CLUSTAL format seed alignment for MF_03113

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GET1_ASPTN        ----------MLSLIWTVFFVHVAIYLINTIGASTIDGLLWLLYLKLPTSTS--KCAQEQ
GET1_PENRW        ----------MLSLVLTVFFVHVAIYLVNTIGASTIDSLLWLLYLKLPTPTS--RTARKQ
GET1_ASPFU        ----------MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTS--RNARQQ
GET1_ASPFC        ----------MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTS--RNARQQ
GET1_NEOFI        ----------MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTS--KNAREQ
GET1_ASPCL        ----------MLSLILTIFFVHVAIYLVNTAGASTIDTALWALYLKLPTSTA--KNAREQ
GET1_ASPFN        ----------MLSLIWTIFFLHVAIYVVNTAGASTIDSLLWLLYLKLPTSTS--KNAREQ
GET1_ASPOR        ----------MLSLIWTIFFLHVAIYVVNTAGASTIDSLLWLLYLKLPTSTS--KNAREQ
GET1_ASPNC        ----------MLSLLWSVFLVHVAIYLVNTIGASTIDNLLWLLYLKVPTSTS--KKYKEQ
GET1_EMENI        ----------MISLIWTIFILHIAIFLVNTIGAATIDNLLWLLYLKLPTSLY--QTAQEQ
GET1_TALMQ        ----------MISFLLLIFLIQLAIYIVNTIGSSTIDDLLWILYLRLPMPIS--KDTRKH
GET1_TALSN        ----------MISFLLLIFLIQLAIYIVNTIGASTVDDLLWILYLRLPSSIS--KDARKH
GET1_AJECG        ----------MPSLLITVLFLNVIIYVVNTVGAATVDGLLWLLYIQLPTGTS--QIAREQ
GET1_AJECH        ----------MPSLLITALFLNVIIYVINTVGAATVDGLLWLLYIQLPTGTS--QIAREQ
GET1_AJECN        ----------MPSLLITVLFLNVIIYVINTVGAATVDGLLWLLYIKLPTGTS--QIAREQ
GET1_AJEDR        ----------MPSLLITILLLNIVIYVINTIGAATIDSLLWLFYIKLPTGTS--HMAREQ
GET1_BLAGS        ----------MPSLLITILLLNIVIYVINTIGAATIDSLLWLFYIKLPTGTS--HMAREQ
GET1_PARBP        ----------MPSLLISVLFLHIAIYIINTIAASTIDSLLWLIYMKLPTSAS--CIAREQ
GET1_PARBD        ----------MPSLLISVLFLHIAIYIINTIAASTIDSLLWLIYMKLPTSAS--CIAREQ
GET1_PARBA        ----------MPSLLISVLFLHIAIYIINTIGASTIDSLLWLIYTKLPTSAS--CMAREQ
GET1_ARTOC        ----------MASLLLFVLVIQIITYLINTIGARTIDSLLWLLYIKLPNQAS--QVAREQ
GET1_COCIM        ----------MPSLLIIVLIIHVVTYLINTIGANTIDSLLWLLYLKLPNQTS--QTANEQ
GET1_COCP7        ----------MPSLLIIVLIIHVVTYLINTIGANTIDSLLWLLYLKLPNQTS--QTADEQ
GET1_UNCRE        ----------MASLLIIVFLSHVVTYLINTIGATTVDNLLWLLYLKLPNNTS--RTAVEQ
GET1_PHANO        ----------MPSLLLVVFILQFLLHIINTVGASTVNDLLWILYNKLPTPTS--SSAQKA
GET1_PYRTR        ----------MPSLLLVVFILQLLLHIINTVGANTVNELLWVLYNKLPTPTS--GSAQRC
GET1_BOTFB        ----------MPSLLFTCFLVQLLIHLVNTFGADAINNLLWNLYNMFPTPTS--QSAGEQ
GET1_SCLS1        ----------MPSLLFTCFLVQLLIHLVNTFGAATINNLLWNLYNMLPTPTS--QSAGEQ
GET1_NEUCR        ----------MPSLLVVIFVIELFVQLVNTIGAATINNLLWRIALSLPLPLS--AQFAAQ
GET1_PODAN        ----------MPSLLLIIFVTELVVQLVNTLGATTINDLLWRIYLTLPTPLS--LEFAQQ
GET1_CHAGB        ----------MPSLLVVVFVIELVVQLVNTIGATTINNLIWRAYLSIPTSLA--KQFTEQ
GET1_MAGO7        ----------MPSLLILIFTIEVAVELINTIGAATINNLLWRIFNALPTKLS--AQFAEQ
GET1_COPC7        -----------MSLLLTVFLIVFVTQLISWIGQNVLLEWAYNLYLRLSRN----SLAARQ
GET1_LACBS        -----------MSLLITIFLLVFITQLVSWIGQTVLLELAYALYLRLTRS----AAFARQ
