CLUSTAL format seed alignment for MF_03115

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DRE2_BABBO       ----------------MAFRILAVGANREDMEKHVRFS---SFLSKYSSITSSLLKLDSV
DRE2_PLABA       ----------------------------MINFSNTLII---LNNDVP---CELLKKKYSE
DRE2_PLAYO       ----------------------------MINFSNTLVI---LNNDVP---CELLKKKYSE
DRE21_PARTE      -----------------------------------------MNLKITINQQASI------
DRE22_PARTE      -----------------------------------------MNLKITINQQASI------
DRE2_CRYHO       -------------------------------MTQLIIT---YQSDSKLEESEVFLSELNR
DRE2_CRYPI       --------------------------------MTQLII---THQ--SDSKLEESEVFLSE
DRE2_PHYIT       ----------------------------MALQGNVAIL---TRLQDTASAVQQFKQTNPQ
DRE2_MALGO       -----------------------MNNTAHSMSEKVLLV-----ASLEAARYGQYQQAVKG
DRE2_USTMA       ------------------MTPPVATDAAFSHSSNGVVLSTSVDPSGTVLVIGSMTSAQSG
DRE2_CRYNJ       ------------------MPAPVPPTAFAQPSGPATQL---VLGSMQRA-PE-YQALLTS
DRE2_CRYNB       ------------------MPAPVPPTAFAQPSGPATQL---VLGSMQRA-PE-YQALLTS
DRE2_COPC7       -------------MAPTAVYTQKDSPSSSQPSSKGPAL---AIGSLETAQDGKYQSLITE
DRE2_LACBS       --------MSPSMPVATTVAADPIAVGAVAVKRPALVI-----GSLSTAEDGTYQALISD
DRE2_CAEBR       ---------------------MSAALSDFLKQSNLLQV---TDGGPLVAGTDGVE-----
DRE2_CAEEL       ----------------------MSILSDFLKHPNLLQV---TDGGPLVDGTNGVKGT---
DRE2_SCHJY       -------------------------------MTTTIVL---ASPNYAAN-ESKFATSLAK
DRE2_SCHPO       ------------------------------MSSSVLVL---TSPGFASK-EESLKKVFDL
DRE2_SCHJA       --------------------MEPYVVDNLNRDDCVMIV---WSGEVQDDVMCDLKAAVST
DRE2_SCHMA       --------------------MEQCVADCLNSDDCVMIV---WSGEVQEDVMRGLQVAVST
DRE2_ACYPI       ----------------------------MSDRKNVLFV---VGKSSA---VKELEEFASC
DRE2_MONBE       --------------------------MADLQGKAVLTI---AVPEAK---ADQIEAEILR
DRE2_TRIAD       ---------------------MESVSHLVSNGQSVLLV---WSQGGQ---LDTLANFTSS
DRE2_DROWI       -------------------------MEQFKGLQKSLYI---WTD------NAELDKRVEQ
DRE2_DROGR       -------------------------MEQFKDLQKSLYI---WTD------SGELDKRVQT
DRE2_DROVI       -------------------------MEQFKGLQKSLYI---WTD------SAELDKRVET
DRE2_DROMO       -------------------------MEQFKGLQKSLYI---WTD------SGELDKRVQA
DRE2_DROPE       -------------------------MEQFKGLQKSLYI---WTD------SADLDKRVEQ
DRE2_DROPS       -------------------------MEQFKGLQKSLYI---WTD------SADLDKRVEQ
DRE2_DROAN       -------------------------MEQFKGLQKTLYI---WTD------SADLDKRVEK
DRE2_DROME       -------------------------MENFKGLQKSLYI---WTD------SADLDKRVEQ
DRE2_DROSE       -------------------------MENFKGLQKSLYI---WTD------SADLDKRVEQ
DRE2_DROSI       -------------------------MENFKGLQKSLYI---WTD------SADLDKRVEQ
DRE2_DROYA       -------------------------MENFKGLQKSLYI---WTD------SADLDKRVQQ
DRE2_DROER       -------------------------MENFKGLQKSLYI---WTD------SADLDKRVEQ
DRE2_ANOGA       -------------------------MNFVQENNHVLYL---WAGTVGPEIEQEVNAIKTI
DRE2_AEDAE       -------------------------MNFVQENNHVLYI---WNGAISGEIEQEVNRLKAI
DRE2_CULQU       -------------------------MNFVQENNQVLYI---WGGTISADIEQEVNQLKSI
DRE2_IXOSC       ------------------------MDYGLQEGSRVLIL---WDGQVK---ADVLTELVRR
CPIN1_TETNG      -----------------------MATLGIKAGENVLMV---WAQPSK---PATLKDYAEE
CPIN1_DANRE      -----------------------MADLGLQKGKRVLLI---WTQPSS---SSALKQFAES
CPN1B_SALSA      -----------------------MADLDVKAGDKVLLV---WSQPSS---PTTLKELAES
CPIN1_ONCMY      -----------------------MADLGVKAGDKVLLV---WSQPSS---PTTLKELAES
CPN1A_SALSA      -----------------------MADLGVKAGDKVLLV---WSQPSS---PTTLKKLAES
CPIN1_XENLA      ---------------------MDDLANLVFPGQQVAVT---WDGSSS---TEALKEFVSK
CPIN1_XENTR      ---------------------MDDLGTLVSSGQKVAVT---WDGSSS---KDALKEFVSK
CPIN1_CHICK      -----------------------MGEYGIAPGQRVAVI---WDSSSP---VEALKGLVDA
CPIN1_HUMAN      -----------------------MADFGISAGQFVAVV---WDKSSP---VEALKGLVDK
CPIN1_BOVIN      -----------------------MADFGISAGQFVAVI---WDKSSP---VEALKDLVDK
CPIN1_MOUSE      -----------------------MEEFGISPGQLVAVF---WDKSSP---EEALKKLVAR
CPIN1_RAT        -----------------------MAEFGISPGQLVAVF---CDKSSS---EEALKKLVGR
DRE2_NEMVE       ------------------------MEAVVDTNNFVLLL---WSGAQL---PKDIEAVVGS
DRE2_BRAFL       -------------------------MDYVSPGHSVLLL---WGGAVS---GDTIQTTVGN
DRE2_ASHGO       ----------------------------MTHSRTALVL---IHPATTTR-PELLTAAKQH
DRE2_ZYGRC       ----------------------------MASTKTGLVL---IHPGATED-PSSVVNAQEQ
DRE2_LACTC       ----------------------------MSGEKSSLLL---IHPAVTTT-PELVESVKKS
DRE2_CANGA       ------------------------------MAKSGLLL---IHPAITTT-PEEVEKAKAD
DRE2_YEAST       ----------------------------MSQYKTGLLL---IHPAVTTT-PELVENTKAQ
DRE2_YEAS2       ----------------------------MSQYKTGLLL---IHPAVTTT-PELVENTKAQ
DRE2_YEAS8       ----------------------------MSQYKTGLLL---IHPAVTTT-PELVENTKAQ
DRE2_YEAS1       ----------------------------MSQYKTGLLL---IHPAVTTT-PELVENTKAQ
DRE2_YEAS7       ----------------------------MSQYKTGLLL---IHPAVTTT-PELVENTKAQ
DRE2_YARLI       --------------------------------MSNLLV---FDNSVVTD-EALVANIMAQ
DRE2_KOMPG       --------------------------------MNTLLL---LHPTIVTE-PQAVEAAKDS
DRE2_DEBHA       -------------------------------MTRILLL---LHPTAVTD-EQLVTKVKSE
DRE2_CLAL4       -------------------------------MSEILLL---LHPTVVTE-ESLVESAKSG
DRE2_CANTT       ------------------------------MTSNILLL---LHPTVVTD-QHIVENIKLK
DRE2_CANAL       ----------------------------MTSSINILLL---LHPTVVTD-AQLVEQIKSK
DRE2_CANDC       ----------------------------MTSSINILLL---LHPTVVTD-AHSVEQIKSK
DRE2_BRUMA       --------------------------------------------------MEQLKMRFKK
DRE2_ARTOC       ----------------------MSPAAILSDVPRVLLL---SPPSLSSN-PDKLAELLNQ
DRE2_ASPCL       ------------------------------MSGRTLLL---SPPSLSSQ-PERLNGILQS
DRE2_ASPFC       ------------------------------MAKQTLLL---SPPSLSSQ-PGKLNETLQS
DRE2_NEOFI       ------------------------------MAKQTLLL---SPPSLSSQ-PGKLNETLQS
DRE2_MAGO7       ------------MSPATVTIDTTPDFSNGGAPHSTLLL---APPAMAAQ-QDAMAAALTD
DRE2_PODAN       MPPAAVMIDTTPDFDFSPAHAAAAASAKGDSGDRTLLL---APPSIASR-EDRLTSLFSV
DRE2_NEUCR       ------MSPITLDLTSDFNPANTTGAGSSSSQPRTLLV---APPSVASH-EERISALFST
DRE2_CHAGB       -----MAPGLDLTPDFHPPTTTTTTTNNAPPQQRTLLL---APPTLATHGEARLATLFTT
DRE2_TALMQ       --------MPSLPVLIDTTPDFDFAPAQDATQKRTLLL---APPSIAAH-EEKLRDIFAT
DRE2_TALSN       --------MPSLPVLIDTTTEFDVSSPQNVTQKRSLLL---APPSIAAH-EEKLRDIFTT
DRE2_ASPTN       ------MTPVPVSVDTTADFAAPPTKTAPSTSTRTLLL---APPSIAAH-EEKLRDIFAT
DRE2_ASPFN       ---------MSITIDTSVDIDLPTPPQSNGSQKRNLLL---APPSVAAH-EEKLRDVFST
DRE2_ASPOR       ---------MSITIDTSVDIDLPTPPQSNGSQKRNLLL---APPSVAAH-EEKLRDVFST
DRE2_PENRW       -------MAPSFITIDANDMDVDFSTTKPVQAKRTLLL---APPSIATQ-EDKLRDLFST
DRE2_ASPNC       MAPSFVTIDTTPDFDMAPAPSFQPMST-GSPSKRTLLL---APPSIATQ-EEKLRDLFTA
DRE2_EMENI       -----MAPSFVSIDTTPDFDMTPTSSKSADSGKRTLLL---APPSIATQ-EDKLRTLFTT
DRE2_COCIM       -------------------------------MERMLLL---SPPSLAAR-PERLNTILSS
DRE2_COCP7       -------------------------------MERMLLL---SPPSLAAR-PERLNTILSS
DRE2_PARBA       ---------------------MLPSQTPAQGSGRFLLL---SPPSLSSH-PEKLNAILGL
DRE2_PARBD       ---------------------MPPSQTPAQGSGRFLLL---SPPSLSSH-PEKLNAILGL
DRE2_AJEDR       ----------------------------MASTGRVLLL---SPPSLSSH-PEKLNAILGS
DRE2_BLAGS       ----------------------------MASTGRVLLL---SPPSLSSH-PEKLNAILGS
DRE2_AJECN       ----------------------------MATTGRVLLL---SPPSLSSH-PEKLNAILKS
DRE2_AJECG       ----------------------------MATTGRVLLL---SPPSLSSH-PEKLNTVLKS
DRE2_AJECH       ----------------------------MATTGRVLLL---SPPSLSSH-PEKLNTVLKS
DRE2_PHANO       -----------------------------MAAPRTLLL---CPPSLSAH-PEALNKIYEI
DRE2_PYRTR       ------------------------------MAPRCLLI---GTPSIAAH-PERLDQVYEI
DRE2_NECH7       ----------------------MPVSKSVSPPKRTLLL---APPTLASH-SSALSSVLAD
DRE2_BOTFB       ------MAPSVTIDNSSDFSPITTNFKTTSFNPRTLLL---APPSIASH-EEKLRNVLAT
DRE2_SCLS1       ------MAPSVTIDNISDFSPITTTTKTTSFNLRTLLL---APPSIASH-EEKLRNVLAT
DRE2_DICDI       ---------------------MNSLSLELNKEQEVLII---SDVENSESIINQVKELSKT
DRE2_OSTLU       --------------------------MSVLALDVARDV---AAPRRAEI-LETLRALADG
DRE2_OSTTA       --------------------------------MRVVVV---DLDGVDGA-DLALERAYER
DRE2_ARATH       -------------------------MDSMMNQKTVLAV---TDDVVLP--VSSVLAIMKE
DRE2_MAIZE       ------------------------MSAALAVTDEVALP------------IRAVGDLAAA
DRE21_ORYSI      ----------------------------MAATAAAALA---VTDELALP-LRAVGDLAAA
DRE21_ORYSJ      ----------------------------MAATVAEALA---VTDELALP-LRAVGDLAAA
DRE22_ORYSJ      ----------------------------MAATAAALAV----TDELALP-LRAVGDLAAA
DRE22_ORYSI      -----------------------------MAATAAALA---VTDELALP-LRAVGDLAAA
DRE2_SOYBN       ------------------------------MDGAVLAC---TDGAVLPV-SQVFDAIREL
DRE2_MEDTR       -------------------------MDAAKMYGAVLAC---TDEAVLP--VSQVFDAIRE
DRE2_RICCO       -------------------------MDRTRKQCSVLAF---TDDAVLP--VSTIVNAVRE
DRE2_POPTR       ------------------------MDTKRMLQNSVLAL---TDDTLIS--IGTVTNAARE
DRE2_VITVI       -----------------------------MLQNSTLAL---TDHEVLS--ISTVLDAVRK
DRE22_PICSI      -----------------------------MDTQPIVLV---ITDSVTLH-AAIVSWGLQN
DRE21_PICSI      -------------------------------MEATVLL---VTDSITLS-SKVVTWAIQE
                                                                             

