_PLAKH        ISLREKLKGTLNMLKSFTN------------------NEVELEGIYEKINH---------
ASNA_PLAVS        INLREKLKGTLNMLKSFTN------------------NEMELEGIYEKINH---------
ASNA_PLAF7        INIREKLKGTLNVLKNFTN------------------NEMEFDSLYEKINH---------
ASNA_LEIIN        MSLEGL-APMIEAASHLIGSNLGDLGGACGDTAGSCEQATAAPSPSSAAPGAGSAAAASP
ASNA_LEIMA        MSLEGL-APMIEAASHLIGTNLGALGGACGDTAGSCEQATAAPSLSSAAPGEGSAAAASS
ASNA_LEIBR        MSLEGL-APMLEAASHLIGSSLGAVGG---DSVSGCEVATAMPSSSSTAPGAGSAATGSS
ASNA_TRYCC        LSVEGL-NTLIQAASAVLSST------------------TNLGDMSSLMPA---------
                    .                                                         

ASNA_ENTDS        -----------------MLKTSEQIVKDFTNPNLTTFIPVLIPEFLPLYETERLIQELMN
ASNA_ENTHI        -----------------MLKTSEQIVEDFTNPNLTTFIPVLIPEFLPLYETERLIQELMN
GET3_CANAL        -----------------VQKNVEEVNEQFTNPDLTTFVCVCISEFLSLYETERMIQELMS
GET3_YEAST        -----------------LKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELIS
ASNA_GIAIC        -----------------KIDVVKRISAEFRDPSLCTFVGVCIPEFLSLYETERLVQRLAV
ASNA_DICDI        -----------------TKKVIEEINIQFKNPDLTTFIPVCIPEFLSVYETERLIQQLTK
F0ZQ05_DICPU      -----------------TKKTIEEINVQFKNPDLTTFIPVCIPEFLSVYETERLIQQLTK
D3B3Z0_POLPP      -----------------IKKTIEEVNIQFKNPDVTTFVPVCIPEFLSLYETERLIQQLTK
ASNA_HUMAN        -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
I3M8X1_ICTTR      -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
G1M0I7_AILME      -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
ASNA_BOVIN        -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
ASNA_MOUSE        -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
G3V9T7_RAT        -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
H0X6E2_OTOGA      -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
ASNA_DANRE        -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
H3AKV5_LATCH      -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
ASNA_XENTR        -----------------TLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
ASNA_NEMVE        -----------------TLPVIKQVSAQFKNPDHTTFVCVCIAEFLSLYETERLIQELTK
ASNA_AEDAE        -----------------MLTIIRQVNEQFRNPDQTTFVCVCIAEFLSLYETERLVQELTK
ASNA_ANOGA        -----------------MLSIIQQVNEQFHNPQQTTFVCVCIAEFLSLYETERLVQELTK
E0VDM0_PEDHC      -----------------MLAVIHQVNEQFRDPDQTTFVCVCIAEFLSLYETERLVQELTK
ASNA_DROME        -----------------MLRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLVQELTK
ASNA_DROPS        -----------------MLRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLIQELTK
E9GRY6_DAPPU      -----------------MLPIIQQINEQFKDPNRTTFVCVCIAEFLSLYETERLVQELSK
ASNA_CAEBR        -----------------TLESVKKMNGQFKDPNCTTFVCVCIAEFLSLYETERLIQELTK
ASNA_CAEEL        -----------------TLESVKKMNAQFKDPNCTTFVCVCIAEFLSLYETERLIQELSK
GET3_EMENI        -----------------LRETIGEVNTQFKNPDMTTFVCVCIAEFLSLYETERMIQELTS
GET3_ASPFU        -----------------LRETISEVNTQFKNPDMTTFVCVCIAEFLSLYETERMIQELTS
GET3_AJECG        -----------------LRETIGEVNAQFKDADLTTFVCVCIAEFLSLYETERMIQELTS
GET3_PHANO        -----------------LRGTISEVNGQFKDADLTTFVCVCIPEFLSLYETERMIQELNS
GET3_NEUCR        -----------------LRATISEVNTQFKDERLTTFVCVCIPEFLSLYETERMIQELAS