D8Q9D6_SCHCM      -----------MGLIETLFILIFITELIAVIGKTVLADLAFGLYARVFLS----KTHSKQ
G0SZ89_RHOT2      -----------MELIAWLLLTTFVVELLGWVGTDTLAGYIYAPFAPAAK---------QQ
GET1_CRYNJ        ----------MINLALVIFLCTLLNQIVSWVGKSVLQEIAFTAYSWVFLS----GTAAKQ
GET1_SCHJY        -----------MDFLLFLFCLNLFIHLFDKYVKTFLVNQGFRVYARFSGS----PEFKSY
GET1_SCHPO        ----------MMDLIISTILLSLFIHFFDKFAKKRTIDGAYRIYVSVSNN----KDLKKN
GET1_CANAL        ---MLLPDLHPYTILLSIFLVLVAKQLVATIGKSTIQEFVWLVYLKVSS----NQSIKTY
GET1_CANAW        ---MLLPDLHPYTILLSIFLVLVVKQLVATIGKSTIQEFVWLVYLKVSS----NQSIKTY
GET1_CANDC        ---MLLPDLHPYTILLSIFIVLLLKQLVASIGKSTIKEFVWLVYLKVSS----NQSIKTY
GET1_CANTT        ----MFLDLHPYTILVSIFIILLVKQIVGRIGKSTIQEFVWLLYLKISP----NQAIKDY
GET1_PICST        MGILAALDLHPYTLVVSSFTVLLIQQLVGFIGKSTIQEFAWLFYLRVGGKLGLSNSFVAH
GET1_LODEL        ---MLTLDIDPYTILVTSFLILAIQKLVTVIGKQKIQLYIWQIYTKYLSH---SQSIKQF
GET1_DEBHA        -----MFDISSSNLLISVLVVLFAKQLINAVGKATLENIGWSAYCKVAPKLG-DSKFIAL
GET1_PICGU        --------MEPYTLLLFIFVIQIVKQIISAVGKQSIESISWVLYCRVAPKFG-HSKLASM
GET1_CLAL4        -----MFELQPSSIVVLVFCVLAIKVCISLIGKTTIQDRIWYLYTIGASKAG-HSKFVAL
GET1_KOMPG        --------MDPFSILLTLTLIILAQNAVRIVGKSQIHQSIWNLYLRYSN----DQQILKL
GET1_YEAS6        -------------MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNE-----LSKKY
GET1_YEAS1        -------------MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNE-----LSKKY
GET1_YEAS7        -------------MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNE-----LSKKY
GET1_YEAST        -------------MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNE-----LSKKY
GET1_CANGA        -------------MSWVVAIAVVFVVVLKVLEYSTSYHDLVLQSLFFKNSP----ISVKF
GET1_VANPO        -------------MNWVIIAALFFVIINKLLQYTSRYQEAWINKFSISSDIS--SLSKEY
GET1_ZYGRC        ----------MDSGGWIVYCCIFFILLGKVLEYTSSYQDKWFTKLTLTPEAR--KLNSQY
I2H1G3_TETBL      -------------MEYPVVIAIVFLFITNFLNWTSQYHASIRAKLFSSNTK----LTSEY
GET1_ASHGO        -------------MDYWILLVLAFLVADKSWHLTGLLATKL-----TSPE--------RL
GET1_KLULA        -------------MESWLLVILAFLVLERLWPLIDSLIQRF-----AQANS------TKL
GET1_LACTC        ------------MVNSTILVTVVLVLALRALQWCSGYQHKFIDMIWCKPVA------LKL
                                                                              

GET1_ASPTN        TRLKREVVQLKREMNNTSSQDEFAKWAKIRRRHDKTMEEYEKINKTLNAQKTSFDWSVKI
GET1_PENRW        QQLKRQVLEQKHEMNSTSSQDEFAKWAKARRRHDKSMEEYEALNKTLTAQKSSFDWTVKI
GET1_ASPFU        SRLKREVVQLKREMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKI
GET1_ASPFC        SRLKREVVQLKREMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKI
GET1_NEOFI        SRLKREVVQLKREMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKI
GET1_ASPCL        SRLKREVVQLNREMNNTSSQDEFAKWAKLRRRHDKAKDEYETINQALTSQKTSFDWAVKI
GET1_ASPFN        SRLKREALELKRDMNNTSSQDEFAKWAKLRRRHDKTMDEYEQLNKTLTAQKSSFDWSVKI
GET1_ASPOR        SRLKREALELKRDMNNTSSQDEFAKWAKLRRRHDKTMDEYEQLNKTLTAQKSSFDWSVKI