DRE2_BABBO       LFPSVT----RL-------------ELSKKDYDYMSISAVFEYGNKPCTY-DHVVLATDS
DRE2_PLABA       LLIPTIG---IL-------------DFKKKKIYKKYN-NIFLY--SYQNY-SFLLDLN--
DRE2_PLAYO       LL--------IP-------------TISILDFKKKK---------IYKKYNNIFLYSYQN
DRE21_PARTE      ----------SD-------------SLIIANLNLI-----QFF--RDNTF-NKI------
DRE22_PARTE      ----------SE-------------KLIIANLEQLL-----IF--RDNTF-NKI------
DRE2_CRYHO       IK--------KE-------------EDKFAKFSSLSD-LRAIV--KKGEF-RIVSIYLSS
DRE2_CRYPI       LNRIK-----KE-------------EDKFGKFSSLSD-LRAIV--KKGEF-RIVSIYLSS
DRE2_PHYIT       VADVTV----LA-------------VAEDSDVTQTVTSSSASA--KENAF-DGIVSF---
DRE2_MALGO       LQAE------SG-------------LLETHMIDRITD--LAYA--PPADYFDAVYMMLPS
DRE2_USTMA       AYQKAVEAYSGR-------------QVEMHMVDRLTD-GATSL--SANTY-PLAHLAV--
DRE2_CRYNJ       LKSAAPP---SS-------------SVQGEMVDRILD-NATTL--PPPPL-TIHLVLP--
DRE2_CRYNB       LKSAAPP---SS-------------SVQGEMVDRILD-NATTL--PPPPL-TIHLVL---
DRE2_COPC7       LEA-------TR-------------QVDKLLLDRLVD-GATTL--EPSKY-NSVHVTLAS
DRE2_LACBS       LQS-------SR-------------QVDRQLLDRLVD-NATTL--EPSSY-DSVHITLAP
DRE2_CAEBR       ----------GT-------------RVDLV--------GEVEH--------AIIQVQ---
DRE2_CAEEL       ----------RV-------------VGSVSNARELRG--------ADSLVGDVERAIIQV
DRE2_SCHJY       FQANSTDA--SH-------------QRDIHMIDRIAG-NLASL--TVNAY-DRGLLFLDE
DRE2_SCHPO       IDN-------GA-------------SRELQMIDRVQS-QLVNL--PINRY-DSVIAAIDD
DRE2_SCHJA       HVKK------LH-------------FENLENFTNSSTISSQFH--GCS---SVILCGWPN
DRE2_SCHMA       Y---------VK-------------KLQFENLEKFVDSSAVDS--QLHEC-SVILCGWPN
DRE2_ACYPI       NAD-------RA-------------NVKIEIVENIG----LAT--DGPLY-SAILSGFGA
DRE2_MONBE       LRAATTE---AG-------------SVQLEQFDRLE---QVFL--APSSY-DVIFSGHIA
DRE2_TRIAD       LRERVGT---NG-------------TVAVENINRLS---QSSY--GSSTF-DVALSNVVS
DRE2_DROWI       LKTAT-----GG-------------EVALENVHRLS---FASY--ASSSF-DLIVI----
DRE2_DROGR       IKEAT-----GG-------------EVAVENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROVI       LKAAT-----GG-------------EVAVENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROMO       LKEAT-----GG-------------EVAVENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROPE       LKTAT-----GG-------------EVAVENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROPS       LKTAT-----GG-------------EVAVENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROAN       VKSAT-----GG-------------EVALENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROME       LKAAT-----GG-------------DVALENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROSE       LKAAT-----GG-------------DVALENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROSI       LKAAT-----GG-------------DVALENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROYA       LKSAT-----GG-------------DVALENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_DROER       LKSAT-----GG-------------DVALENVHRLS---FSSY--ANSSF-DLIVI----
DRE2_ANOGA       P---------NV-------------QVNVENVERLQ---LAEY--GKSQF-DVILAQVAT
DRE2_AEDAE       P---------NV-------------QVNVENADRVL---LAGY--TPSQF-DVVLANVPS
DRE2_CULQU       P---------GV-------------KVNVENAERVL---LGGY--GQSQF-DIILANVST
DRE2_IXOSC       IQATVKD---DK-------------LCQVENSQQL---GKSHH--QTSSF-DAVLLGAV-
CPIN1_TETNG      LSSIVGT---DG-------------KVSVENVDRLL---LSSH--SASTF-DCAVSCVLA
CPIN1_DANRE      IAAVVGD---QS-------------LVSLENSERLL---LSSH--NASSY-DCVLSGLLT
CPN1B_SALSA      LGSMVGS---EG-------------RVSLENMERLL---MSSH--AASTY-DWVLSSLLP
CPIN1_ONCMY      LGAMVGT---DG-------------RVSLENMERLM---MSSH--AASSY-DWVLSSVLS
CPN1A_SALSA      LGAMVGT---DG-------------RVSLENMERLI---MSSH--AASSY-DWVLSSLLS
CPIN1_XENLA      LQEVVAP---RG-------------KVSVENIERLL---LSAH--ADSSF-DAILLGMVQ
CPIN1_XENTR      LQEAVAP---QG-------------TVSVENIERLL---LSAH--ADSSF-DAVLLGVVQ
CPIN1_CHICK      VQASVGA---DS-------------RVSVENINQLC---QSAH--RESSF-DVILSGVVP
CPIN1_HUMAN      LQALTGN---EG-------------RVSVENIKQLL---QSAH--KESSF-DIILSGLVP
CPIN1_BOVIN      LQALTGD---EG-------------RVSVENINQLL---QSAH--KESSF-DIVLSGIIP
CPIN1_MOUSE      LQELTGS---EG-------------QVFMENVTQLL---QSSH--KESSF-DVILSGVVP
CPIN1_RAT        VQGLTGS---EG-------------QVFVENITQLL---QSAH--KESSF-DVILSGIVP
DRE2_NEMVE       LTKKVGP---NG-------------KVSLEHSDRLH---IASH--AMSSF-DVVLSGVCE
DRE2_BRAFL       LQTKVGE---KG-------------HVRVEHVDRLL---LSNH--GSSTF-DVVMSGTIN
DRE2_ASHGO       SSLS------GA-------------NIEQHLVNKLND-GSLQL--QDNSY-DVIFYVTPE
DRE2_ZYGRC       ARSEG-----VS-------------VEAQFLINKIND-GSVKL--EDNHY-DEVRYVTPE
DRE2_LACTC       NVFAD-----SS-------------KLDQFLVNKLND-SSVQL--EDEKY-SLVYYLTPE
DRE2_CANGA       AVAAD-----VK-------------IANQFLINKVNE-GSVKL--QKGIY-DVIYYLTPE
DRE2_YEAST       AASKK-----VK-------------FVDQFLINKLND-GSITL--ENAKY-ETVHYLTPE
DRE2_YEAS2       AASKK-----VK-------------FVDQFLINKLND-GSITL--ENAKY-ETVHYLTPE
DRE2_YEAS8       AASKK-----VK-------------FVDQFLINKLND-GSITL--ENAKY-ETVHYLTPE
DRE2_YEAS1       AASKK-----VK-------------FVDQFLINKLND-GSITL--ENAKY-ETVHYLTPE
DRE2_YEAS7       AASKK-----VK-------------FVDQFLINKLND-GSITL--ENAKY-ETVHYLTPE
DRE2_YARLI       ----------NQ-------------GASHQLLERIG--TQVQL--PANTY-ASIQVFTKS
DRE2_KOMPG       LAQKLGTD--KS-------------NISQHIIDRVAT-GQVSL--RPSYY-NHIQYLAPP
DRE2_DEBHA       ISSTNS----DA-------------DVVQHIIDRVAN-KIVKL--ENNTF-DEVIYINPN
DRE2_CLAL4       LSGKFP----EA-------------SLTQHIIDRIAN-DMVEL--PSSHF-DHIHYVNPN
DRE2_CANTT       ISNTHK----DF-------------HLSQTTIDRLTQ-GSIEF--DNNSF-DEIIYINPN
DRE2_CANAL       IYQSHNNNNNNNGGTTTTTTGTVNINLNQQIIDRVTK-GIIEL--PYDYY-DEIIYINPN
DRE2_CANDC       IYQSHNNDINSI-------------NINQQIIDRITK-GVIEL--PNDYY-DEIIYINPN
DRE2_BRUMA       LTVLTPR---DK-------------QTELDVKEEIY---------------DAVIIVTFG
DRE2_ARTOC       YD--------KN-------------TRDLQMIDRLAA-GLVSL--PESTY-NLVLLLTDI
DRE2_ASPCL       YD--------RK-------------TTDLQMLDRLIL-GVVNL--PDAAY-SRIIILAGE
DRE2_ASPFC       YN--------RN-------------ATDLQMLDRLAL-GLASL--PDSAY-SSIVILAGG
DRE2_NEOFI       YN--------RN-------------ATDLQMLDRLAL-GLASL--PDSTY-STIVILAGG
DRE2_MAGO7       AAPL------GS-------------RPELYMLDRLAA-GLTNL--APAAY-DLVLVLA--
DRE2_PODAN       YD--------RS-------------STDLQMLDRLAA-GLVSL--PAKTY-DLILVLTDP
DRE2_NEUCR       YP--------RD-------------TTDLHMLDRLAA-GLVTL--PTSTY-DLILVLTDP
DRE2_CHAGB       TYP-------RA-------------TTDLQMLDRLAA-GLVTL--PATTY-DLVLVLTDP
DRE2_TALMQ       FD--------RS-------------VTDLQMLDRLSA-GFVTL--PASAY-DLVLVLTDT
DRE2_TALSN       FD--------RS-------------VTDLQMLDRLSA-GFVTL--PASTY-DLVLVLTDT
DRE2_ASPTN       FD--------RA-------------STDLQMLDRLSA-GFVSL--PAATY-DLVLVLTDT
DRE2_ASPFN       FD--------RS-------------STDLQMLDRLSA-GFVSL--PPNTY-DLVLVLTDA
DRE2_ASPOR       FD--------RS-------------STDLQMFDRLSA-GFVSL--PPNTY-DLVLVLTDA
DRE2_PENRW       FD--------RS-------------TTDLQMLDRLSA-GVVSL--PATTY-DLVLILTDT
DRE2_ASPNC       FD--------RS-------------TTDLQMLDRISA-GFVSL--PANTY-DHILVLTDT
DRE2_EMENI       YD--------RS-------------TTDLQMLDRVSA-GFVSL--PANTY-DLVLVLTGT
DRE2_COCIM       HS--------RY-------------ATDLQMLDRVAA-GLVSL--PQSTY-DIVMLLTDV
DRE2_COCP7       HS--------RY-------------ATDLQMLDRVAA-GLVSL--PQSTY-DIVMLLTDV
DRE2_PARBA       HA--------RE-------------STDLQMLDRLAL-GLVSL--PQSTY-DVVLLLTGA
DRE2_PARBD       HA--------RE-------------STDLQMLDRLAL-GLVSL--PESTY-DVVLLLTGA
DRE2_AJEDR       HT--------RD-------------RTDLQMLDRLVH-GLVSL--PASTY-DIVLLLTGA
DRE2_BLAGS       HT--------RD-------------RTDLQMLDRLVH-GLVSL--PASTY-DIVLLLTGA
DRE2_AJECN       HT--------RD-------------KTDLQMLDRLAH-GLVSL--PESTY-DIVLLLTGA
DRE2_AJECG       HT--------RD-------------KTDLQMLDRLAH-GLVSL--PESTY-DIVLLLTGA
DRE2_AJECH       HT--------RD-------------KTDLQMLDRLAH-GLVSL--PESTY-DIVLLLTGA
DRE2_PHANO       HD--------RS-------------TADLQMLDRIAA-GLVQL--PAATY-DVVLLLTDA
DRE2_PYRTR       HH--------RS-------------STDLQMLDRIAA-GLVNL--PAATY-DVVLLLADA
DRE2_NECH7       YD--------RS-------------VTDLQMLDRLSA-GLVKL--PSSTY-DRVLILADA
DRE2_BOTFB       HD--------RT-------------VTDLQMLDRLSA-GLVTL--PESTY-DLVLILTDA
DRE2_SCLS1       HD--------RS-------------VTDLQMLDRLSA-GLVTL--PESTY-DLVLILTDA
DRE2_DICDI       VTTSLS----KE-------------QQQIQN-----------------NF-DHVIII---
DRE2_OSTLU       ADATTREI--AS-------------DDDADALERASCDAYFAR--ARDAS-EA-------
DRE2_OSTTA       AAALD-----DG-------------ATPATTYARD---VRAPG--AADGF-----IG---
DRE2_ARATH       LGKEV-----IE-------------SFDPLIITQASTINQFPL--DASSV-EAVLAIS--
DRE2_MAIZE       AEVSR-----EE-------------VAVITQCAALG--GKLPF--EDASV-GAVLAVIK-
DRE21_ORYSI      AGVSR-----EE-------------VVVITQCASLG--GKLPF--ADASV-GSVLAVIK-
DRE21_ORYSJ      AGVSR-----EE-------------VVVITQCASLG--GKLPF--DDASV-GSVLAVIK-
DRE22_ORYSJ      AGFSR-----EE-------------VVVITQCASLG--GKLPF--DDASV-GSVLAVIK-
DRE22_ORYSI      AGVSR-----EE-------------VVVITQCASLG--GKLPF--DDASV-GSVLAVIK-
DRE2_SOYBN       GNGGL-----EQ-------------WDPLVLTSASLL-SKLPV--DSSSV-DFVILIW--
DRE2_MEDTR       LGNEG-----VE-------------KLDPLVITSASSLSKFPV--ESSSV-DLVVLIW--
DRE2_RICCO       LGNEG-----AE-------------QCDPQVVTQASSLSKLPV--DSSSM-DIVISIC--
DRE2_POPTR       VANDG-----VD-------------QCDPQIITQASSLSKLPL--EPSSV-DIVIPIF--
DRE2_VITVI       LDNAG-----VD-------------QCDPLIITQASSLSQLPV--ESSSL-DIVISIC--