GET3_SCLS1        -----------------LRETISEVNGQFKDENLTTFVCVCIPEFLSLYETERMIQELSS
C7YRA2_NECH7      -----------------LRETISEVNTQFQDAELTTFVCVCIAEFLSLYETERMIQELAG
D5GGF4_TUBMM      -----------------MREVIGEVSKQFKDPDLTTFICVCIPEFLSLYETERMIQELNN
GET3_YARLI        -----------------TRATISEVNTQFKNPDLTTFVCVCIPEFLSLYETERMVQDLTS
GET3_COPC7        -----------------MRAVITEVNTQFKDPEKTTFVCVCISEFLSLYETERLVQELTA
GET3_CRYNJ        -----------------MREIITEVNNQFKDPEKTTFVCVCISEFLSLYETERLIQELTS
GET3_USTMA        -----------------MREVITEVNTQFKDPEKTTFVCVCIAEFLSLYETERLIQELTS
E3KVY1_PUCGT      -----------------MRAVITEVNNQFKDPDLTTFICVCISEFLSLYETERLIQELTQ
I1CEA3_RHIO9      -----------------MRSVINEVNKQFKDPNITTFVCVCISEFLSLYETERMIQELTS
F4NRV5_BATDJ      -----------------MRETIQEVNSQFQNPNKTTFVCVCIAEFLSLYETERMIQELTS
GET3_SCHPO        -----------------MRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQELTS
B9IC86_POPTR      -----------------MKDVIEKVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELAK
B9GPT9_POPTR      -----------------MKDVIEQVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTK
F6I363_VITVI      -----------------MKDVIEQVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELNK
Q949M9_ARATH      -----------------LKDVIEQVNRQFKDPDMTTFVCVCIPEFLSLYETERLVQELAK
C5X622_SORBI      -----------------MKDVIEQVNRQFKDPDLTTFVCVCIPEFLSLYETERLVQELAK
A9RXS6_PHYPA      -----------------IKAVIEQVNNQFRNPDMTTFICVCIPEFLSLYETERLVQELAR
A9T6J9_PHYPA      -----------------IKAVIEQVNYQFRNPDMTTFICVCIPEFLSLYETERLVQELAR
B7G933_PHATC      -----------------TRAVINKVNQAFQDPTKTTFVCVCIPEFLSIYETERLVQELSK
B8BXF4_THAPS      -----------------TREIINKVNTAFQDPALTTFVCVCIPEFLSIYETERLVQELSK
D0NW99_PHYIT      -----------------TREVIQKVNAQFKDPERTTFVCVCIPEFLSLYETERLVQELTK
H3G8W6_PHYRM      -----------------TREVIQKVNAQFKDPERTTFVCVCIPEFLSLYETERLVQELTK
ASNA1_PARTE       -----------------MKDTVTKVNAQMKDRNKTTFIGVCIPEFLSMYETERLVQELTK
ASNA2_PARTE       -----------------MKDTVTKVNAQMKDKNKTTFIGVCIPEFLSMYETERLVQELTK
I7M036_TETTS      -----------------KKKTVQLVVNQMKDPNRTTFVAVCIPEFLSMYETDRLVYELAK
ASNA_BABBO        -----------------LGDMINTTHEQMKNPDLTTFICVCIPEFLSVYETERLIQDLAK
ASNA_THEPA        -----------------FKSNLTLIMNQMKDPNRTTFVCVCIPEFLSVYETERLIQSLAK
ASNA_CRYPI        -----------------LKAITTSVKETFQDPSKTTFVCVCIPEFLSVYETERLIQELAK
ASNA_TOXGV        -----------------LKAVTTSVREAFQDPAHTTFVCVCIPEFLSVYETERLVQELAK
ASNA_PLABA        -----------------LNTMSISIQENFQNPLKTTFVCVCIPEFLSVYETERLIQELTK
ASNA_PLAYO        -----------------LNTMSISIQENFQNPLKTTFVCVCIPEFLSVYETERLIQELTK
ASNA_PLACH        -----------------LNTMSISIQENFQNPLKTTFVCVCIPEFLSVYETERLIQELTK
ASNA_PLAKH        -----------------LNAMSISIQSNFQNPLKTTFVCVCIPEFLSVYETERLIQELTK
ASNA_PLAVS        -----------------LNAMSISIQSNFQNPLKTTFVCVCIPEFLSVYETERLIQELTK
ASNA_PLAF7        -----------------LNAMSSSIQANFQNPMKTTFVCVCIPEFLSVYETERLIQELTK
ASNA_LEIIN        QSRWCITADEVRSTALHWRQTMEEVQARFSDPNRTSFVCVCIAEFLSVYETERLVQELMK
ASNA_LEIMA        QSRWCITADEVRSTALHWRQTMEEVQARFNDPNRTSFVCVCIAEFLSVYETERLVQELMK
ASNA_LEIBR        QGSWSITADEVRAKALHWRQVMEEVQDRFNDPSRTSFVCVCIAEFLSVYETERLVQELMK
ASNA_TRYCC        --------------FKQWRENVQEVQRQFTDAEKTAFICVCIPEFLSVYETERLVQELMK