GET1_ASPNC        NRLKREVVQLKRDMNNTSSQDEFAKWAKLRRKHDKTMEEYEAINKQLVSQKTSFDWGVKI
GET1_EMENI        TKLKREVVQLKRDMNNTSSQDEFAKWAKLRRRHDKALSEYEALNQKLSSQKGSFDWFVKI
GET1_TALMQ        GELKHDVVQLKREMNATSSQDEFAKWAKLRRRHDKAMEEYEAMNRSMGSRKTSFQFSIKI
GET1_TALSN        GELKRDVVQLKREMNATSSQDEFAKWAKLRRRHDKAMEEYEAMNRSMGSRKTSFQYSVKI
GET1_AJECG        RHMKREVVQLKHEMSSTSSQDEFAKWAKLRRRHDKALEAYEAKNNELTQSKSTFDMTIKI
GET1_AJECH        RHMKREVVQLKHEMSSTSSQDEFAKWAKLRRRHDKALEAYEAKNNELTQSKSTFDITIKI
GET1_AJECN        RHMKREVVQLKHEMSSTSSQDEFAKWAKLRRRHDKAMEAYEAKNNELTQSKSTFDMTIKI
GET1_AJEDR        RRLKREVIQLKREMNATSSQDEFAKWAKLRRRHDKALETYEAKNNELTQCKSSFDMTVKS
GET1_BLAGS        RRLKREVIQLKREMNATSSQDEFAKWAKLRRRHDKALETYEAKNNELTQCKSSFDMTVKS
GET1_PARBP        HQMKLEVVQLKREMNATSSQDEFAKWAKLRRRHDKALEEYEVKNKQFSRFKSFFDVAVKA
GET1_PARBD        HQMKLEVVQLKREMNATSSQDEFAKWAKLRRRHDKALEEYEVKNKQFSRFKSFFDVAVKA
GET1_PARBA        HQMKLEVVQLKREMNATSSQDEFAKWAKLRRRHDKALEEYEVKNKQFSRFKSLFDVAVKA
GET1_ARTOC        RHAKLEVIRLKREMSATSSQDEFAKWAKLRRRHDKAMEEYDVKNKKLSALKTSFDWTIKT
GET1_COCIM        RRLKREVMQLKREMNATSSQDEFAKWAKLRRRHDKTMEEYEAKNKALGKHKSSFDLAVKS
GET1_COCP7        RRLKREVMQLKREMNATSSQDEFAKWAKLRRRHDKTMEEYEAKNKALGKHKSSFDLAVKS
GET1_UNCRE        RRLKGEVVQLKREMKSTSSQDEFAKWAKLRRRHDKAMEEYEAKNKALGKHKGSFDLTVKS
GET1_PHANO        QKLKKEIVQLKRELGATSAQDNFSKWAKLDRQHNKAMAEFQKIDGSLRGHQTAFTSAVST
GET1_PYRTR        QVLKQDIVRLKRELGNTSPQDNFSKWAKLDRQHNKAMAEYQKLDGSLRSHQATFTSAVST
GET1_BOTFB        KKLKREFMKVRHEMNATSSQDEFAKWAKLRRQHDKLFDQLEKSKSSLDSTKSTFDSSVST
GET1_SCLS1        KKLKREYMKVRQEMNATSSQDEFAKWAKLRRQHDKLYDQLEKSKSSLDSTKSTFDTSVST
GET1_NEUCR        RKKQKEYLAIRRELNATSSQDEFAKWARLRRQHDKLLEDLEKRKKELDAAKTKFDRTLTT
GET1_PODAN        RRKQKEYLAVRHELKATSSQDEFAKWAKLRRQHDKLLEDLEKKKASLEAARTKFDRTLTT
GET1_CHAGB        RQKQKEYLAVRLELNATSSQDEFAKWAKLRRQHDKLLDELEKKKSAVEASRTKFDRYITA
GET1_MAGO7        RKLQQDYLKVRRELNATSSQDEFAKWAKLRRQHDKLLEQLEKKKAALDSTKGNFDKYITG
GET1_COPC7        RSLKTEILNNKTELLKTSAQDQFAKWAKLRRSVDKGLAELEKLNSEIATAKSSFSTKFNA
GET1_LACBS        QALKSEILATKSELLKTSAQDQFAKWAKLRRSVDKGLADLEKLNSQIASSKSSFSLKFNS
D8Q9D6_SCHCM      RQLKKETLANKAAMLNTSAQDQFAKWAKLRRSVDKGLADIETTNKELAAAKSAFTMKFNT
G0SZ89_RHOT2      RAQKAEILKLRAELAATSSQDEFSKWARIRRKLDKAVQDLESSNADSSAHRQQFNKTFKS
GET1_CRYNJ        RKLRKQVLEDKAELGRTSSQDEFAKWAKLRRKLDKGLADLEKTNNTLSSSRSSFSKKFST
GET1_SCHJY        NDLRLQLLSTKRDLNNVSAQDEFAKWARLNRKFDQLNVKWEKQSKIVSQKSEGVKKLISL
GET1_SCHPO        KEILEQLLTVKKELNATSSQDQFAKWARLNRKYEQLSQEWEKQSANVKIFQDTFKRVLSL
GET1_CANAL        NSKQHELHETNRQKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKSSIDKASNA
GET1_CANAW        NSKQHELHETNRQKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKSSIDKASNA
GET1_CANDC        NSKQHELHETNKEKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKASIDKVSNA
GET1_CANTT        NTKKVELHEINKQKRSISAQDEYAKWTKLNRQADKLTSEIQKLNEEIRQSKASIDKLANV
GET1_PICST        TKKQEELHKLNREKRSISAQDEYAKWTKLNRQAEKLTAEVKSLSDDIAKDKSKINSLVGV