DRE22_PICSI      FQVKA-----ED-------------LHVITQADRLE--GKLNL--KSSSL-DAVVSI---
DRE21_PICSI      FKEKADR---GN-------------NLCVLTQANSLE-WKSYF--SSSSL-DVVVFFSE-
                                                                             

DRE2_BABBO       TFCRTGSDA-----SPLLEKLHEALTPNGTIVIILPHSN---------------------
DRE2_PLABA       --------------DNILLKIQKYLNKNGILDINLYLND-KSNNNS-GTSKKDHSKIEDI
DRE2_PLAYO       Y------SFLLDLNDNILLKIQKYLNKNGILDINLYLND-----KNNNNNSGTNKKDHSK
DRE21_PARTE      -------ECDQLLTLKDAVQISQILKDQGVLIYEGEINE---------------------
DRE22_PARTE      -------DCDQQITLKDAVQISQILNDQGVLNYEGEINE---------------------
DRE2_CRYHO       G----SILAEIFT-FEFLKEFYGVLDFGSVLKVNILALD---------------------
DRE2_CRYPI       G----SILGEIFT-FEFLKEFYGVLDFGSVLKVNILALD---------------------
DRE2_PHYIT       -----SEQTEELG--IELGAVLPLLKTGGVLQLHVANVK---------------------
DRE2_MALGO       EGVEW---------AAALPKLRASMIPGAKLRVSVVNEN---------------------
DRE2_USTMA       -------NYAEAASPVLLSSLHSALQPKAKLIVEAAELV--------------------D
DRE2_CRYNJ       --------------LPLPSNLLSAIPPSTQIFIHIPADS---------------------
DRE2_CRYNB       -------PLPLPP------NLLSAIPPSTQIFIHIPADS---------------------
DRE2_COPC7       SDYQSLQESTL---RSLLTQLLTGLTPLGTLHLLNLTDG---------------------
DRE2_LACBS       S----DYQGLTQKLPQLLSQLLTGLTPLGTLHLINLTSA---------------------
DRE2_CAEBR       -------ETELLA--EVCNTVFDVMKQNGEVLVFSTDLT---------------------
DRE2_CAEEL       Q------ETELLA--EVCNTVFDVMKQNGEVIVFSQDLT---------------------
DRE2_SCHJY       -------STTLEEIKAILPKLFAAVHPGAALSVDGVFAK---------------------
DRE2_SCHPO       G----AWSSTLGP---ILSQAFASVHPGGTLRVYSTADE---------------------
DRE2_SCHJA       -----PININTLE-RGLLSNLSSCLQPGGRLICRESTME---------------------
DRE2_SCHMA       -----SISVNILK-LGLLSNLLSCLRPGGRFFGRDLITG---------------------
DRE2_ACYPI       -------DDNVSCDLNLLPTYTTLLTAGGTLIAKTDVGT---------------------
DRE2_MONBE       L------PAKSHA-DSALAKLAAALKPGGRLALRESLNS---------------------
DRE2_TRIAD       S------YCCKHT-SEQLAQILKMLKPDCKCLLRDTSPS---------------------
DRE2_DROWI       -------ECAQLT--DNYVKLLHMLKPSGKLHLISFIGA---------------------
DRE2_DROGR       -------ECAQLT--DNYVKLLHMLKPSGKLHLIAYIGT---------------------
DRE2_DROVI       -------ECAQLT--DNYVKLLHMLKPSGILHLFAYIGP---------------------
DRE2_DROMO       -------ECAQLT--DNYVKLLHMLKPSGKLHLFAYIGP---------------------
DRE2_DROPE       -------ECAQLT--DNYVKLLHMLKPSGKLHLFSFIGP---------------------
DRE2_DROPS       -------ECAQLT--DNYVKLLHMLKPSGKLHLFSFIGP---------------------
DRE2_DROAN       -------ECAQLT--DNYVKLLHMLKPSGKLHLVAFIGP---------------------
DRE2_DROME       -------ECAQLT--DSYVKLLHMLKPSGKLHLVSYIGP---------------------
DRE2_DROSE       -------ECAQLT--DSYVKLLHMLKPSGKLHLVSFIGP---------------------
DRE2_DROSI       -------ECAQLT--DSYVKLLHMLKPSGKLHLVSFIGP---------------------
DRE2_DROYA       -------ECAQLT--DSYVKLLHMLKPSGKLHLVSFIGP---------------------
DRE2_DROER       -------ECAQLT--DSYVKLLHMLKPSGKLHLVSFIGP---------------------
DRE2_ANOGA       GN------------STLVTLLVKLLKPKGKCVFRDDSAA---------------------
DRE2_AEDAE       GN------------SEMASSLLKLVKPKGKVVFKDDSAN---------------------
DRE2_CULQU       GN------------SELVSHLLKLTKPKGKAVFKDDSAA---------------------
DRE2_IXOSC       -------TPDMRPTSDCLVDLLSLLKPNGKLSLQLTKTD---------------------
CPIN1_TETNG      D------SSAVHS-LDTLAELARVLKPGGKLILEEVVTG----------------AEAQR
CPIN1_DANRE      D------SSLIHS-SEMLVEMARVMKPGGTLVLEEPVTG----------------SEDTG
CPN1B_SALSA      D------SSSIHT-SETLAEMARVIKPGGKLVLEEPVTG--------------------T
CPIN1_ONCMY      D------SFSVHT-SETLAEMARVIKPDGKLVLEEPVTG--------------------T
CPN1A_SALSA      D------SFSVHT-SETLAEMARVIKPDGKLVLEEPVTG--------------------T
CPIN1_XENLA      G------TQCIHS-SEVLAEVARILKPGGALIIQEPVAA----------------GAGAQ
CPIN1_XENTR      G------TQSVHS-SEILAEVARILKPGGAVIIQELVAA------------------GVD
CPIN1_CHICK      G------STAQHS-AEVLAEIARILKPGGRVLLKEPVVT--------------ESENNSQ
CPIN1_HUMAN      G------STTLHS-AEILAEIARILRPGGCLFLKEPVET--------------AVDNNSK
CPIN1_BOVIN      G------STTLHS-ADILAEMARILRPGGCLFLKEPVET------------------AVV
CPIN1_MOUSE      G------STSLHS-AEVLAEMARILRPGGCLFLKEPVET------------------AEV
CPIN1_RAT        G------STSLHS-PEALADMARILRPGGCLFLKEPVET------------------TGV
DRE2_NEMVE       S------PSLIHS-MELLSKLAKLLKPDGKLILREPVGS---------------------
DRE2_BRAFL       P------PTTVHS-GDVLAEVARLLKPSGRAVVCEPTVS-------------------TD
DRE2_ASHGO       -----AADEILFP-RRLIGVLAAALRAGGSLHGLYDKYQ---------------------
DRE2_ZYGRC       -----ASDEIRFP-SKLIGVIGKSLKTNGKLYGLSDLYK---------------------
DRE2_LACTC       -----KESEIQFP-TKLIAVLAQSLRGGGRLFGLSDVYK---------------------
DRE2_CANGA       -----APDAILFP-KKLIGALNEALKVGGVLYGLSDKYK---------------------
DRE2_YEAST       -----AQTDIKFP-KKLISVLADSLKPNGSLIGLSDIYK---------------------
DRE2_YEAS2       -----AQTDIKFP-KKLISVLADSLKPNGSLIGLSDIYK---------------------
DRE2_YEAS8       -----AQTDIKFP-KKLISVLADSLKPNGSLIGLSDIYK---------------------
DRE2_YEAS1       -----AQTDIKFP-KKLISVLADSLKPNGSLIGLSDIYK---------------------
DRE2_YEAS7       -----AQTDIKFP-KKLISVLADSLKPNGSLIGLSDIYK---------------------
DRE2_YARLI       P------QPVTLP-ASLLETLSGALAPGGALFGAVDGSQ---------------------
DRE2_KOMPG       -----EANVKKLP-VKCYEIIFEALQSNGVFEGTIPPES---------------------
DRE2_DEBHA       E----GEFNRQLP-VSTITIIYDSLVEDGVLKGDLPTNQ---------------------
DRE2_CLAL4       K------SHLSIP-PSVMAKLFASLKNGGELSGDLPKDQ---------------------
DRE2_CANTT       -----EEQYREIP-NSLMKLIFDLLKLNGKFTGDLPTDQ---------------------
DRE2_CANAL       N----ESQYREIP-ISLMQLIYKLLKSNGKFKGDLPLDQ---------------------
DRE2_CANDC       D----EPQYREIP-ISLMQLIYKLLKSNGKFKGDLPLDQ---------------------
DRE2_BRUMA       PAL-----------ERLLRXAFLLARPNSAVRVIVRDVD---------------------
DRE2_ARTOC       DGTS-TESERLVG-RDVLQQIARTLQPGGIMKYHDGLSA---------------------
DRE2_ASPCL       EDSI-SESSKLTT-RETFSHIARSLQKGGYICSQHEQQG---------------------
DRE2_ASPFC       DNSF-SESLKLIN-RQIFNQIIGSLRRGGYIYGQDAVSG---------------------
DRE2_NEOFI       DNSF-SESLKLIN-RQTFNQIIGSLRRGGYIYGQDAVSG---------------------
DRE2_MAGO7       -----SGADPLLSRRDVFAKIADAMKPGAKLRSRDGSPL---------------------
DRE2_PODAN       DGSRRSEVSPLLSNREIWGKVVPALKAGGTLRSEDGSLG---------------------
DRE2_NEUCR       DGSRHAEASALLSNRAVWSLLVPALKAGGKLRSEDGTLG---------------------
DRE2_CHAGB       DGSRRAEAAALLADRAVWARLVPAVRAGGRVASEEGGGE---------------------
DRE2_TALMQ       NGARRNEALGLLT-RDVFNVLTPAMKPSAQLKLQDGPFQ---------------------
DRE2_TALSN       NGARRNEALELLT-RDIFNILTPSMKPSAQLQLQDGPFQ---------------------
DRE2_ASPTN       DSARRAEALQLLS-RDVYSALVPSMKGGAKLQLQDGTWN---------------------
DRE2_ASPFN       QS---DEAVRLLT-RDVYTALVPAMKAGARLQLQQGSLG---------------------
DRE2_ASPOR       QS---DEAVRLLT-RDVYTALVPAMKAGARLQLQQGSLG---------------------
DRE2_PENRW       DGTRRSEALQLLT-RNVYTTLVPAMKAGAKLQTQDSALN---------------------
DRE2_ASPNC       DGTRRSEALHLLT-RDVYTALVPCMKAGAKLQTQDNFFG---------------------
DRE2_EMENI       DGTRRSEALQLLK-REVYAAVVPAMKGGAKLQTEDNFFG---------------------
DRE2_COCIM       DGLG-TGSTSAMG-RGVIQSVVRALRPGGKFK-RENGTF---------------------
DRE2_COCP7       DGLG-TGSTSAMG-RGVIQSVVRALRPGGKFK-RENGTF---------------------
DRE2_PARBA       DNTL-AETYRLVS-RGVLQGVVNSLKPGGKLRNRDNQIWGSGSDSAAGLGSSDGGGGGGG
DRE2_PARBD       DNTL-AETYRLVS-RGVLQGVVNSLKPGGKLRNRDNQIW--GSGSDSAAGLGSSDGDGGG
DRE2_AJEDR       DNTL-AEPYSLVT-RDIIQQVVHSLKPAGKLRSQDNKAW------------GLRSSGNNS
DRE2_BLAGS       DNTL-AEPYSLVT-RDIIQQVVHSLKPAGKLRSQDNKAW------------GLRSSGNNS
DRE2_AJECN       DNTL-AETHSLLN-RELIQRVVHSLRPAGKLRNRENKPW---------GLSDGNGSNANS
DRE2_AJECG       DNTL-AETHSLLN-RELIQRVVHSLRPAGKLRNRENKPW---------GLSDGNGNNANS
DRE2_AJECH       DNTL-AETHSLLN-RELIQRVVHSLRPAGKLRNRENKPW---------GLSDGNGNNANS
DRE2_PHANO       DGTT-RESHKLLA-RDVASKVAGALKVGGILKAK--------------------------
DRE2_PYRTR       DGTT-RESHKLFS-RDVMNKVASALKIGGVLKSQAGPFQ---------------------
DRE2_NECH7       SFML-GESLALMN-RAVLGPVAEALKPNGRLQSQDGNSL---------------------
DRE2_BOTFB       DGTR-VESKGLLT-RDVFGKITQALKAGAKLQAQDGTFG---------------------
DRE2_SCLS1       DGTR-AESTELLT-RDVFGKITQALKTGAKLQAQDGTFG---------------------
DRE2_DICDI       -------SSKPFN-SALISMYSNLLKKGGKLSIYQTNEN---------------------
DRE2_OSTLU       --------------RRACARASEKLRAGGALGVVVDDER---------------------
DRE2_OSTTA       -----DGATAAMA-SRTCARAWTALRAGGTVIARGGDAA---------------------
DRE2_ARATH       -------KTSDFPSDKICGEFSRILKPGGTVSVCKVLEG---------------------
DRE2_MAIZE       -------NVESLR-EQLVAEIRRVLKAGGRVLVQSPAPS---------------------
DRE21_ORYSI      -------KVENLG-NQFITEISRVLKAGGMVLVQSSPSD---------------------
DRE21_ORYSJ      -------KVENLG-DLFITEISRVLKAGGMVLIQSSPSD---------------------
DRE22_ORYSJ      -------KVENLG-DLFITEISRVLKAGGMVLIQSSPSD---------------------
DRE22_ORYSI      -------KVENLG-DLFITEISRVLKAGGMVLIQSSPSD---------------------
DRE2_SOYBN       -------LSIDCPVDQLIQEILRVLKVDGTILIRKSSQS----------------AVGSF
DRE2_MEDTR       -------KSLDFPIDQLTQEVLRVLKAGGTTLIRKSSQS--------------------A
DRE2_RICCO       -------RSLQFQGDFLFEEISRVLKPGGTVLIYKTLQS----------------VAEGT
DRE2_POPTR       -------RSIEFPGDLLVKEMFRVLKPGGTILIYSSQQS--------------------V
DRE2_VITVI       -------RSLEFPCDKLLAEISRVLKPGGTVLIQKTSQS---------------------