                                              : :    :*: * *.**:.:***:*::  *  

ASNA_ENTDS        LNMDVNSIIVNQILPVNDC-----------------------------------------
ASNA_ENTHI        LNMDANSIIVNQILPVNDC-----------------------------------------
GET3_CANAL        YQMDVNSIVVNQLLFADDD-E---------------------------------------
GET3_YEAST        YDMDVNSIIVNQLLFAENDQE---------------------------------------
ASNA_GIAIC        LDMDCHAIVINFVLDANAA-----------------------------------------
ASNA_DICDI        LDIDVHNVIVNQIVYPE-------------------------------------------
F0ZQ05_DICPU      LDIDVRDIIVNQIVYPE-------------------------------------------
D3B3Z0_POLPP      LDMDVQNIIVNQIVYPE-------------------------------------------
ASNA_HUMAN        CKIDTHNIIVNQLVFPD-------------------------------------------
I3M8X1_ICTTR      CKIDTHNIIVNQLVFPD-------------------------------------------
G1M0I7_AILME      CKIDTHNIIVNQLVFPD-------------------------------------------
ASNA_BOVIN        CKIDTHNIIVNQLVFPD-------------------------------------------
ASNA_MOUSE        CKIDTHNIIVNQLVFPD-------------------------------------------
G3V9T7_RAT        CKIDTHNIIVNQLVFPD-------------------------------------------
H0X6E2_OTOGA      CKIDTHNIIVNQLVFPD-------------------------------------------
ASNA_DANRE        CRIDTHNIIVNQLVFPD-------------------------------------------
H3AKV5_LATCH      CRIDTHNIVVNQLVFPD-------------------------------------------
ASNA_XENTR        CSIDTHNIIVNQLVFPE-------------------------------------------
ASNA_NEMVE        SEIDTHNIIVNQLVFPS-------------------------------------------
ASNA_AEDAE        CGIDTHNIIVNQLLFRR---E---------------------------------------
ASNA_ANOGA        CGIDTHNIIVNQLMFQK---K---------------------------------------
E0VDM0_PEDHC      CGIDTHNIIVNQLLFPL---K---------------------------------------
ASNA_DROME        CGIDVHNIIVNQLLFLQ---N---------------------------------------
ASNA_DROPS        CGIDVHNIIVNQLLFLN---N---------------------------------------
E9GRY6_DAPPU      SNIDTHNIIVNQLLLDTPITS---------------------------------------
ASNA_CAEBR        QGIDTHNIIVNQLLFPDTDES---------------------------------------
ASNA_CAEEL        QGIDTHNIIVNQLLFPDTDAN---------------------------------------
GET3_EMENI        YQIDTHAIVVNQLLFPK-------------------------------------------
GET3_ASPFU        YGIDTHAIVVNQLLFPK-------------------------------------------
GET3_AJECG        YQIDTHCIVVNQLLFPG-------------------------------------------
GET3_PHANO        YEIDTHSIVVNQLLFPK-------------------------------------------
GET3_NEUCR        YGIDTHSIVVNQLLFPK-------------------------------------------
GET3_SCLS1        YHIDTHCIVVNQLLFPK-------------------------------------------
C7YRA2_NECH7      YGIDTHSIVVNQLLFPK-------------------------------------------
D5GGF4_TUBMM      YQIDTHSIVVNQLLFPQ-------------------------------------------
GET3_YARLI        FDIDTHNIVVNQLLYPK-------------------------------------------
GET3_COPC7        YEIDTHNIVVNQLLFPK-------------------------------------------
GET3_CRYNJ        YEIDTHNIVVNQLLFPK-------------------------------------------
GET3_USTMA        YEIDTHAIVCNQLLYPK-------------------------------------------