GET1_LODEL        NLKQKEIKDLTKQQKLISAQDEYAKWTKINRALDKLKLEVQELNETIAGEKTRIDSITKL
GET1_DEBHA        DQKNVELAKVSKERKSISAQDQYARWTKLNRQFDKLTGEINKLKEETSASRSYISKYIGY
GET1_PICGU        SQKSSQLRTVAGERRAVSAQDQYAKWTKLNRQHDKLVAEIEQLQKEVDLDKVKVNTFTGY
GET1_CLAL4        AQKREELVRVNKERRAISAQDEYAKWTKLNRQFDKLNSEVNDLAEATSSEKAQISKLVNL
GET1_KOMPG        RNLKAESYDVYKQRSNTSAQDEYAKWTKLNRKYDQLQTEIKAVSDQVSQQQQAIEKYLGL
GET1_YEAS6        LAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK
GET1_YEAS1        LAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK
GET1_YEAS7        LAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK
GET1_YEAST        LAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK
GET1_CANGA        ETLVKERRSIQEENKSISAQDNYAKWTKNNRKLDKLDKEITELGAQLKAHNEQIKGHLKK
GET1_VANPO        SKLSAERLKIKEENQSISAQDNYARWTKNNRKLTKLEGELEKLRSNLKIAKDSQSKLFNR
GET1_ZYGRC        HELLSERLRLQEENHSISAQDNYARWTKNNRKLGELDKKLGTIRDKLQETNTSSKKVFGR
I2H1G3_TETBL      KSKLAKRHEYVLENNSISAQDNYAKWTKNNRAISKLDIELKKLKELISQNDSVNLKLFKR
GET1_ASHGO        QQLIRERQELHQQQQSLSAQDHYAKWTKNNRRLDVLDRDIARVRKNYLESVEATKARLAK
GET1_KLULA        KELMHQRQAILAEQKEISAQDQYVKWTKNNRTLEKINKQIEEEKKQLLSQVDRTKASLKK
GET1_LACTC        QGLIKKRRELHLAQQSTSAQDEYAKWTKLNRQIAQLDTQVKQTQEQLVENRKVGEKNLGK
                       .           *.**.: :*::  *                             

GET1_ASPTN        ARWLSTNGLKIFLQFWYSKTPVFAL---PQAWFPYYVEWVLSFPRAPMG-----------
GET1_PENRW        ARWLSTNGLKIFLQFWYSKTPVFPL---PEAWFPYYVEWIVSFPRAPLG-----------
GET1_ASPFU        ARWLSTNGLKIFLQFYYSKTPVFAL---PAGWFPFYVEWVLSFPRAPRG-----------
GET1_ASPFC        ARWLSTNGLKIFLQFYYSKTPVFAL---PAGWFPFYVEWVLSFPRAPRG-----------
GET1_NEOFI        ARWLSTNGLKIFLQFYYSKTPVFAL---PAGWFPSYVEWVLSFPRAPRG-----------
GET1_ASPCL        ARWLSTSGLKIFLQFYYSKTPVFAL---PAGWFPSIVEWMLSFPRAPRG-----------
GET1_ASPFN        ARWLSTNGLKIFLQFWYSKTPVFAL---PEAWIPYYVQWILSFPRAPMG-----------
GET1_ASPOR        ARWLSTNGLKIFLQFWYSKTPVFAL---PEAWIPYYVQWILSFPRAPMG-----------
GET1_ASPNC        VRWFGTSGLKFFLQFWYSKTPVFHL---PEGWLPYYVAWLLSFPRAPMG-----------
GET1_EMENI        ARWLSTTGLKIFIQFRYSKTPVFEL---PGGWLPYPVEWVLAFPRAPQG-----------
GET1_TALMQ        ARWLTLNGPRLFIQFYYTKTPVFDL---PAGWFPYPVEWILSFPRAPLG-----------
GET1_TALSN        ARWLTLNGPRLFIQFYYTKTPVFDL---PPGWFPYPVEWILSFPRAPLG-----------
GET1_AJECG        ARWAATSGLMLFLQFWYSKTPIFTL---PPGWIPWQVQWVLSFPRAPMG-----------
GET1_AJECH        ARWAATSGLMLFLQFWYSKTPIFTL---PPGWIPWQVQWVLSFPRAPMG-----------
GET1_AJECN        ARWAATSGLMLFLQFWYSKTPIFTL---PPGWIPWQVQWVLSFPRAPMG-----------
GET1_AJEDR        VRWAATSGLMLFLQFWYSKRPIFTL---PPGWIPWQVQWVLSFPRAPMG-----------
GET1_BLAGS        VRWAATSGLMLFLQFWYSKRPIFTL---PPGWIPWQVQWVLSFPRAPMG-----------
GET1_PARBP        LRWAGTSGLIVFLQFWFSKTPIFTL---PPSWIPWQVEWVLSFPRAPMG-----------
GET1_PARBD        LRWAGTSGLIVFLQFWFSKTPIFTL---PPSWIPWQVEWVLSFPRAPMG-----------