DRE22_PICSI      --------SALHT-QQWLLELARVLRPGGIIVLQNPNSV---------------------
DRE21_PICSI      -------KCEFHK-QNLVVELARILKPGGAVFIQTLVSM-----------------EDGT
                                                                             

DRE2_BABBO       -----PNENVVKKECMYTGFV---ELTFF------EH-----------------------
DRE2_PLABA       ----NKILKRLRKECLYNGYI---NISAE------QT-----------------------
DRE2_PLAYO       IEDISQILKKLRKECLYNGYI---NISTE------QT-----------------------
DRE21_PARTE      ---------SVITYFQASGLY---NQGQG-------------------------------
DRE22_PARTE      ---------QITTYLEACGLY---SQGQG------QF-----------------------
DRE2_CRYHO       ---SIDKVKAFERNLLFSGFI---KVKKL------KG-----------------------
DRE2_CRYPI       ---SIDKVKAFERNLLFSGFI---KVKKL------KG-----------------------
DRE2_PHYIT       ----EEKKNAILMALMIGGLV---DTSDK------QE-----------------------
DRE2_MALGO       --DPSSFLSQVRAELTIAGFT---DIQTY------EN-----------------------
DRE2_USTMA       ----ASTAQKVKAELIIAGFT---DIQVD------VA-----------------------
DRE2_CRYNJ       ----ESQLGALHSALASHSFT---PVLPT------PS----------------------P
DRE2_CRYNB       ----ESQLGALHSALASHSFT---PVLPT------PS----------PST----------
DRE2_COPC7       -------LKTLPSELTLSGFLVLSAAGEN------PG-----------------------
DRE2_LACBS       -------VRTLPSELTLAGFN---VLSAL------PD-----------------------
DRE2_CAEBR       ---------TAHRKLRIAGF----RVTEL-------------------------------
DRE2_CAEEL       ---------TAQRKLRIAGF----RVTEV-------------------------------
DRE2_SCHJY       -----ELADAFERESLLAGWM---IESKG------PF-----------------------
DRE2_SCHPO       ------ADESFEMTALLSGWL---IESKS------PW-----------------------
DRE2_SCHJA       ------DWNSFRKNLTLSGYV---NPYQL------PG-----------------------
DRE2_SCHMA       ------DWDSLKKNLTLSGYI---NPYQL------SC-----------------------
DRE2_ACYPI       -------EDALVKRMKLCGFL---NVAKS------ES-----------------------
DRE2_MONBE       -----RNETALRSALTMGGFV---NVQVS------TS-----------------------
DRE2_TRIAD       --------DQIRSELILAGFT---NISIV------AE-----------------------
DRE2_DROWI       -------AGSLLQEIKLSGFI---NCSED------SD-----------------------
DRE2_DROGR       -------PASLLQEIKLSGFI---NCGED------TA-----------------------
DRE2_DROVI       -------AGSLLQEIKLSGFI---NCRED------AV-----------------------
DRE2_DROMO       -------AANLLQEIKLSGFI---NCSED------AA-----------------------
DRE2_DROPE       -------ASSLLQEIKLSGFI---NCSEG------TD-----------------------
DRE2_DROPS       -------ASSLLQEIKLSGFI---NCSEG-------------------------------
DRE2_DROAN       -------AGSLLQEVKLSGFI---NCRED------AD-----------------------
DRE2_DROME       -------AASLLQEIKLSGFI---NCRED-------S-----------------------
DRE2_DROSE       -------AASLLQEIKLSGFI---NCRED-------S-----------------------
DRE2_DROSI       -------AASLLQEIKLSGFI---NCRED-------------------------------
DRE2_DROYA       -------AASLLQEIKLSGFI---NCRED-------S-----------------------
DRE2_DROER       -------AASLLQEIKLSGFI---NCRED-------------------------------
DRE2_ANOGA       ------SIEQARSNLLLAGFI---NIVAS------DS-----------------------
DRE2_AEDAE       -------AEATRSNLLLSGFI---NITSL------DG-----------------------
DRE2_CULQU       -----GGAETVRANLLLSGFI---NIASA------EG-----------------------
DRE2_IXOSC       -----LDCDKLVYNLKLSGYV---DVSMG------SS-----------------------
CPIN1_TETNG      ----ERTSEKLVSTLKLSGFT---SVTEI-------S----------KAELSPDALSAIR
CPIN1_DANRE      ----VRTAEKLMSAIKLAGLV---SVTEV-------K----------TEPLSPKAAAALT
CPN1B_SALSA      NDQQLRTAEKLMSALKLSGLV---SVTEI------SK-----------GPLTPKALSALR
CPIN1_ONCMY      DDQKVRTAEKLISALKLSGLV---SVTEV------SK-----------EPLTPEAVSALK
CPN1A_SALSA      DDQKVRTAEKLISALKLSGLV---SVTEV------SK-----------EPLTPEAVSALK
CPIN1_XENLA      ----LRTPEHLSSVLKLSGLT---EVTQL------LQ-----------EPLNPEQKQGVV
CPIN1_XENTR      KGSPLRTPERLSSLLKLSGLT---EATQL------LQ-----------EPLSPEQKQTVV
CPIN1_CHICK      ----IKTAAKLPAALTLSGLV---EVKGL-------Q----------KEPLTAEEAQSVR
CPIN1_HUMAN      ----VKTASKLCSALTLSGLV---EVKEL-------Q----------REPLTPEEVQSVR
CPIN1_BOVIN      NNSKVKTASKLCSALTLSGLV---EVKEL------QR-----------ESLSPEEIQSVR
CPIN1_MOUSE      NNDKMKTASKLCSALTLSGLV---EIKEL------QR-----------EALSPEEVQSVQ
CPIN1_RAT        NNDKIKTASKLCSALTLSGLV---EIKEL------QR-----------EALSPEEAQSMQ
DRE2_NEMVE       --NDSRSPEKIISTLKLSGFV---SISQA------NE-----------------------
DRE2_BRAFL       NGGTLRTAAKLSSSLKLAGLV---SVSEA-------------------KEVSLSQQEHDL
DRE2_ASHGO       ------------VDALLSGFD---IVREP------TY-----------------HWQKRA
DRE2_ZYGRC       ------------LDALINEFEISRSENHY------CW---------IKKASIKAEPVAVP
DRE2_LACTC       ------------IDALINGFE---VVNSG------EQGYHWVKKGTAHTQTAPVALRPKR
DRE2_CANGA       ------------IDALVNDFDIVSDSGKY------HW----VKKVNMAVKAEPVAVPLKK
DRE2_YEAST       ------------VDALINGFE---IINEP------DY---------CWIKMDSSKLNQTV
DRE2_YEAS2       ------------VDALINGFE---IINEP------DY---------CWIKMDSSKLNQTV
DRE2_YEAS8       ------------VDALINGFE---IINEP------DY---------CWIKMDSSKLNQTV
DRE2_YEAS1       ------------VDALINGFE---IINEP------DY---------CWIKMDSSKLNQTV
DRE2_YEAS7       ------------VDALINGFE---IINEP------DY---------CWIKMDSSKLNQTV
DRE2_YARLI       -----------VMDFIMAGLA----QDGD------KW-----------------------
DRE2_KOMPG       -----------ATDGILQGFL---VESDT------KW-------------VKPSTLGSVV
DRE2_DEBHA       -----------NLDAIMSGFI---VGEQG------NW-------------IKPKAVGESV
DRE2_CLAL4       -----------DLDVLMNGFI---VKDDG------SW-------------------SKPA
DRE2_CANTT       -----------NLDVLMNGFL---IINQN------EW----------NKPQPEETVVTLK
DRE2_CANAL       -----------NLDVLMTGFIIEEEEKEK------EK------------EENNLEGELVN
DRE2_CANDC       -----------NLDVLMTGFI---IEEEE------QE---------QQEQQSGLNEGTVY
DRE2_BRUMA       -------EAKVLREVKLAGFLRVMKVNNN------AW-----------------------
DRE2_ARTOC       -----MIKEPARTEAILSGLI-ANDKGEL------VK-----------------------
DRE2_ASPCL       -------QAFDHNEAVLVGLI---PTDNG-------------------------------
DRE2_ASPFC       -------IAFDHNEAILAGLI---HVGNG-------------------------------
DRE2_NEOFI       -------VAFDHNEAILAGLI---HVGNG------KY-----------LKPDIEEMQAVP
DRE2_MAGO7       -------DAAIAKEAILAGLV---ESAEG------AY-----------------------
DRE2_PODAN       -----QGNSIEEKEAILAGLV---LGDDG-------------------------------
DRE2_NEUCR       ----RDTTTPEAREAVLAGLV---AGADG------FT-----------------------
DRE2_CHAGB       -GTEFLGDQRVGREAVLAGLV---AGGVG-------------------GFVKPEYAEEEA
DRE2_TALMQ       --------ATEGREAILAGLV---ENNGA------FE-----------------------
DRE2_TALSN       --------ANEGREAILAGLV---EKHGA------FE-----------------------
DRE2_ASPTN       --------SAEGLEAILAGLV---EKDGA------FE-----------------------
DRE2_ASPFN       --------ASEGLEAILAGLV---EKDGG------FE-----------------------
DRE2_ASPOR       --------ASEGLEAILAGLV--------EKDGGF-E-----------------------
DRE2_PENRW       --------ASDAMEAVLAGLV---QSDNG-------------------------------
DRE2_ASPNC       --------EAEEREAVLAGLI---KTDAG------FE-----------------------
DRE2_EMENI       --------EAEDREAVLAGLV---KKETG-------------------------------
DRE2_COCIM       ----TSTECPDNTELMLAGLV-FDDTGGL------LK-----------------------
DRE2_COCP7       ----PSTECPDNTELMLAGLV-FDDTGGL------LK-----------------------
DRE2_PARBA       GEKKSSSEQAFRNEAILAGLV-FDDRGEL------AK-----------------------
DRE2_PARBD       GEKMSSSEQAFRNEAILAGLV-FDDRGEL-------------------AKPDFGAQQAVP
DRE2_AJEDR       DDDNDNDELTFRNEAILAGLV-FDDNGEL------LK-------------------PDVA
DRE2_BLAGS       DDDNDNDELTFRNEAILAGLV-FDDNGEL------LK-------------------PDVA
DRE2_AJECN       SRRYNDDEQRFRNEVILAGLV-FDDKGEL------LK-----------------------
DRE2_AJECG       SRRYNDDEQRFRNEVILAGLV-FDDKGEL------LK-----------------------
DRE2_AJECH       SRRYNDDEQRFRNEVILAGLV-FDDKGEL-------------------LKPDIGAQQAIP
DRE2_PHANO       ------------TEAILAGLS---ESPNG--------------------MVKTEQVESVS
DRE2_PYRTR       --------GAEKTEAILAGLT---ETEDG------MA--------------KPEQEEPVS
DRE2_NECH7       ------EESTLSKEAVLAGLV---ASRGG------FE---------------------KP
DRE2_BOTFB       ----QEIDGAEYQEAILSGLV---AEGGV--------------------MLKPDYSASVA
DRE2_SCLS1       ----QEIDGAEYREAILAGLV---TEGGV------ML--------------KPDHSASVA
DRE2_DICDI       -----ETLVNSGMDFLIGGLV---DFKAT------SN-----------------------
DRE2_OSTLU       ------TATATTEAMVLAGFT---TVTRE------DD-----------------------
DRE2_OSTTA       -----------RDAAVLAGFA---DVVVD------AT-----------------------
DRE2_ARATH       --ETGEIQQTIQRRVTLAGFL---EPQCL------DL-----------------------
DRE2_MAIZE       --SSQKPNTDIERKLLMGGFA---EVQSS-------------------------------
DRE21_ORYSI      ----QDPNNSIERKLLLGGFV---DVQAS------AA-----------------------
DRE21_ORYSJ      ----QDPNNSIQRKLLLGGFV---DVQAS------AA-----------------------
DRE22_ORYSJ      ----QDPNNSIQRKLLLGGFV---DVQAS------AA-----------------------
DRE22_ORYSI      ----QDPNNSIQRKLLLGGFV---DVQAS------AA-----------------------
DRE2_SOYBN       ----DKIISSLENKLLLAGFT---EPQVL------QS-----------------------
DRE2_MEDTR       VGSGDKMIPDLENKLLLAGFS---EIQAL------QS-----------------------
DRE2_RICCO       ----SEAVLALERKLLLAGFL---EAQGL------------------------------Q
DRE2_POPTR       IGETDKAISGLQRKLLLGGFL---EAEAL------------------------------Q
DRE2_VITVI       VAGIKDGETSLERKLLMAGFL---EAQAI------------------------------Q
DRE22_PICSI      NDDVKETLSALERILLLAGFV---LSEGA------DG-----------------------