E3KVY1_PUCGT      YEIDTHCIVVNQLLFPK-------------------------------------------
I1CEA3_RHIO9      YHIDTHNIIVNQLLFPK-------------------------------------------
F4NRV5_BATDJ      FHIDTHNIVVNQLLYPK-------------------------------------------
GET3_SCHPO        YEIDTHNIVVNQLLL-D-------------------------------------------
B9IC86_POPTR      VEIDTHNIIINQVLYDEEDVE---------------------------------------
B9GPT9_POPTR      FEIDTHNIIINQVLYDEEDVE---------------------------------------
F6I363_VITVI      FEIDSHNVIINQVLYDEEVVE---------------------------------------
Q949M9_ARATH      FEIDTHNIIINQVLYDDEDVE---------------------------------------
C5X622_SORBI      FEIDSHNIIINQVIFDEEAVE---------------------------------------
A9RXS6_PHYPA      FEIDTHNIIINQVLFQPDVSD---------------------------------------
A9T6J9_PHYPA      FEIDTHNIIINQVLFQPDVSD---------------------------------------
B7G933_PHATC      YGIDSHNIVVNQVLFPEKDAEELSAWYEANGATLPK------------------------
B8BXF4_THAPS      FGIDSHNIVVNQVLFPEKDAEE--------------------------------------
D0NW99_PHYIT      YEIDVHNVVVNQVLYPEE------------------------------------------
H3G8W6_PHYRM      YEIDVHNVVVNQVLYPEE------------------------------------------
ASNA1_PARTE       FKIDIHNIVINQVLFPD-------------------------------------------
ASNA2_PARTE       FKIDIHNIVINQVLFPD-------------------------------------------
I7M036_TETTS      YEIDIQNIVINQVLYPN-------------------------------------------
ASNA_BABBO        SEIDCSYIIVNQVLKHIQLGGLI-----EDAWDGLT------------------------
ASNA_THEPA        TDIDCSYIIVNQVLSYINLEEHVKNT--QNSLENLS------------------------
ASNA_CRYPI        QSISCSHIVVNQVMFPIDLPS--GNDQGESVLKDSS--------ELLKLEDIPSDHSKLV
ASNA_TOXGV        QKIDCSNIVVNQVLFPVGGVQDEGCRPPASLLASADAETPAPLEELLAPPAARGEKETAQ
ASNA_PLABA        KNISCYNIVVNQVVFPLTSPD-VNIEKCEKLLKQIK------------------------
ASNA_PLAYO        KNISCYNIVVNQVVFPLICPD-ANIEKCENLLKQIK------------------------
ASNA_PLACH        KNISCYNIVVNQVVFPLTSQD-ANIESCEGLLKQIK------------------------
ASNA_PLAKH        KNISCYNIVVNQVVFPLDCPT-VNVSHCEGLLKQIK------------------------
ASNA_PLAVS        KNISCYNIVVNQVVFPLDSMT-VDVAHCEGLLKQIK------------------------
ASNA_PLAF7        KNISCYNIVVNQVVFPLDSPN-VNLENCKNLLSQIK------------------------
ASNA_LEIIN        YNIGCDSIVVNQLVLKPS------------------------------------------
ASNA_LEIMA        YNIGCDSIVVNQLVLKPS------------------------------------------
ASNA_LEIBR        YNIGCDSIVVNQLVLKPS------------------------------------------
ASNA_TRYCC        YDISCDSIVVNQLVLKPS------------------------------------------
                    :.   :: * ::                                              

ASNA_ENTDS        --------------------CDYCKNKRSVQAKYLGQIDVLY-SDFHLIKINMQTNEVRG
ASNA_ENTHI        --------------------CDYCKNKRAIQAKYLGQIDVLY-GDFHLIKINMQTNEVRG
GET3_CANAL        ------------------NPCKRCVARWKMQKKYLDQMAELY-EDYHLVKMPLLGSEIRG
GET3_YEAST        ------------------HNCKRCQARWKMQKKYLDQIDELY-EDFHVVKMPLCAGEIRG
ASNA_GIAIC        ------------------TPCSMCRSRARMQNKYIDQINELY-DDFNIVLSPLRHDEVRG
ASNA_DICDI        ------------------KDCSLCNARQKMQKKYLDQIADLY-FDFHVTKLPLLKAEVRG
F0ZQ05_DICPU      ------------------NDCNLCSARQKMQKKYLDQIEELY-YDFHVTKLPLLKAEIRG