GET1_PARBA        LRWAGTSGLILLLQFWFSKTPIFTL---PPSWIPWQVEWVLSFPRAPMG-----------
GET1_ARTOC        VRWVSTTGVTVILQFWFSKSPIFDL---PRGWLPWQVEWILSFPRAPLG-----------
GET1_COCIM        IRFFSTTGLKLFLQFWCSKTPIFEL---PRGWIPWQVEWVLSFPRAPLG-----------
GET1_COCP7        VRFFSTTGLKLFLQFWFSKTPIFEL---PRGWIPWQVEWVLSFPRAPLG-----------
GET1_UNCRE        VRFFSTTGLKFFLQFWYSKTPMFEL---PRGWVPWQVEWVLSFPRAPLG-----------
GET1_PHANO        LRWLGTQGLRFVLQFWFAKSPMFWM---PAGWLPFYVEWILSFPRAPLG-----------
GET1_PYRTR        VRWLGTQGLRFVLQFWFSRSPMFWM---PAGWVPYYVEWILSFPRAPLG-----------
GET1_BOTFB        LRWLGTNGLRMLLQFWFSKQAMFWL---PKGWFPYYAEWLLSFPRAPLG-----------
GET1_SCLS1        LRWLGTNGLRMLLQFWFSKQAMFWL---PKGWFPYYAEWLLSFPRAPLG-----------
GET1_NEUCR        VRVVATRGLQWFLPFWYSREPMFWL---PYGWFPYYVEWFASFPRAPLG-----------
GET1_PODAN        TRTVSTRSVQWFLPFWYSKEPMFWL---PYGWFPYYVEWFASFPRAPMG-----------
GET1_CHAGB        VRFISTRGVQWLLPMWYGKLPMFWL---PYGWFPYYVEWFVSFPRAPLG-----------
GET1_MAGO7        IRWVGTQGLRYFLPFWYAKVPMFWL---PYGWFPYYAEWLVSFPRAPMG-----------
GET1_COPC7        VIWALTSGVNLVIGWWYGRKAVFYL---PEGWMG-PLTWWFSFPFAPRG-----------
GET1_LACBS        AIWILTTGVQFVVGWWYRRQPVFYL---PEGWFG-PLAWWLAFPFAPAG-----------
D8Q9D6_SCHCM      AIWILTSGLLLVAGAYYRSSPVFFL---PKGWFG-PFERPLSWPWAPTG-----------
G0SZ89_RHOT2      ALWVLTTVLPFIVSSYHRRTPVFWL---PKNWFG-PLGWWLSFPSASAG-----------
GET1_CRYNJ        LLWLMTTGAQFLLSWWFRKQPIFWL---PEGWVPYPVAWLLSFPSAPIG-----------
GET1_SCHJY        TFWIVTRGYRFIVQFKNSGNPVFAV---PEGMLPTWALWFLALPKAKTG-----------
GET1_SCHPO        FLWILTRGFRFYIQFKESKTPVFFL---PAFLLPSWALWVLSLPRSIYG-----------
GET1_CANAL        LILVLTTLPIWIARVFYRKTHLFYI---RQGIFPKYVEWVLALPFLPNG-----------
GET1_CANAW        LILVLTTLPIWIARVFYRKTHLFYI---RQGIFPKYVEWVLALPFLPNG-----------
GET1_CANDC        LLLVLTTLPIWVARVLYRNTHLFYI---RQGIFPKYVEWVLALPFLPNG-----------
GET1_CANTT        LLMVLTTLPIWVARIFFRKTHLFYL---RSGIFPRYIEWVLALPFFPSG-----------
GET1_PICST        VLLFLTTLPLWVFRLWFRKSVLFYL---PTGVFPYYVERVLAIPFFASG-----------
GET1_LODEL        AITLILTLPIWFLRIFCRKTALLYI---RKGILPAYLEWWLALPFFKSG-----------
GET1_DEBHA        MILVTTTLPIWFFRVWFRKAVLFYF---PTGVLPHYLEWFLALPFITTG-----------
GET1_PICGU        LIAILTSIPIWFFRVWYRSVVLFYF---PPGILPRALEWSIALPFTVTG-----------
GET1_CLAL4        AIAATTTAPIWFSRIWYRKVVLFYL---PPKVFPYYIEWVLALPFIVTG-----------
GET1_KOMPG        AISVTTTLPLWLFRFKYRKQPLFYF---PKDTFPSYLEWILSFPSVPQG-----------
GET1_YEAS6        LRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKW
GET1_YEAS1        LRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKW
GET1_YEAS7        LRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKW
GET1_YEAST        LRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKW
GET1_CANGA        VKLLLLTVPFLCFKLWKGKHIVYNL--PHHQMFPQLVAGVWSQGWLYLAILPLQLAKS--
GET1_VANPO        LKLLTLTLPFMILKLWKGKFIVYDI--PTKDTFPVIVNGVLSQGLLYIPLLPINFLRG--