DRE21_PICSI      ----TKIHASLEHSLLLAGFVRPEVVASV------EG-----------------------
                                                                             

DRE2_BABBO       ---------NNFKWIVGK-R-PNWA-------PAQRSLTRG-------------------
DRE2_PLABA       -----MSENGIVINIKAE-N-PDFN-----------------------------------
DRE2_PLAYO       -----TSENGIVINIKAE-N-PDFN-----------------------------------
DRE21_PARTE      ---------------KFI-K-QVLQ-------IKKLNIPQQE------------------
DRE22_PARTE      -----IKRTLQTKKINIP-Q-QDFN-------NCYGKYDYIE------------------
DRE2_CRYHO       -DGLNSSDSDFEIVIKAE-K-PSWK---PEE-----------------------------
DRE2_CRYPI       -DGLNSSDSDFEIVIKAE-K-PSWK---PEE-----------------------------
DRE2_PHYIT       -SSPFYPEFSDAVSFTSK-K-QSFE-------SAAIPLAVKS------------------
DRE2_MALGO       ---ASIESRRPASSSVAE-KDSTAS---SGMGAVKLRRKPNE------------------
DRE2_USTMA       -----------TGSVSAS-K-PATA---SSSFSIGSSSGSSSAL----------------
DRE2_CRYNJ       STLAYTSPSAPSLPAVAS-E-PSPA---PSS-STPVTLSGAR------------------
DRE2_CRYNB       --LAYTSPSAPSLPTVAS-D-PSPA---PSS-STPVTLSGAR------------------
DRE2_COPC7       ------------DSIVAQ-K-PAHA---IGA-SVSLKKRGSATTTSTTAFVTTTTTTSTS
DRE2_LACBS       -----------EGTIIAQ-K-PQHV---AST-SVPLKSRQPGALL---------------
DRE2_CAEBR       -------------------A-ADWP---ARG-VKSVNFGDKV------------------
DRE2_CAEEL       ---------AAEFPVRGI-KLVNFG-----E-KVALDLGVVA------------------
DRE2_SCHJY       VLRRPAQVEAVPLKLSTK-KSAGAS---VGV-KLDFLFKKPE------------------
DRE2_SCHPO       ---------------ILS-RPNQVE-------AVPIKLSNKN------------------
DRE2_SCHJA       ---------GNHLIFIAF-VPSNYT---RGS-SIKLPWAHSD------------------
DRE2_SCHMA       ---------ENHLIFSAS-VPSNYT---QGS-SVKLPWANSD------------------
DRE2_ACYPI       ----------VPGVVVGN-M-PTYK---VGS-SDKVTLN---------------------
DRE2_MONBE       ---------EHALEAHAD-K-PVYE---VGA-AAPLKLSFAKKKQS--------------
DRE2_TRIAD       --------DNATVKVNAR-K-PNFE---IGS-SAALPFANKIS-----------------
DRE2_DROWI       ------------NTLTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROGR       -----------ANTLTAE-K-PGYE---TGS-AARLSFAKKA------------------
DRE2_DROVI       -----------ANTLTAE-K-PGYE---TGS-SARLSFAKKT------------------
DRE2_DROMO       -----------ANTLTAE-K-PGYE---TGS-SARLSFAKKS------------------
DRE2_DROPE       -------------TLTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROPS       -----------TDTLTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROAN       ------------DALTAE-K-PGYE---TGS-SARLSFAKKD------------------
DRE2_DROME       -----------PDALTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROSE       -----------PDALSAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROSI       ----------SPDALTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROYA       -----------PDALTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_DROER       ----------SPDALTAE-K-PGYE---TGS-SARLSFAKKN------------------
DRE2_ANOGA       ------------NVYVAE-K-PDYE---VGS-KSKLSFAKKS------------------
DRE2_AEDAE       ------------NVFVGE-K-PNYE---IGS-AAKLSLGGNK------------------
DRE2_CULQU       ------------NVYIAE-K-PNYE---IGS-AAKLSLGGGA------------------
DRE2_IXOSC       ---------TDLVEIKCS-K-PNYE---MGS-SSKLPFSSAVS-----------------
CPIN1_TETNG      TATGYQGNALFRIRMSAS-K-PDFE---VGS-SSQIKLSFGN------------------
CPIN1_DANRE      ERTGFSGNTLSRVRMTAS-K-PDFE---VGS-STQLKLSFGK------------------
CPN1B_SALSA      TSTGFQGNTLSRVRMSAS-K-PNFE---VGS-SSQLKLSFGKKTPKPE------------
CPIN1_ONCMY      TYTGFQGNTLSRVRMSAS-K-PNFE---VGS-SSQLKLSFGK------------------
CPN1A_SALSA      TFTGFQGNTLSRVRMSAS-K-PNFE---VGS-SSQLKFSFGKKTSKPV------------
CPIN1_XENLA      ELLGYNGNDVSTIRIRAK-K-PNYE---VGS-SRQLSLPKRK------------------
CPIN1_XENTR      ELLGYKGNDVSTIRMKAK-K-PNYE---LGS-SRQLSLPKSKIT----------------
CPIN1_CHICK      EHLGYQGNDLLIVQIEGR-K-PNFE---VGS-SSQLKLSFAK------------------
CPIN1_HUMAN      EHLGHESDNLLFVQITGK-K-PNFE---VGS-SRQLKLSITK------------------
CPIN1_BOVIN      EHLGYHSDSLLSLQITGK-K-PNFE---VGS-SSQLKLSIAKKSS---------------
CPIN1_MOUSE      EHLGYHSDSLRSVRVTGK-K-PNFE---VGS-SSQLKLPNKKSSS---------------
CPIN1_RAT        EHLGYHSDSLLSVHVTGK-K-PNFE---VGS-SSQLKLLHKKSSS---------------
DRE2_NEMVE       -------VKPSIVEISAQ-K-PSFE---VGA-KTALSLSFAPKP----------------
DRE2_BRAFL       LKQALSVDGIQVVEVSAS-K-PSYE---VGS-SAQLTLSFAKKKQV--------------
DRE2_ASHGO       VTASAPVKLAPRQPVSAA-GLPRFKRASAPS-PAAVTPTLDE------------------
DRE2_ZYGRC       LRNHKKTTTPGTTTTAKK-SLPIFK---RAT-DNDSTKNKQQ------------------
DRE2_LACTC       NTPSGGSKSLPIFAKPSF-ALPAFK---KAEKPKPTGLPTFKKPES--------------
DRE2_CANGA       SEKSEPSKTLPSFKKAGESKLPSFK---KAA-NKPLPTFKKK------------------
DRE2_YEAST       SIPLKKKKTNNTKLQSGS-KLPTFK---KAS-SSTSNLPSFKKADHSRQPIVKETDSF--
DRE2_YEAS2       SIPLKKKKTNNTKLQSGS-KLPTFK---KAS-SSTSNLPSFKKADHSRQPIVKETDSF--
DRE2_YEAS8       SIPLKKKKTNNTKLQSGS-KLPTFK---KAS-SSTSNLPSFKKADHSRQPIVKETDSF--
DRE2_YEAS1       SIPLKKKKTNNTKLQSGS-KLPTFK---KAS-SSTSNLPSFKKADHSRQPIVKETDSF--
DRE2_YEAS7       SIPLKKKKTNNTKLQSGS-KLPTFK---KAS-SSTSNLPSFKKADHSRQPIVKETDSF--
DRE2_YARLI       VKPAATGTTLLKKSGGGP-KKFAFK---RAS-PATAAPSTNG------------------
DRE2_KOMPG       SLKRPAGQNKTKSSAFKK-EMPFFK-----KLSSPPTLTDSS------------------
DRE2_DEBHA       SIPLKKKEVAVGGASKQC-L-PSFK---KLS-STHAAVGLTDTSASNT------------
DRE2_CLAL4       PVSTVLLRKKKPAETAAR-KMPTFK---KPV-SSPVTLTDTS------------------
DRE2_CANTT       KKSTTTNNNSNTSTIKKS-F-PMFKKLNNDN-ASTPGLTDSS------------------
DRE2_CANAL       VWVKPIPVDEPVVTLLKK-KTTTSNTTTIKK-SLPLFKKLNKDEINNSDKDINN------
DRE2_CANDC       VWVKPIPVDEPVVTLLKK-K-TTNN----TKKSLPLFKKLNK------------------
DRE2_BRUMA       ------------KAYDCE-K-PNVS---VGA-TVPLKLPHLN------------------
DRE2_ARTOC       ---------------------PVFE---EQSVLLPFSINRSQ------------------
DRE2_ASPCL       ---------------KFV-K-PDIE---DMR-AVPLRLGRKKHDKTISSNLAEP------
DRE2_ASPFC       ---------------KYQ-K-PDIK---EMQ-AVPLRLGRKNDHLA--------------
DRE2_NEOFI       LRLGRKND-----HLAGA---PSLEGSAAEH-PFPPEVSEGK------------------
DRE2_MAGO7       -----------------E-K-PAEE---VA--AVPLKFLKKKNKGEGGGPVQSP------
DRE2_PODAN       ----------------YT-K-PDYA---EQE-VVPLRFGAKKVNADGSVPLSFGKKAAAA
DRE2_NEUCR       -------------------K-PDYA---EEE-AVPLRFGLKRKTN---------------
DRE2_CHAGB       VPLRFGKKKAAAAAAAAV-SSAGPA---VGTVKVATATSAGKKEEVGM------------
DRE2_TALMQ       -------------------K-PQYQ----EA-AVPLRFGLKKKNK---------------
DRE2_TALSN       -------------------K-PQYQ----EA-AVPLRFGANK------------------
DRE2_ASPTN       -------------------K-PAYQ----EA-AVPLRLGGKK---------KKA------
DRE2_ASPFN       -------------------K-P------VQEAAVPLKLGGRKKK----------------
DRE2_ASPOR       -------------------K-P------VQEAAVPLKLGGRKKKDKTNGVNGVQ------
DRE2_PENRW       ----------------FE-K-PNFE---PSA-AVPLKFGLKK------------------
DRE2_ASPNC       ---------------KMD-Q-PKSF-------AIPLRRNGKKKDAA--------------
DRE2_EMENI       ----------------FE-K-MDVG---NGA-AVPLRLGRKK------------------
DRE2_COCIM       ---------------------PDFG---PEN-IVPLKLGKRK------------------
DRE2_COCP7       ---------------------PDFG---PEN-IVPLKLGKRK------------------
DRE2_PARBA       ---------------------PDFG---AQQ-AVPLKLGRKKNLGDSAF---------GN
DRE2_PARBD       LKLGRKKNLGESAFGNGAVELPASNGVRVTTGATSSTTTTTTTTAAAAAATA--------
DRE2_AJEDR       AQQAVPLKLGRRKKEKER-RHPSGNDVTNGKVNAPSSNGVNASTSTATATATTTTT----
DRE2_BLAGS       AQQAVPLKLGRRKKEKER-RHPSGNDVTNGKVNAPSSNGVNASTSTATATATTTTT----
DRE2_AJECN       ---------------------PDIG---AQQ-AIPLKLSRRRKEKEKTDTLASSANYSTN
DRE2_AJECG       ---------------------PDIG---AQQ-AIPLKLGRRKKEKEKTDTLASSANYITN
DRE2_AJECH       LKLGRRRKEKEKTDTLAS-S-ANYI--TNGTVDAPASNGISAPIPAAK------------
DRE2_PHANO       IPLKFGKKKTNGVNGTNGAVNPDG--------SVPLNLNGKR------------------
DRE2_PYRTR       IPLKFGKNKANGVSATNG-TNGAVN---PDG-SVPLNLNRKR------------------
DRE2_NECH7       DYGDNEGAVTLKFGLKKK-NQPAPL---ADG-SVPLNFKKKKPVE---------------
DRE2_BOTFB       VPLRLRRKDNSKNAAVSS-AGPAVS-------MAAVPLHGKRKSVDMTDDVPEKDVPKV-
DRE2_SCLS1       VPLRLRRKDNSKTTAVSN-AGPPVS-------TVEVPVSGKRKSVDMTEDVPEK------
DRE2_DICDI       --------STYKTIVHAD-K-PSWD---TNE-SSTINIPSTSS-----------------
DRE2_OSTLU       ------------GVVRCV-K-PNWA---RGT-AFALKSRAVR------------------
DRE2_OSTTA       -----------RGVVRGT-K-PAWA---RGT-AFSLKSRAVR------------------
DRE2_ARATH       -KSIKLSTFSLSFGIKAK-K-PSWK---IGS-SFALKKPVTN------------------
DRE2_MAIZE       --AASSQDSVQSVTVKAK-K-ASWS---MGS-SFPLKKTTK-------------------
DRE21_ORYSI      ----SSQDNEHSVNIKAK-K-ASWS---MGS-SFPLKKATKG------------------
DRE21_ORYSJ      ----SSQDSEHSVTIKAK-K-VSWS---LGS-SFPLKKATKG------------------
DRE22_ORYSJ      ----SSQDSEHSVTIKAK-K-VSWS---MGS-SFPLKKATKG------------------
DRE22_ORYSI      ----SSQDSEHSVTIKAK-K-VSWS---MGS-SFPLKKATK-------------------
DRE2_SOYBN       ------------AGIKAK-K-PSWK---IGS-SFALKKVIRS------------------
DRE2_MEDTR       ------------SVIKAK-K-PSWK---IGS-SFALKKVVKS------------------
DRE2_RICCO       LNSLELSGLDHSFGMKAK-K-PSWK---IGS-SFALKKSTKG------------------
DRE2_POPTR       PKPVGLSNVVCSFGVKAK-K-PSWN---IGS-SFALKKSIKS------------------
DRE2_VITVI       LKPVVPSEGAQSFGIKAK-K-PSWK---IGS-SFSIKKAEK-------------------
DRE22_PICSI      -----SIDGLGPLAVKGR-K-PAWD---TGS-SFKLKKKVAQ------------------