D3B3Z0_POLPP      ------------------NECGLCHARSKMQKKYIDQMADLY-MDFHVTKMPLLKAEIRG
ASNA_HUMAN        ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
I3M8X1_ICTTR      ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
G1M0I7_AILME      ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
ASNA_BOVIN        ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
ASNA_MOUSE        ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
G3V9T7_RAT        ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
H0X6E2_OTOGA      ----------------PEKPCKMCEARHKIQAKYLDQMEDLY-EDFHIVKLPLLPHEVRG
ASNA_DANRE        ----------------NERPCKMCEARHKIQSKYLDQMEDLY-EDFHIVKLPLLPHEVRG
H3AKV5_LATCH      ----------------PDKPCRMCEARNKIQSKYLDQMEDLY-EDFHIVKLPLLPHEVRG
ASNA_XENTR        ----------------PEKPCRMCEARHKIQSKYLDQMEDLY-EDFHIAKLPLLPHEVRG
ASNA_NEMVE        ----------------KREECNLCEARYRIQHKYLDQIQDLY-EDFHVTRLPLLTHEVRG
ASNA_AEDAE        ----------------GQAPCAMCSARYKVQGKYLDQIADLY-EDFYVVKLPLLDKEVRG
ASNA_ANOGA        ----------------GQQPCSMCSARCKVQEKYLDQIADLY-EDFHVVRLPLLDEEVRG
E0VDM0_PEDHC      ----------------NEEPCRMCSARHKVQNKYLDQIADLY-EDFHVTKLPLLDKEVRG
ASNA_DROME        ----------------SHDSCSMCASRFKIQEKYLDQIADLY-EDFHVTKLPLLEKEVRG
ASNA_DROPS        ----------------SHSACKMCASRYKIQEKYLDQIADLY-EDFHVTKLPLLEKEVRG
E9GRY6_DAPPU      ----------------TGETCGLCGARKKLQAKYLDQIADLY-EDFHVTRLPLLDREVRG
ASNA_CAEBR        ----------------GKITCRKCGSRQAIQSKYLSEIDELY-EDFHVVKLPLLESEVRG
ASNA_CAEEL        ----------------GTVSCRKCASRQAIQSKYLTDIDELY-EDFHVVKLPLLEAEVRG
GET3_EMENI        ----------------QGSDCEQCNARRKMQKKYLEQIEELY-EDFNVVRMPLLVEEVRG
GET3_ASPFU        ----------------EGSGCEQCNARRKMQKKYLEQIEELY-EDFNVVRMPLLVEEVRG
GET3_AJECG        ----------------KDSSCEQCKARRKMQKKYLNEIEDLY-EDFNVVRMPMLVEEVRG
GET3_PHANO        ----------------QDNPCEQCNARRKMQKKYLEQIEELY-DEFNVVKMPLLVEEVRG
GET3_NEUCR        ----------------PGSDCEQCTARRKMQKKYLDQIEELY-DEFNVVKMPLLVEEVRG
GET3_SCLS1        ----------------KGSDCDQCNARRKMQKKYLEQIEELY-DEFNVVKMPLLVEEVRG
C7YRA2_NECH7      ----------------KASDCDQCNARRKMQRKYLDQYEELYAEDFNVVKMPLLVEEVRG
D5GGF4_TUBMM      ----------------KGSTCEQCTARRRMQKKYLEQIEELY-EDFNVVKCPLLVEEVRG
GET3_YARLI        ----------------KGDDCELCSSRYKMQQKYLEQILDLY-EDFHIVRLPQQTQEVRG
GET3_COPC7        ----------------KSSNCEHCSVRHKMQQKYLAEAHELYDEFFHIVKLPLLTEEVRG
GET3_CRYNJ        ----------------AGDNCEQCSVRHNMQQKYLKEAYDLYEDEFHIVKLPLLTEEVRG
GET3_USTMA        ----------------KDSNCQHCRVRKQMQDKYVGEMMELYADDFHIVKMPLLTEEVRG
E3KVY1_PUCGT      ----------------ANSDCDQCNTRYKMQRKYLREINDLYIEDFHIVKMPLLTEEVRG
I1CEA3_RHIO9      ----------------NDSNCEHCTVRHKMQQKYLDQIYDLY-EDFHIVRMPLLTKEVRG
F4NRV5_BATDJ      ----------------SGSNCEQCLVRAKMQAKYLEEIDELY-EDFHVVKMPLLTHEIRG
GET3_SCHPO        ----------------PNTTCPQCMARRKMQQKYLAQIEELY-EDFHVVKVPQVPAEVRG
B9IC86_POPTR      --------------------SKLLKARMRMQKKYLDQFYMLY-DDFNITKLPLLPQEVTG
B9GPT9_POPTR      --------------------SKLLKARMRMQQKYLDQFYMLY-DDFNITKLPLLPQEVTG
F6I363_VITVI      --------------------SKLLKARMRMQQKYLDQFYMLY-DDFHITKLPLLPEEVCG
Q949M9_ARATH      --------------------SKLLRARMRMQQKYLDQFYMLY-DDFNITKLPLLPEEVTG
C5X622_SORBI      --------------------SKLLKARIKMQQKYIDQFHMLY-DDFNISKLPLLSEEVCG