GET1_ZYGRC        VKLIGLTIPFWILKIWQRSHVVYHF--PKQDLFPKLVTGVWARGWLYLALGPLQYLRN--
I2H1G3_TETBL      LRLVALTVPFMAIKLYYGKKIVYRL--PFDNLFPQIMTLMVSKGFASLALLPLNYYKS--
GET1_ASHGO        LKLLVVTVPFTALKFYKGKLPVYAL---PKGMFPRFIEGTLEHGWLYMALAPLNMKQFSE
GET1_KLULA        VKLVLITVPFTILKFYKGKMPIYDL---PKGLFPNYLQGLFQHGWVYLALGPLNIKKVGD
GET1_LACTC        LRLVFFTAPLLVLRFWKGKLPVYAL---PSGMFPRVVESVLSQGWAAAALAPVRFVWASG
                                       :  .       .                           

GET1_ASPTN        ------------------SVSIQVWSNVCATAISVLAEIVTAAFMQMA-----SRTAVPV
GET1_PENRW        ------------------SVSIHVWSNVCATTIALTAEVMGALLVQIVGQKKEQRETAPV
GET1_ASPFU        ------------------SVSVQVWNSVCATAIAVMAEIVTSMLLQLRS----RSASPAS
GET1_ASPFC        ------------------SVSVQVWNSVCATAIAVMAEIVTSMLLQLRS----RSASPAS
GET1_NEOFI        ------------------SVSVQVWNSVCATAIAVMAEIVTSMLLQLRS----RSASPAS
GET1_ASPCL        ------------------SVSVQVWNSVCATAIAVMAEIFAAMLVRMRG----QAAARTP
GET1_ASPFN        ------------------SVSVHVWNSVCATAVSVTAEMVTSMFLQT--------ARPTP
GET1_ASPOR        ------------------SVSVHVWNSVCATAVSVTAEMVTSMFLQT--------ARPTP
GET1_ASPNC        ------------------SVSIQIWSNVCATAITTMAEVVTAVLLQR--------ATAAA
GET1_EMENI        ------------------SVSVQVWNSVCATAVTVIAEIITGLALQVKG------SAQAV
GET1_TALMQ        ------------------SVSIQVWSSACATAISLAGDVVIAVVQRR-----QASNRQAQ
GET1_TALSN        ------------------TVSIQVWSSACATAISLTGNVVIAALQKSG----QASMRQAQ
GET1_AJECG        ------------------TVSIQIWGGACATVVALVGDAMK-ASLAYVSKPK--IDRIKL
GET1_AJECH        ------------------TVSIQIWSGACATVVALVGDAMK-ASLAYVSKPK--IDRIKL
GET1_AJECN        ------------------TVSIQIWGGACATVVALVGDAMR-ASLAYVSKPK--IDRIKL
GET1_AJEDR        ------------------TVSIQIWGGACATVVALVGDAVG-ATMGFVSASK--KEGMKV
GET1_BLAGS        ------------------TVSIQIWGGACATVVALVGDAVG-ATMGFVSASK--KEGMKV
GET1_PARBP        ------------------TVSIQVWGGACAVVVALIGEAIG-ATVRYLYASKDSMEAIKV
GET1_PARBD        ------------------TVSIQVWGGACAVVVALIGEAIG-ATVRYLYASKDSMEAIKV
GET1_PARBA        ------------------TVSIQVWGGACAVMVALVGEAIG-ATVRYLYGSKDSMEAIKV
GET1_ARTOC        ------------------TVSIQVWGGACGTVIALVGGAMGVAAPAFKKINQPRGEAQKM
GET1_COCIM        ------------------TVSIQIWGGVCATVVSLAGDAIGVVNVYLTSKAPKQKEPATS
GET1_COCP7        ------------------TVSIQIWGGVCATVVSLAGDAIGVVNVYLTSKAPKQKEPATS
GET1_UNCRE        ------------------TVSIQVWSGVCTTVVSLAGDALGVVIQSLILKMTKRGVARTS
GET1_PHANO        ------------------SVSINVWGIACASMIALAAEGLAAVWVLATKRPTPIATEKK-
GET1_PYRTR        ------------------SVSINVWGIACASIISLAAEATAAIWVLVTHKPTPMAAEKQR
GET1_BOTFB        ------------------SISIQAWTLACAAVILLVSDALVAVVALALGTQTGA---KAK
GET1_SCLS1        ------------------SISIQAWTLACAAVILLVSDALVAVVALVLGARTGVQGQKAK
GET1_NEUCR        ------------------SVSIVVWQWACTGVIKLVIETVMAVVGLIVAARQKQQEKQKA
GET1_PODAN        ------------------SVSIVVWQWACTAVIALMIEAATAAL-VYVAAKQS----QKI