DRE21_PICSI      ---LASSDGLELFALRAQ-K-PTWE---TGS-SFSLKKKSVQ------------------
                                                                             

DRE2_BABBO       ------------------------------------------------------------
DRE2_PLABA       ----------------------------------------------------KSDD----
DRE2_PLAYO       ----------------------------------------------------KSDD----
DRE21_PARTE      ---------------FNNCYG------KYDYIEQKF-----------QNQINFFKQ----
DRE22_PARTE      ---------------------------QKFQNQINF-----------FKQV-DLKG----
DRE2_CRYHO       ------------------------------------------------------------
DRE2_CRYPI       ------------------------------------------------------------
DRE2_PHYIT       -------------------------------TTTQP-----------IKKWTVLAD----
DRE2_MALGO       ----------------------------NGGHQQKK-----------ALLWATQ------
DRE2_USTMA       ---------------PLRRKL------GSGASANAK-----------KSLWATQPA----
DRE2_CRYNJ       -----------------PLQL------RRNGDKARK-----------AALW-AI------
DRE2_CRYNB       -----------------PLQL------RRNGDKARK-----------AALW-AI------
DRE2_COPC7       TTTATVTSAP-----SVPLLL------RKRGDPAKK-----------KALW-ALT-----
DRE2_LACBS       ---------------------------NRKKTDPAK----------KQALWALSSP----
DRE2_CAEBR       ---------------------------TLDLGNATV------------------------
DRE2_CAEEL       ------------------------------------------------------------
DRE2_SCHJY       ---------------------------KQNTLSKND----------------VLKA----
DRE2_SCHPO       ---------------------------GQSASKNKI-----------LDFLKSDKENLIS
DRE2_SCHJA       -----------------------------------I-----------EAAWENVDN----
DRE2_SCHMA       -----------------------------------V-----------EAAWENVDN----
DRE2_ACYPI       -----------------------------PEMKENV-----------VSAW-KLDDN---
DRE2_MONBE       ---------------------------GAAAPAAQV-----------AEVW-TIAT----
DRE2_TRIAD       ---------------------------LGGNSKMET-----------AKMW-TLSS----
DRE2_DROWI       ---------------------------------SST-----------LNVW-KISG----
DRE2_DROGR       ----------------------------------AG-----------VNVW-KISG----
DRE2_DROVI       ----------------------------------SS-----------VNVW-KISG----
DRE2_DROMO       ----------------------------------PS-----------MNVWKISGD----
DRE2_DROPE       ---------------------------------ASA-----------LNVW-KISG----
DRE2_DROPS       ---------------------------------ASA-----------LNVWKISGD----
DRE2_DROAN       ---------------------------------ASA-----------LNVW-KISG----
DRE2_DROME       ---------------------------------ASA-----------VNVW-KISG----
DRE2_DROSE       ---------------------------------ANA-----------ANVW-KISG----
DRE2_DROSI       ---------------------------------ANA-----------VNVWKISGD----
DRE2_DROYA       ---------------------------------ASA-----------VNVW-KISG----
DRE2_DROER       ---------------------------------ASA-----------INVWKISGD----
DRE2_ANOGA       ----------------------------------NV-----------AAVW-KLDD----
DRE2_AEDAE       ---------------------------------AKV-----------AAVW-KL------
DRE2_CULQU       -------------------------------NKAKV-----------AAVW-KLDV----
DRE2_IXOSC       ---------------------------SNQKSSADV-----------SKIW-SLSA----
CPIN1_TETNG      ---------------KAPRPA------DKPAPDPNT-----------VKMW-MLSA----
CPIN1_DANRE      ----------------KKTTT------VKPALDPGT-----------AQKW-TLSA----
CPN1B_SALSA      ---------------------------DKPALDPNV-----------EKAW-TLSA----
CPIN1_ONCMY      ---------------KTSKPV------DKPVLDPNA-----------ARAW-TLSA----
CPN1A_SALSA      ---------------------------DKPALDPNA-----------AKAW-TLSA----
CPIN1_XENLA      -------------------TA------EKPSVDPAA-----------AKLW-TLSA----
CPIN1_XENTR      ---------------------------EKSSVDQAT-----------VKLW-TLSA----
CPIN1_CHICK      ----------------KTSPS------GKPSVDPAT-----------AKLW-TLSA----
CPIN1_HUMAN      ----------------KSSPS------VKPAVDPAA-----------AKLW-TLSA----
CPIN1_BOVIN      ---------------------------GKPAVDPAA-----------AKLW-TLSA----
CPIN1_MOUSE      ---------------------------VKPVVDPAA-----------AKLW-TLSA----
CPIN1_RAT        ---------------------------VKPVVDPAT-----------AKLW-TLSA----
DRE2_NEMVE       ---------------------------AQPKAETSA-----------AQIW-TLSA----
DRE2_BRAFL       ---------------------------EKPKLDENT-----------AKIW-SLSA----
DRE2_ASHGO       ---------------------------VPPAAVDPV-----------KAALLDSAA----
DRE2_ZYGRC       ---------------------------KQQHTGPAR------------VSLDSEDEDEES
DRE2_LACTC       ---------------------------PRASVVAED-----------LDDGDELDGMNED
DRE2_CANGA       ---------------------------VEEAKPKVE-----------ARVHKAENDDDEL
DRE2_YEAST       ---------------------------KPPSFKMTT-----------EPKVYRVVDDLIE
DRE2_YEAS2       ---------------------------KPPSFKMTT-----------EPKVYRVVDDLIE
DRE2_YEAS8       ---------------------------KPPSFKMAT-----------EPKVYRVVDDLIE
DRE2_YEAS1       ---------------------------KPPSFKMAT-----------EPKVYRVVDDLIE
DRE2_YEAS7       ---------------------------KPPSFKMAT-----------EPKVYRVVDDLIE
DRE2_YARLI       ---------------------------TNPAATVNL-----------NSVVTLSMD----
DRE2_KOMPG       -----------------------------EADEDEE-----------SQLNEKLKGSKLI
DRE2_DEBHA       ---------------------------DEENDDVNS-----------KRKLQETKLAYFS
DRE2_CLAL4       ---------------------------ANNTDAEDD-----------LSMKRKLDSTKLA
DRE2_CANTT       ---------------AGTSED------ETATVSNKR--------KLVESKLVYFSD----
DRE2_CANAL       ---------------------------DNITNNNNN-----------NNNKRKLVETKLT
DRE2_CANDC       ---------------NDMTIN------VPQEIDNIT----NNKRKLVETKL-TYFS----
DRE2_BRUMA       ----------------------------------KK-----------SNVWNIKVM----
DRE2_ARTOC       ---------------KSIKGI------NINKSDQQP-----------AILQKNIVTLTNN
DRE2_ASPCL       ---------------VRNHQA------SPTVAQDQA-----------EDGF-RYSSGRNI
DRE2_ASPFC       ---------------GAPSLQ------ESAAEHPCP-----------PETMISAST----
DRE2_NEOFI       ---------------------------TASGDNRVA-----------VVGSQKFRENIVS
DRE2_MAGO7       ---------------AAATQP------TAPAPAAAA-----------KSLPNGVVM----
DRE2_PODAN       ---------------PAPAPA------PAPVSKGPA-----------GVGFIDFS-----
DRE2_NEUCR       ---------------------------PNPVVAPIQPVAQVVTAAPAGVGFVTLDLNDDL
DRE2_CHAGB       ---------------------------VPPAVAAAA-------AAPAGVGFVDFSDDLDL
DRE2_TALMQ       ---------------------------VAPEPVKVE-----------SVGFVDNYD----
DRE2_TALSN       ---------------------------RKNKISPEP-------VKIESVGFVDNYD----
DRE2_ASPTN       ---------------------------PAPTEQPPV-----------ATGVGFVDG----
DRE2_ASPFN       ---------------------------DKTNGVNGV-----------QNGVATNGASTNG
DRE2_ASPOR       ---------------------------NGVATNGAS-----------TNGV-GMFD----
DRE2_PENRW       ------------------KNK------PTPTAVPSI-----------PTGFAAPMGIDSP
DRE2_ASPNC       ---------------KTETFA------PAPAPAPPV-----------QPVTVGMIN----
DRE2_EMENI       ----------------KAAPA------PAPVVQPPP----------------IISS----
DRE2_COCIM       -PVHSVSSNGTGTSGPHVNMQLSTGSMLKGQTTTIK-----------GVGFVDFTDDPSL
DRE2_COCP7       -PVHSVSSNGTGTSGPHVNMQLSTGSMLKGQTTTIK-----------GVGFVDFTDDPSL
DRE2_PARBA       GTVELPASNGVRVTAGATTT-TPTTTTTTTINSSTP----------SGVRFIDFSDDFGV
DRE2_PARBD       ---------------------------ATPTTTTTT---TINSSTPSGVGFIDFSDDFGV
DRE2_AJEDR       ---------------------------TTPKTNPAP----------SGVGFIDFSDDYGV
DRE2_BLAGS       ---------------------------TTPKTNPAP----------SGVGFIDFSDDYGV
DRE2_AJECN       GTVGAPSSNGISAPIPAAKTT------ENNPVPPGV-------------GFIDFSDDFGV
DRE2_AJECG       GTVDAPASNGISAPIPAAKTT------ENNPVPPGV-------------GFIDFSDDFGV
DRE2_AJECH       ---------------------------TTENNPVPP-----------GVGFIDFSDDFGM
DRE2_PHANO       ---------------------------NQPEPVKPV-----------GVGFVDFSDDLDD
DRE2_PYRTR       ---------------------------DQPEPVKPA-----------GVGFVDFSD----
DRE2_NECH7       ---------------------------VKPVVPVVP----------AGVGFIDLSD----
DRE2_BOTFB       ---------------------------DSPKNDAPK-----------GVGFIDFSDDFDA
DRE2_SCLS1       ---------------------------DVPKNDVPK-----------GVGFIDFSDDFDA
DRE2_DICDI       -----------------------------------------------NNPWASIE-----
DRE2_OSTLU       ----------------------------VNATAADA-----------ADAWGASAA----
DRE2_OSTTA       --------------------------------VVTA-----------DAGW-GADA----
DRE2_ARATH       -----------------------------------------------LFKI-DLDD----
DRE2_MAIZE       ---------------------------ALPKIQIDD------------------------
DRE21_ORYSI      --------------------------------LPKI----------------QIDD----
DRE21_ORYSJ      --------------------------------LPKI----------------QIDD----
DRE22_ORYSJ      --------------------------------LPKI----------------QIDD----
DRE22_ORYSI      ---------------------------GLPKIQIDD------------------------
DRE2_SOYBN       ----------------------------SPKMQIDF------------------------
DRE2_MEDTR       ----------------------------SPKVQIDF------------------------
DRE2_RICCO       ------------------------------SVKVNL------------------------
DRE2_POPTR       ----------------------------PVKVQNDD------------------------
DRE2_VITVI       ---------------------------SLPKFQIED------------------------
DRE22_PICSI      --------------------------------KPAN-----------VVTFDIPAFKVQL