A9RXS6_PHYPA      --------------------SKLLQARVRMQQKYLDQFHELY-EDFNITKLPLLPEEVRG
A9T6J9_PHYPA      --------------------SKLLQARVRMQQKYLDQFHELY-EDFNITKLPLLPEEVRG
B7G933_PHATC      ---------------EAREICSKLLARKRMQDKYIGQCFDLYGDDFHVVLMPLLDYEVRG
B8BXF4_THAPS      ------------------EICSKMMARKRMQDKYIGQCFDLYGDDFHVVLMPLLDHEVRG
D0NW99_PHYIT      -----------------GSTCKSCNARQKMQQKYIDQIYDLY-EDFHVVEMPLLTEEVRG
H3G8W6_PHYRM      -----------------GSSCKSCNARQKMQQKYIDQIYDLY-EDFHVVEMPLLTEEVRG
ASNA1_PARTE       ------------------DQCKMCNARAKMQKKYLDQMIDLY-DDFHVVIMPLQENEVRG
ASNA2_PARTE       ------------------DQCKMCNARAKMQKKYLDQMIDLY-DDFHVVIMPLQENEVRG
I7M036_TETTS      ------------------ETCKMCRSRAKMQKKYMDQILELY-EDLHVVIVPLQESEVRG
ASNA_BABBO        ---EEQQRIMTPFFEKVREHHSTHNSRVDVQRKYLSDIKDLYQEDFNIVAVHQNKQEVRG
ASNA_THEPA        ---PENKKVLDCFFELVLEQQNNLNGRLSIQRKYIEDIKQLYEGFFNIVAIKQYKYEVRG
ASNA_CRYPI        EFTEKIVCSYNKLLSYSKLLYSKYYSKRNMQMKYLEQIRDLYSYDFHVAYIPTLNNEVSK
ASNA_TOXGV        EENARLRQLIRRMQIRLLALEKSYHSRRAMQSRYLQQIQDLYSFDFHVVPIPQQPEEVRG
ASNA_PLABA        --DTNIQNSFNSLILKAKELEDVYISRRKLQSKYLTQIKNLYGNYFHIVCMPQLKTEIRG
ASNA_PLAYO        --DTNIQDSFNTLILKAKELEDVYISRRKLQSKYLTQIKNLYGNYFHIVCMPQLKTEIRG
ASNA_PLACH        --DTNIKDSFSSLILKAKELEDVYISRRKLQSKYLTQIKNLYGNYFHIVCMPQLKSEIRG
ASNA_PLAKH        --DKKIQESFSSLVQKTKELEDVYISRRKLQSKYLTQIKNLYGNDFHIVCMPQLKSEIRG
ASNA_PLAVS        --DKQVQESFSSLVQKTKELEDVYISRRKLQSKYLTQIKNLYGNDFHIVCMPQLKSEIRG
ASNA_PLAF7        --NEQIQSYFNDLISKTEELEDVYISRRKLQSKYLTQIKNLYSNDFHIVCMPQLKNEIRG
ASNA_LEIIN        ----------------SEPPCRMCSARQKIQAKYLEQIDLLY-EDFHVVKMPLLSDEVRG
ASNA_LEIMA        ----------------SEPPCRMCSARQKIQAKYLEQIDLLY-EDFHVVKMPLLSDEVRG
ASNA_LEIBR        ----------------SEPPCRMCAARQKIQTKYLEQIDLLY-DDFHVVKMPLLSDEVRG
ASNA_TRYCC        ----------------SEPDCRMCNARQKIQSKYLAQIDSLY-EDFHVVKMPLLSDEVRG
                                            :  :* :*: :   **     :        *:  

ASNA_ENTDS        VPALCAFSKNFEAKH---------------------------------------------
ASNA_ENTHI        VAALRAFSKNFEAKH---------------------------------------------
GET3_CANAL        VENLKKFSKFLIKPYDPKVDRGIITDLKEQ------------------------------
GET3_YEAST        LNNLTKFSQFLNKEYNPITDGKVIYELEDKE-----------------------------
ASNA_GIAIC        IANLRDYAETLIKPYRFCWSANPDPSSAK-------------------------------
ASNA_DICDI        VPSLKLFSELLIKPYDPSTPLVLPNQEN--------------------------------
F0ZQ05_DICPU      VPSLKLFSELLVKPYDPSHPLVLPNQEK--------------------------------
D3B3Z0_POLPP      VPSLTIFSELLTVPYDPSKPVVLPTENQ--------------------------------
ASNA_HUMAN        ADKVNTFSALLLEPYKPPSAQ---------------------------------------
I3M8X1_ICTTR      ADKVNTFSALLLEPYKPPSAQ---------------------------------------
G1M0I7_AILME      ADKVNTFSALLLEPYKPPSAQ---------------------------------------
ASNA_BOVIN        ADKVNTFSALLLEPYKPPSAQ---------------------------------------
ASNA_MOUSE        ADKVNTFSALLLEPYKPPSTQ---------------------------------------
G3V9T7_RAT        ADKVNTFSALLLEPYKPPSTQ---------------------------------------
H0X6E2_OTOGA      ADKVNTFSALLLEPYKPPSTQ---------------------------------------
ASNA_DANRE        ADKVNTFSKQLLEPYSPPKK----------------------------------------