GET1_CHAGB        ------------------SVSIVTWQAACTAILTLVMNAVVGILAFISASRQSG--KQKQ
GET1_MAGO7        ------------------SVSIASWQLACTGFVVLIKDAITALVVFVMGMRQS-----NV
GET1_COPC7        ------------------SVSVGVWSFACKRVLLVLERMVKEL-FFAETQAKEVPVGFSP
GET1_LACBS        ------------------SVSVGVWQMACKRVVVLGERVVKDL-TGESLDYVHVSS----
D8Q9D6_SCHCM      ------------------SVSVYVYQMACRRVIKAGARGIQGL-NALPEDTASTDAPAPD
G0SZ89_RHOT2      ------------------AVAVSIWTMACRRTFTSTKSAIFAF-VPSPAERTAQQFAKEQ
GET1_CRYNJ        ------------------SVSSGAWGAICRRVLSTLQEIIQSLLAPSPAATGPVPTGPSS
GET1_SCHJY        ------------------YVSVAVWNFASQKVISTLL-----------------------
GET1_SCHPO        ------------------SVSLTVWNFAVQKTISGIF-----------------------
GET1_CANAL        ------------------AVGLTIWMFAVNSVVSNFSFLVSFPFAKRVSKPVRDTKVE--
GET1_CANAW        ------------------AVGLTIWMFAVNSVVSNFSFLVSFPFAKRVSKPVRDTKVE--
GET1_CANDC        ------------------AVGLTIWMFAVNSVVSNFAFLVSFPFAKKVSKPVRDTKIE--
GET1_CANTT        ------------------AVGLTVWMFAANSVIHNVISLVSFAFEKRVEKPVRQKK----
GET1_PICST        ------------------SVGLTVWMFAVNNVISSVLFLLTFPFKPSVPIPIRQTKVEEV
GET1_LODEL        ------------------TIGLTCWMFVVNSVLSNLIFLISFPFTQKVERPIKPKNEQKT
GET1_DEBHA        ------------------GVGLTIWMSAVNNVVSSVIFLVKFPFEKEVPFPSKEVGNEKT
GET1_PICGU        ------------------GVSLTVWMMAAGAVASSLTFLFMFPFEKAVPKP---VLAKKS
GET1_CLAL4        ------------------GVGLTVWMFALNSVLSSLEFLIKFYLEEPVKKPEAPAASEAQ
GET1_KOMPG        ------------------SIGIMFWILLLNKFVSNLEFIVK-TFSTKVEKPVPIVKVEDL
GET1_YEAS6        HIMEGKFGASKFDDMALQSVSLGIWVWALMNVINGVEFIVKQL-FLTPKM------EAPA
GET1_YEAS1        HIMEGKFGASKFDDMALQSVSLGIWVWALMNVINGVEFIVKQL-FLTPKM------EAPA
GET1_YEAS7        HIMEGKFGASKFDDMALQSVSLGIWVWALMNVINGVEFIVKQL-FLTPKM------EAPA
GET1_YEAST        HIMEGKFGASKFDDMALQSVSLGIWVWALMNVINGVEFIVKQL-FLTPKM------EAPA
GET1_CANGA        -IVTGSSFAIETASFPHMGVSLGIWLWALNSVISNIEFMTMQL-WAKPVS------KPS-
GET1_VANPO        -------IDPNKHILVP-GVSLGIWLMALTKTIDTVEFIVKQLVFQPVVS---KQVKEKT
GET1_ZYGRC        -------GSLNIQDYAPHGVSLGIWIWALQATINTLEFLVKQVILEKPVSPPPQKSKSAT
I2H1G3_TETBL      --------GGKLESISGLPICLGIYVWALTSVLKNLEFLVKFIFFTEPVIK----PNPLR
GET1_ASHGO        --------------GASVAVSLGIWLFALLRVLGAIEFVLETLREQNPQV------ATET
GET1_KLULA        --------------GTHVTVSLAIWLFALLKVVSTLGNIWESLTAPAIPA------PTIT
GET1_LACTC        T---------VKPMQVETPVCLAIWLWALSRVLDTSEFVVRSLCM---------------
                                     :    :                                   

GET1_ASPTN        -----AAED--------KKEL---------------
GET1_PENRW        -----SAEG--------KKAQ---------------
GET1_ASPFU        -----TAKA--------QKAQ---------------
GET1_ASPFC        -----TAKA--------QKAQ---------------
GET1_NEOFI        -----TAKA--------QKAQ---------------
GET1_ASPCL        -----AAKA--------QKTQ---------------
GET1_ASPFN        -----VATA--------QKTQ---------------
GET1_ASPOR        -----VATA--------QKTQ---------------