DRE21_PICSI      ---------------------------KQESLPKPG-----------ALSVK--------
                                                                             

DRE2_BABBO       ----------------------TLKVVSL--DDYI-----------------PSAP----
DRE2_PLABA       ----------------------DNNLVSS-------DEEIYEK-----------------
DRE2_PLAYO       ----------------------DNNLVSS-------DEEIYEK-----------------
DRE21_PARTE      -VDING----------------KQEIIDE--NELL-DDGVQVK---------QVES----
DRE22_PARTE      ----------------------NQETIDE--NELLNDGVEVKQ-----------------
DRE2_CRYHO       ----------------------GKVLVDD--IDLEGSVPDIKN---------YVPLGQ--
DRE2_CRYPI       ----------------------GKVLVDD--IDLEGSVPDIKN---------YVPLGQ--
DRE2_PHYIT       --DFGDDQ--------------DDDIIDE--DTLLDDTDEVLQ----------------A
DRE2_MALGO       ----------------------PETHMDT--EAKL---QEHAR---------TVSPAS--
DRE2_USTMA       ---------------------SANDLIDE--ASLL-RDADFVA-----------TTAV--
DRE2_CRYNJ       ----------------------DSPLIPDGGKSLL-TPADRTR---------PD------
DRE2_CRYNB       ----------------------DSPLIPDGGKSLL-TPADRTR---------PD------
DRE2_COPC7       -TDASAS---------------PSTKIDA--DALL-TAEDKAR---------PVPT----
DRE2_LACBS       ----------------------STPKIDP--EALL-TAEDKTR-----------------
DRE2_CAEBR       ----------------------EEDLIDE--DGLL-QEEDYEK---------PTGDQL--
DRE2_CAEEL       ----------------------DEDLIDE--DGLL-QEEDFEK---------PTGDQL--
DRE2_SCHJY       -AQEEEEG--------------EDDLYDE--DALV-SDEETQL---------GKDVLA--
DRE2_SCHPO       GDD-------------------DQELIDE--DELL-DESAHDN-------------VL--
DRE2_SCHJA       -ETSYDV---------------DKNLINT--NSLL-QKSDYVT---------PLAA----
DRE2_SCHMA       -SSDA-----------------NGNIINT--NTLL-QKSDLKT---------PLSV----
DRE2_ACYPI       ----------------------NSETISE--DDLL-EADDLIK---------PDSSSL--
DRE2_MONBE       -DDFD-----------------DDDLLENDGDELL-DAEDLAL---------ATTAPE--
DRE2_TRIAD       -QDFVDD---------------DIDIIDE--NTLI-EEDDFLK---------PDPSSL--
DRE2_DROWI       ---------------------DDDELIDE--EDLL-DEVDKQK---------PDPASL--
DRE2_DROGR       ---------------------DDEELIDE--EDLL-DEADKQK---------PDPSGL--
DRE2_DROVI       --D-------------------DEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_DROMO       ----------------------DEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_DROPE       ---------------------DDEELIDE--EDLL-DEEDKQK---------PDPAGL--
DRE2_DROPS       ----------------------DEELIDE--EDLL-DEEDKQK---------PDPAGL--
DRE2_DROAN       ---------------------DDEELIDE--EDLL-DEEDKQK---------PDPAGL--
DRE2_DROME       ---------------------DDEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_DROSE       ---------------------DDEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_DROSI       ----------------------DEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_DROYA       ---------------------DDEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_DROER       ----------------------DEELIDE--EELL-DEEDKQK---------PDPAGL--
DRE2_ANOGA       -NE-------------------EEERIDD--EELL-DEDDKAK---------PTEESL--
DRE2_AEDAE       --DVDDD---------------DDERIDE--DELL-DEEDKVK---------PTAESL--
DRE2_CULQU       --DDDGE---------------AEERIDE--DELL-DEEDKVK---------PSAESL--
DRE2_IXOSC       -QDVLDR---------------DVELVDP--DQLI-SEEDFKK---------PDPSTL--
CPIN1_TETNG      -NDMNDD---------------DLDLVDS--DSLL-DEEDLKK---------PDPSSL--
CPIN1_DANRE      -NDMDDD---------------DVDLVDS--DALL-DADDLKK---------PDPSSL--
CPN1B_SALSA      -NDMDDD---------------DVDLVDS--DALL-DADDLKK---------PDAASL--
CPIN1_ONCMY      -NDMDDD---------------DVDLVDS--DALL-DADDFKK---------PDASSL--
CPN1A_SALSA      -NDMDDD---------------DVDLVDS--DALL-DADDFKK---------PDAASL--
CPIN1_XENLA      -SDMNDD---------------DVDILDS--DELL-DQEDLKK---------PAPSSL--
CPIN1_XENTR      -NDMNDE---------------NVDLLDS--DELL-DQEDLKK---------PVPSSL--
CPIN1_CHICK      -SDMNDE---------------EMDLLDS--DELL-DSEDLKK---------PDPASL--
CPIN1_HUMAN      -NDMEDD---------------SMDLIDS--DELL-DPEDLKK---------PDPASL--
CPIN1_BOVIN      -NDMEDE---------------SVDLIDS--DELL-DAEDLKK---------PDPASL--
CPIN1_MOUSE      -NDMEDD---------------SVDLIDS--DELL-DPEDLKR---------PDPASL--
CPIN1_RAT        -NDMEDD---------------SMDLIDS--DELL-DPEDLKK---------PDPASL--
DRE2_NEMVE       -QDIDDE---------------DVDLLDS--DTLL-DEDDLKK---------PDPLSL--
DRE2_BRAFL       -VDMNDD---------------DIDLLDP--DELL-DEEDLKK---------PDPASL--
DRE2_ASHGO       ----------------------GDAPIAE--NDLV-VGHDST----------PITLLT--
DRE2_ZYGRC       EGSSDPSDSKSKFFEKSGSPLTENDSIEE--DELV-DENEMRE---------PSLTMI--
DRE2_LACTC       DSNSDELTASKSKFFDDVAGQDSADSIDE--DDLV---DDAEK---------SAITVV--
DRE2_CANGA       EDEEDENLFDASRSKYFDED--DSESLDE--DDLL-NEEDAKN-----------IGGI--
DRE2_YEAST       DSDDDDFSSDSSKAQYFDQVDTSDDSIEE--EELI-DEDGSGK---------SMITMI--
DRE2_YEAS2       DSDDDDFSSDSSKAQYFDQVDTSDDSIEE--EELI-DEDGSGK---------SMITMI--
DRE2_YEAS8       DSDDDDFSSDSSKAQYFDQVDTSDDSIEE--EELI-DEDGSGK---------SMITMI--
DRE2_YEAS1       DSDDDDFSSDSSKAQYFDQVDTSDDSIEE--EELI-DEDGSGK---------SMITMI--
DRE2_YEAS7       DSDDDDFSSDSSKAQYFDQVDTSDDSIEE--EELI-DEDGSGK---------SMITMI--
DRE2_YARLI       ----------------------DDDLMDE--DDLMEDDTNLSM---------PIK-----
DRE2_KOMPG       YFDESS----------------DDEIIDE--DELLRDDDGALK--------GPVVVPV--
DRE2_DEBHA       ESDDEDE---------------EDQIIDE--NNLI---SEVRT---------ANLV----
DRE2_CLAL4       YFSDDSSGE-------------EDDLIDE--NELI---ADSHK---------FNVNIV--
DRE2_CANTT       -DDDDDDYDGSSD---------GEDLINE--NDLI-AESNKYK-------------II--
DRE2_CANAL       YFSSDDENSSDGSVLENDDIDDDDELIDE--NDLL-NFNNNNN-----TNGGSLLSDKLI
DRE2_CANDC       -SDDENSSDGSLSDNANEEEEDDDELIDE--NDLL-KYNNHNNNNNNNGEQSFSDKLI--
DRE2_BRUMA       ----------------------DDDLIDE--DTLL-KDEDYVK---------PIKESHEE
DRE2_ARTOC       TNDIFNGLEGD-----------DDELIDE--DELI-NEDELER---------PIIQ----
DRE2_ASPCL       VTASAHETS-------------DNEIIDE--EDLL-DGSELAA---------PIIQ----
DRE2_ASPFC       -MNSNEAS--------------DDELINE--DNLL-DDSELSA---------PIIQRG--
DRE2_NEOFI       AATMDNNEAS------------DDELINE--DNLL-DDSELSA---------PII-----
DRE2_MAGO7       -VDLNDDFDVS-----------DDEMIDE--DELM-TEEDLMR---------PIQQ----
DRE2_PODAN       -DDLDLDAED------------DDDVIDE--DTLL-TEADLKR---------PIQQ----
DRE2_NEUCR       DLDGEDD---------------DDDVIDE--DTLL-TEADLRR---------PIQ-----
DRE2_CHAGB       DVED------------------DEDVIDE--ETLL-TEEDLWR---------PIQ-----
DRE2_TALMQ       ----------------------DDELIDE--DDLL-AEEDLGR---------PVQ-----
DRE2_TALSN       ----------------------DDELINE--DDLL-DEEDLGK---------PVQ-----
DRE2_ASPTN       ----------------------NDELIDE--DDLL-SDDDLKR---------PMQQ----
DRE2_ASPFN       VGMFDPAQNN------------DDELIDE--DALL-SDDDLKR---------PLP-----
DRE2_ASPOR       -PAQNN----------------DDELIDE--DALL-SDDDLKR---------PLPR----
DRE2_PENRW       VTNHDRDE--------------DDELINE--DTLL-SEEDLTR---------PIMP----
DRE2_ASPNC       -NDDDYEN--------------DDDLIDE--DTLL-SDEDLKR---------PIQ-----
DRE2_EMENI       -DDNDLN---------------DDELIDE--DTLL-SADDLKR---------PIVP----
DRE2_COCIM       SEADIYSGQT------------DDELIDE--ETLL-DGEDMGR---------PIIQ----
DRE2_COCP7       SEADIYSGQT------------DDELIDE--ETLL-DGEDMGR---------PIIQ----
DRE2_PARBA       PMVEETQEL-------------DEELIDE--EELL-GEFDMGR---------PIV-----
DRE2_PARBD       PMVEETQDS-------------DEELIDE--EELL-GEYDMGR---------HIV-----
DRE2_AJEDR       PMEEDPQGS-------------DDELIDE--DELL-GEDDMGR---------PIV-----
DRE2_BLAGS       PMEEDPQGS-------------DDELIDE--DELL-GEDDMGR---------PIV-----
DRE2_AJECN       PAEDDPQDS-------------DEELIDE--DELL-DEDDMGR---------QIV-----
DRE2_AJECG       PAEDDLEDS-------------DEELIDE--DELL-DEDDMGR---------QIV-----
DRE2_AJECH       PAEDDLEDS-------------DEELIDE--DELL-DEDDMGR---------QIV-----
DRE2_PHANO       PIITGEDD--------------DDDLIDE--DDLI-TEEDMAR---------PVIQ----
DRE2_PYRTR       --DLDDPIITGE----------DDDLIDE--DDLI-TEADMAR---------PVVQPL--
DRE2_NECH7       --DLD-----------------DDDLIDE--DTLM-TEEDLLR---------PIN-----
DRE2_BOTFB       EDD-------------------DDELIDE--DTLL-TEEDMKK---------PLA-----
DRE2_SCLS1       EDD-------------------DDELIDE--DTLL-TEEDMKK---------PLA-----
DRE2_DICDI       ----------------------GGDRINE--NDLV-SENDKTS---------KPATTL--
DRE2_OSTLU       -AD-------------------DDELIDE--SALL-TELDVNT------------APV--
DRE2_OSTTA       -DV-------------------DDELIDE--SALL-TELDVNS------------TAV--
DRE2_ARATH       ----------------------DVDLIDE--DSLL-TEEDLMK---------PQLP----
DRE2_MAIZE       ----------------------DSDLIDE--DSLL-TEEDLKK---------PQLPVV--
DRE21_ORYSI      ----------------------DSELIDE--DSLL-TEDDLKK---------PELPVV--
DRE21_ORYSJ      ----------------------DSELIDE--DSLL-TEDDLKK---------PELPVV--
DRE22_ORYSJ      ----------------------DSELIDE--DSLL-TEDDLKK---------PELPVV--
DRE22_ORYSI      ----------------------DSELIDE--DSLL-TEDDLKK---------PELPVV--
DRE2_SOYBN       ----------------------DSDLIDE--DSFL-TEEDLKK---------PQLP----
DRE2_MEDTR       ----------------------DSDLIDE--NSLL-SEEDLKK---------PELPSG--
DRE2_RICCO       ----------------------DDDLIDE--DSLL-TEEDMKK---------PPIAPG--
DRE2_POPTR       ----------------------YSDLIDE--DSLL-TEEDLKK---------PQLPPV--
DRE2_VITVI       ----------------------DMDLIDE--DSLL-TEEDLKK---------PQLP----