H3AKV5_LATCH      ADKVNTFSNLLLEPYKPPSK----------------------------------------
ASNA_XENTR        AENVNTFSKLLLEPYKPPSGK---------------------------------------
ASNA_NEMVE        VDKILNFSSNLVTPYKP-------------------------------------------
ASNA_AEDAE        VENVKKFSEYLIKPYCPNGTNETQEQDK--------------------------------
ASNA_ANOGA        VEKVKKFSRNLLVPYSPDAPPATE------------------------------------
E0VDM0_PEDHC      AEQVKSFSENLVIPYKTE------------------------------------------
ASNA_DROME        PESIRSFSENLMKPYNPKGEPKE-------------------------------------
ASNA_DROPS        PDSIKAFSENLMTPYDPKAKPKE-------------------------------------
E9GRY6_DAPPU      VEQVKKFSENLLKPYSPK------------------------------------------
ASNA_CAEBR        GPEILKFSERMVHPEKNTNQ----------------------------------------
ASNA_CAEEL        GPAILQFSERMVDPEANKN-----------------------------------------
GET3_EMENI        KEKLEKFSDMLINPYVPPN-----------------------------------------
GET3_ASPFU        KEKLEKFSEMLVHPYVPPQ-----------------------------------------
GET3_AJECG        KEKLEKFSDMLVNPYVPPEE----------------------------------------
GET3_PHANO        KEKLEK------------------------------------------------------
GET3_NEUCR        KEKLEKFSEMLVKPFVPPQ-----------------------------------------
GET3_SCLS1        KERLEKFSEMLITPYVPPAGGL--------------------------------------
C7YRA2_NECH7      KEKLEKFSEMLVTPYVPPE-----------------------------------------
D5GGF4_TUBMM      SDKLRKFSEMLVTPYDAPAED---------------------------------------
GET3_YARLI        VQALEKFSNLLVHPYQHIEN----------------------------------------
GET3_COPC7        PEKLKEFSEMLVKPYQPPQD----------------------------------------
GET3_CRYNJ        VEKIKEFSKMLTQPYTPPQ-----------------------------------------
GET3_USTMA        TDKLKDFSNFLVTPYVPPTE----------------------------------------
E3KVY1_PUCGT      GEKIKSFSKMLVNPYKPPSSQIL-------------------------------------
I1CEA3_RHIO9      VEEIKEFSKMLVEPFQEKK-----------------------------------------
F4NRV5_BATDJ      VDRIKTFSEMLIHPYVPENSK---------------------------------------
GET3_SCHPO        TEALKSFSEMLVKPYVYPTSGKE-------------------------------------
B9IC86_POPTR      VESLKAFSRNFISPYQPSTSRGT-----VEDVERRISTLKLQLEDTEAELDRHRKGKQKV
B9GPT9_POPTR      VEALRALSSHFTSPYQPSTSRSA-----VEDLERRISTLKLQLEHAEAELDRLQKGKQKV
F6I363_VITVI      VEALKAFSHNFITPYQPVIEKGT-----MEELEARVSMLKQQLTDAEAELERLRKGKQKQ
Q949M9_ARATH      VEALKAFSHKFLTPYHPTTSRSN-----VEELERKVHTLRLQLKTAEEELERVKSG----
C5X622_SORBI      VQALQNFSQHFLTPYKSNLKRGT-----IEELEQRITLLKSALQEAEAELDRVRKGKQSA
A9RXS6_PHYPA      VESLKSFSRNLTTPYVPEPATDSVDSQRIRELEAEVASLQATCKGLQSELLKLKEGC---
A9T6J9_PHYPA      VESLKSFAKNLTKPYVPEPARESTGAERIRELETEVLSLRAEVSNLQLELEKLRGGH---
B7G933_PHATC      VEKLKTFSELLVDPVDMDE-----------------------------------------
B8BXF4_THAPS      VEKLKDFSELLINPIDLEE-----------------------------------------
D0NW99_PHYIT      VPALKTFSENLLAPYEHVYTSI--------------------------------------
H3G8W6_PHYRM      VPSLTAFSENLLAPYEPNQ-----------------------------------------
ASNA1_PARTE       IDGLKQFCELLLKPKSVPQF----------------------------------------
ASNA2_PARTE       IDGLKQFCELLLKPKTVPQV----------------------------------------