GET1_ASPNC        -----APAA--------KKTQ---------------
GET1_EMENI        -----PATA--------KKA----------------
GET1_TALMQ        -----AVPA--------GKSEAATK-----------
GET1_TALSN        -----AIPA--------GKSE---------------
GET1_AJECG        -----GATMEGKEG---KKRQ---------------
GET1_AJECH        -----GATMEGKEG---KKRQ---------------
GET1_AJECN        -----GATMEGKEG---KKRQ---------------
GET1_AJEDR        -----GAGVGEKEG---KKSQ---------------
GET1_BLAGS        -----GAGVGEKEG---KKSQ---------------
GET1_PARBP        -----GAGAVEKE----KKRQ---------------
GET1_PARBD        -----GAGAVEKE----KKRQ---------------
GET1_PARBA        -----GAGAVEKE----KKRQ---------------
GET1_ARTOC        -----GTPRGSREQTPVRKTQ---------------
GET1_COCIM        -----GENSARPMA--IKKEL---------------
GET1_COCP7        -----GENSARPMA--IKKEL---------------
GET1_UNCRE        -----EGRPSQPMA--LKKEL---------------
GET1_PHANO        ---EAMAFAADQKSSGEKKEL---------------
GET1_PYRTR        EKQEAMAFSANQKP--AEKEL---------------
GET1_BOTFB        KM---EEPMKAGGQGTEKPGKKEL------------
GET1_SCLS1        KM---EEPMKAGGQGTEKAGKKEL------------
GET1_NEUCR        KQ---AVPAAGGGDSKAEEAK---------------
GET1_PODAN        RQ---PVPAQ----SEKKDS----------------
GET1_CHAGB        KQ---PVPAAGARNGETKKEL---------------
GET1_MAGO7        KQ---AVPVKAVSGEKASDEKEGKKEL---------
GET1_COPC7        SSSSSSTPNPMSKASSGSPSPRRRTTVTVESEDEKS
GET1_LACBS        ------------------------------------
D8Q9D6_SCHCM      AKKES-------------------------------
G0SZ89_RHOT2      EKVKVGVTASGAEEKVHEKKEL--------------
GET1_CRYNJ        AKNDQPEAKIEALALEHEKLD---------------
GET1_SCHJY        ------------------------------------
GET1_SCHPO        ------------------------------------
GET1_CANAL        ------------------------------------
GET1_CANAW        ------------------------------------
GET1_CANDC        ------------------------------------
GET1_CANTT        ------------------------------------
GET1_PICST        VPESAESKESSPEVIDIADAN---------------
GET1_LODEL        ES----------------------------------
GET1_DEBHA        SINKEEVSGTPAAN----------------------
GET1_PICGU        PQQL--------------------------------
GET1_CLAL4        TKQ---------------------------------
GET1_KOMPG        SPK---------------------------------
GET1_YEAS6        SVETQEEKALDAVDDAIILD----------------
GET1_YEAS1        SVETQEEKALDAVDDAIILD----------------
GET1_YEAS7        SVETQEEKALDAVDDAIILD----------------
GET1_YEAST        SVETQEEKALDAVDDAIILD----------------
GET1_CANGA        -------KKLEIVTDEIKVD----------------
GET1_VANPO        KEKV-----VELKTTEAELD----------------
GET1_ZYGRC        KAETKRPEKLEITDDKVELD----------------
I2H1G3_TETBL      PTTTTESKDLKIEQDLVGLD----------------
GET1_ASHGO        AKVHARTAQAASAN----------------------
GET1_KLULA        TDPIDQTNESEKPPVDQPVD----------------
GET1_LACTC        ------------------------------------