I7M036_TETTS      VENLKKFCQLLLTQQEIPKIPE--------------------------------------
ASNA_BABBO        KDALVAFAKKLMQHSPLPI-----------------------------------------
ASNA_THEPA        SEAIKEFSKALLKHSPIPDS----------------------------------------
ASNA_CRYPI        IRVLIS------------------------------------------------------
ASNA_TOXGV        IERLLRFGDLLSSCRPLPILPPAPSSP---------------------------------
ASNA_PLABA        LDKISNFSEMLLQSKDIPIYST--------------------------------------
ASNA_PLAYO        LDKISNFSEMLLQSKDIPIYSPQ-------------------------------------
ASNA_PLACH        LDKIASFSEMLLQSKDIPIYSPQ-------------------------------------
ASNA_PLAKH        LENISNFSEMLLESKDIPIYRSEG------------------------------------
ASNA_PLAVS        LQNISNFSEMLLESKEIPIYR---------------------------------------
ASNA_PLAF7        LNNISSFSEMLLQSKDIPIYKDNL------------------------------------
ASNA_LEIIN        VPALKKFARFLQEPYSPETHGYIDVQEPC-------------------------------
ASNA_LEIMA        VPALKKFARFLQEPYSPDTHGYIDVQEPC-------------------------------
ASNA_LEIBR        IPALKMFARFLQEPYNPDTHGYIDVQESC-------------------------------
ASNA_TRYCC        VPALQRFAQFLLEPYDADRHGYIDVCGAAS------------------------------
                     :                                                        

ASNA_ENTDS        --------
ASNA_ENTHI        --------
GET3_CANAL        --------
GET3_YEAST        --------
ASNA_GIAIC        --------
ASNA_DICDI        --------
F0ZQ05_DICPU      --------
D3B3Z0_POLPP      --------
ASNA_HUMAN        --------
I3M8X1_ICTTR      --------
G1M0I7_AILME      --------
ASNA_BOVIN        --------
ASNA_MOUSE        --------
G3V9T7_RAT        --------
H0X6E2_OTOGA      --------
ASNA_DANRE        --------
H3AKV5_LATCH      --------
ASNA_XENTR        --------
ASNA_NEMVE        --------
ASNA_AEDAE        --------
ASNA_ANOGA        --------
E0VDM0_PEDHC      --------
ASNA_DROME        --------
ASNA_DROPS        --------
E9GRY6_DAPPU      --------
ASNA_CAEBR        --------
ASNA_CAEEL        --------
GET3_EMENI        --------
GET3_ASPFU        --------
GET3_AJECG        --------
GET3_PHANO        --------
GET3_NEUCR        --------
GET3_SCLS1        --------
C7YRA2_NECH7      --------
D5GGF4_TUBMM      --------
GET3_YARLI        --------
GET3_COPC7        --------
GET3_CRYNJ        --------
GET3_USTMA        --------
E3KVY1_PUCGT      --------
I1CEA3_RHIO9      --------
F4NRV5_BATDJ      --------
GET3_SCHPO        --------
B9IC86_POPTR      --------
B9GPT9_POPTR      --------
F6I363_VITVI      VGKFCCYL
Q949M9_ARATH      --------
C5X622_SORBI      --------
A9RXS6_PHYPA      --------
A9T6J9_PHYPA      --------
B7G933_PHATC      --------
B8BXF4_THAPS      --------
D0NW99_PHYIT      --------
H3G8W6_PHYRM      --------
ASNA1_PARTE       --------
ASNA2_PARTE       --------
I7M036_TETTS      --------
ASNA_BABBO        --------
ASNA_THEPA        --------
ASNA_CRYPI        --------
ASNA_TOXGV        --------
ASNA_PLABA        --------
ASNA_PLAYO        --------
ASNA_PLACH        --------
ASNA_PLAKH        --------
ASNA_PLAVS        --------
ASNA_PLAF7        --------
ASNA_LEIIN        --------
ASNA_LEIMA        --------
ASNA_LEIBR        --------
ASNA_TRYCC        --------