DRE22_PICSI      GDD-------------------LDDLIDE--DSLL-TEEDLKK---------PDLPPV--
DRE21_PICSI      -PEMNVD---------------LEDLIDE--ESLL-SEEDLKR---------PPLPSA--
                                                                             

DRE2_BABBO       AAESC-DTK----------PRPCANCNCGRAE-RVNT-DAK-------------------
DRE2_PLABA       ----C-EDK------KKVVNRVCDNCTCGKKEKAMNL-EKIKINDN--------------
DRE2_PLAYO       ----C-EDK------KKVVNRVCDNCTCGKKEKAMNL-EKIKINDN--------------
DRE21_PARTE      ----C---A------SK--PRACANCTCGRKE-MEEK-QDKEQL----------------
DRE22_PARTE      -VESC-ASK----------PRACANCTCGRKE-MEEK-QDKEQL----------------
DRE2_CRYHO       GKESC---K------SK--ERACNNCNCGRADLEKEI-GIEAARKVY-------------
DRE2_CRYPI       GKESC-KSK----------ERACNNCNCGRADLEKEI-GVEAARKVY-------------
DRE2_PHYIT       AKADC-GDA----VGGK--KRACKNCTCGLKD-ENDK-----------------------
DRE2_MALGO       RREDC-TVDFSAPRTRR--KRACKGCTCGLRELEEED-ERNSNLVQLDPSEVGGTGGKRT
DRE2_USTMA       KRPDC-DVG--AGQGKK--KKACKGCTCGLRELQEEE-KRTANTNIVQLDTDDMDMPNAD
DRE2_CRYNJ       ----CVFPAENGKPVKR--RRACKDCTCGLKELEQEE-EAQTSAAVQEAQKAFFLEGDDD
DRE2_CRYNB       ----CVFPAENGKPVKR--RRACKDCTCGLKELEQEE-EAQTSAAVQEAQKAFFLEGDDD
DRE2_COPC7       ----C-APV-DRSAPRR--KKACKNCSCGLAELEEEE-KRNAPVVVIDSSIDGEGG----
DRE2_LACBS       LTPAC-EPV-RSSAPRR--KKACKSCSCGLAE-LEEE-ERKLGKVVLLDGSQDGT-----
DRE2_CAEBR       KAGGC-GPD---DPNKK--KRACKNCNCGLAE-QEEA-EKM-------------------
DRE2_CAEEL       KAGGC-GPD---DPNKK--KRACKNCSCGLAE-QEEL-EK--------------------
DRE2_SCHJY       PPSTCSKPG-------K--KKRCKNCTCGQRE-QDEA-EAAAASAAAPK-----------
DRE2_SCHPO       KVPEC-KPE----PGKK--KRACKNCTCGLRE-MEEH-ESSKTSAQLE------------
DRE2_SCHJA       ----CGQEFAKNSIGKR--KRACKNCTCGLAEIEATEVEDK-------------------
DRE2_SCHMA       ----CGKEAATDSVGKK--KRACKNCTCGLAEIEAAE-EDK-------------------
DRE2_ACYPI       RV--C-ATT------KK--AKACKDCSCGLAE-ELEA-NRL--KD---------------
DRE2_MONBE       GDD-C-EVG----AGGK--RRACKNCTCGRADAEAEQ-AAK-------------------
DRE2_TRIAD       RSQECDSAK------KK--RKACKNCSCGLAE-EIES-EKK-------------------
DRE2_DROWI       KV--C-STT------GK--RKACKNCSCGLAD-ELEN-EKKQENA---------------
DRE2_DROGR       RV--C-STT------GK--RKACKNCSCGLAE-ELES-ERT-------------------
DRE2_DROVI       RV--C-STT------GK--RKACKNCSCGLAE-ELES-EKT-------------------
DRE2_DROMO       RV--C-STT------GK--RKACKNCSCGLAE-ELED-EKK-------------------
DRE2_DROPE       KV--C-STT------GK--RKACKNCSCGLAE-ELES-EKQ-------------------
DRE2_DROPS       --KVC-STT------GK--RKACKNCSCGLAE-ELES-EKQ-------------------
DRE2_DROAN       RV--C-STT------GK--RKACKNCSCGLAE-ELES-EKQ-------------------
DRE2_DROME       RV--C-STT------GK--RKACKNCSCGLAE-ELET-EKQ-------------------
DRE2_DROSE       RV--C-STT------GK--RKACKNCSCGLAE-ELET-EKQ-------------------
DRE2_DROSI       --RVC-STT------GK--RKACKNCSCGLAE-ELET-EKQ-------------------
DRE2_DROYA       RV--C-STT------GK--RKACKNCSCGLAE-ELET-EKQ-------------------
DRE2_DROER       --RVC-STT------GK--RKACKNCSCGLAE-ELET-EKQ-------------------
DRE2_ANOGA       RV--C-GTT------GK--RKACKDCSCGLAE-ELDA-EAK---G---------------
DRE2_AEDAE       RV--C-GTT------GK--RKACKDCSCGLAE-ELEA-ETK-------------------
DRE2_CULQU       RV--C-GTT------GK--RKACKDCSCGLAE-ELDA-ESK-------------------
DRE2_IXOSC       -KASC-GGE------KK--RKACKNCTCGLAE-ELDK-EAA-------------------
CPIN1_TETNG      KASTC-GEA----AGKK--KKACKNCTCGLAE-ELEQ-ESK-------------------
CPIN1_DANRE      KAS-C-GDD----SKKK--KKACKNCTCGLAE-ELEQ-ESK-------------------
CPN1B_SALSA      KAPSC-GDG----TTKK--KKACKNCSCGLAE-ELEQ-ESK-------------------
CPIN1_ONCMY      KAPSC-GDG----TTKK--KKACKNCSCGLAE-ESEQ-ESK-------------------
CPN1A_SALSA      KAPSC-GDG----TTKK--KKACKNCSCGLAE-ELEQ-ESK-------------------
CPIN1_XENLA      LASGC-GEG----SEKK--RKACKNCTCGLAE-ELEA-EKT-------------------
CPIN1_XENTR      RASGC-GEG----SEKK--RKACKNCTCGLAE-ELEA-EKT-------------------
CPIN1_CHICK      RAPSC-KEK------GK--KKACKNCTCGLAE-ELEQ-EKK-------------------
CPIN1_HUMAN      RAASC-GEG------KK--RKACKNCTCGLAE-ELEK-EKS-------------------
CPIN1_BOVIN      RAPSC-GEG------KK--RKACKNCTCGLAE-ELEK-EKS-------------------
CPIN1_MOUSE      KAPSC-GEG------KK--RKACKNCTCGLAE-ELER-EQS-------------------
CPIN1_RAT        KAPSC-GEG------KK--RKACKNCTCGLAE-ELEK-EQS-------------------
DRE2_NEMVE       -KAAC-GPG-----SGK--KKACKNCTCGLAE-QENG-DA--------------------
DRE2_BRAFL       -KAQC-GTG---GDTKK--RKACKNCTCGLAE-ELEG-DQP-------------------
DRE2_ASHGO       ----C-GRT----QTRR--RKACKDCTCGLRE-ENEK-EISDTHARQEKLLLGD------
DRE2_ZYGRC       ---TC-GKS----KTRR--RKACKDCTCGQKE-IEEE-ELDGVRKQQDK-----------
DRE2_LACTC       ---TC-GKT----KTRR--RKACKDCTCGLKE-AEAQ-EADAARAAQDRILGK-------
DRE2_CANGA       TMITC-GKS----KTKK--KKACKDCSCGIKE-EEEA-EIDNIRSQQDT-----------
DRE2_YEAST       ---TC-GKS----KTKK--KKACKDCTCGMKE-QEEN-EINDIRSQQDK-----------
DRE2_YEAS2       ---TC-GKS----KTKK--KKACKDCTCGMKE-QEEN-EINDIRSQQDK-----------
DRE2_YEAS8       ---TC-GKS----KTKK--KKACKDCTCGMKE-QEGK-EINDIRSQQDK-----------
DRE2_YEAS1       ---TC-GKS----KTKK--KKACKDCTCGMKE-QEGK-EINDIRSQQDK-----------
DRE2_YEAS7       ---TC-GKS----KTKK--KKACKDCTCGMKE-QEGK-EINDIRSQQDK-----------
DRE2_YARLI       IPAKC-DPG---PGKKR--RKACKDCTCGLKE-MEEQ-AKDAQLAAQN------------
DRE2_KOMPG       K---CALPN----GKRR--KKACKDCTCGLKE-LEEN-EQNERLDAQAS-ILSKLATSAN
DRE2_DEBHA       VPKKCELPN----GKKR--RKACKDCTCGLKE--IEA-QETSDKSTLQNSILNQMVQSAN
DRE2_CLAL4       VPKKCELPN----GKKR--KKACKDCTCGLKE-LEEQ-EEQATRNLQDT-LLGKMAQSAT
DRE2_CANTT       VPKKCELPN----GKKR--KKACKDCTCGLKE-LEEE-EIKSQGKLQDT-VLANMAQSAT
DRE2_CANAL       TPRKC-DIS-LNGGKKR--KKACKDCTCGLKE-LEEL-EVSNQQNLQDQ-ILGKLAQSAT
DRE2_CANDC       TPRKC-ELSLNGGK-KR--KKACKDCTCGLKE-LEEL-EVSNQQNLQDQ-ILGKLAQSAT
DRE2_BRUMA       KLNFC-GEL------KK--RRPCKNCTCGLAE-IVES-EKV-------------------
DRE2_ARTOC       -PPEC-RPK----AGKR--RRACKDCTCGLAQ-KLEA-EDKRQRANADEKLS--------
DRE2_ASPCL       -PPEC-RPK----AGRR--RRACKDCTCGLAQ-KLEE-EDAMRRHAADKQLG--------
DRE2_ASPFC       PAPEC-RPK----AGKR--RRACKDCTCGLAQ-KLQE-EDAVKRADADEQLD--------
DRE2_NEOFI       QPPEC-RPK----AGKR--RRACKDCTCGLAQ-KLQE-EDAVKRADADEQLD--------
DRE2_MAGO7       -PPEC-APK----PGKK--RRACKDCTCGLAE-RLEA-QDKARRDKADKQLQEKAAT---
DRE2_PODAN       -PPEC-APQ----PGKK--RRACKDCTCGLAE-RIAA-EDKARREKAEKGLA--------
DRE2_NEUCR       QPPEC-QPK----PGKK--RRACKDCTCGLAE-RLEA-EDKARRDKADQALN--------
DRE2_CHAGB       QPPEC-QPQ----PGKK--RRACKDCTCGLAS-RMEA-EDKARRAKADSDLN--------
DRE2_TALMQ       QPAEC-KPD---IAKKR--RRACKDCTCGLAA-QLEA-EDAERREKANAELN--------
DRE2_TALSN       QPAEC-QPE---TAKKR--RRACKDCTCGLAA-QLEA-EDAERREKANADLN--------
DRE2_ASPTN       -PANC-QPE---KAKKR--RRPCKDCTCGLAA-EMEA-EDKARQEKADKDLN--------
DRE2_ASPFN       RPQNCVPET----AKKR--RRPCKDCTCGLAS-QLEE-EDRAREAKAAQDLN--------
DRE2_ASPOR       -PQNC-VPE---TAKKR--RRPCKDCTCGLAS-QLEE-EDRAREAKAAQDLN--------
DRE2_PENRW       -PPEC-QPK----TGRR--RRACKDCTCGLAD-KLEA-EDKERRANADKELN--------
DRE2_ASPNC       -PPEC-QPK----PGRR--RRACKDCTCGLAA-RLEA-EEQAEREKADKALN--------
DRE2_EMENI       -PPEC-QPK----AGKR--RRACKDCTCGLAA-QIEA-EDRERREAADKSLN--------
DRE2_COCIM       -PPEC-RPK----AGKR--RRACKDCTCGLAE-RLRE-EDKAARAKADATLE--------
DRE2_COCP7       -PPEC-RPK----AGKR--RRACKDCTCGLAE-RLRE-EDKAARAKADATLE--------
DRE2_PARBA       QPPEC-RPK----AGKR--RRACKDCTCGLSQ-KLEA-EDRAKRANADKALE--------
DRE2_PARBD       QPPEC-RPK----AGKR--RRACKDCTCGLSQ-KLEA-EDRAKRANADKALE--------
DRE2_AJEDR       QPPEC-RPK----PGKR--RRACKDCSCGLSQ-KLEA-EDKAKRATADKALETIMAP---
DRE2_BLAGS       QPPEC-RPK----PGKR--RRACKDCSCGLSQ-KLEA-EDKAKRATADKALETIMAP---
DRE2_AJECN       QPPEC-RPK----PGKR--RRACKDCSCGLSQ-KLEA-KDKAKRATADKALE--------
DRE2_AJECG       QPPEC-RPK----PGKR--RRACKDCSCGLSQ-KLEA-KDKAQRATADKALE--------
DRE2_AJECH       QPPEC-RPK----PGKR--RRACKDCSCGLSQ-KLEA-KDKAQRATADKALE--------
DRE2_PHANO       ---QC-RPK----AGKR--RRACKDCTCGLKE-KMEA-EDAAKRTTADKALN--------
DRE2_PYRTR       ---EC-QPK----PGKR--RRACKDCTCGMKE-KLEA-EDAAKRSSADKALN--------
DRE2_NECH7       IPVEC-QPK----AGKR--RRACKDCSCGLAE-RLVK-EDAEKRAEADKKLE--------
DRE2_BOTFB       IPPEC-APR----AGKR--RRACKDCTCGLAE-KLAK-EDADKRATADSQLQ--------
DRE2_SCLS1       IPPEC-APR----AGKR--RRACKDCTCGLAE-KLAK-EDAEKRATADSQLQ--------
DRE2_DICDI       --DDC-EVG------KT--KKACKNCTCGRAE--EEN-QSK-------------------
DRE2_OSTLU       KYDDC-DVG------AG--KKACKNCTCGRAE-AEAA-EEA-------------------
DRE2_OSTTA       KYDDC-DVG------AG--KKACKNCTCGRAE-AEAA-EES-------------------
DRE2_ARATH       VASGC-ETT----------KKACKNCVCGRAE-IEEK-AVK-------------------
DRE2_MAIZE       --GDC-EVG------AA--KKACKNCTCGRAE-AEEK-VGK-------------------
DRE21_ORYSI      --GDC-EVG------AT--RKACKNCTCGRAE-AEEK-VEK-------------------
DRE21_ORYSJ      --GDC-EVG------AT--RKACKNCTCGRAE-AEEK-VEK-------------------
DRE22_ORYSJ      --GDC-EVG------AT--RKACKNCTCGRAE-AEEK-VEK-------------------
DRE22_ORYSI      --GDC-EVG------AT--RKACKNCTCGRAE-AEEK-VEK-------------------
DRE2_SOYBN       -PGDC-EIG------ST--RKACKNCTCGRAE-EEEK-VLK-------------------
DRE2_MEDTR       ---DC-EIG------PT--RKACKNCSCGRAE-EEEK-VLK-------------------
DRE2_RICCO       GD--C-EVG------ST--RKACKNCTCGRAEAEEKV-----------------------
DRE2_POPTR       --GDC-EVG------ST--RKACKNCTCGRAE-EEEK-----------------------
DRE2_VITVI       VDGDC-EVG------ST--RKACKNCTCGRAE-EEEK-VEK-------------------
DRE22_PICSI      --DDC-EVG-------KAGRKACKNCTCGRVE-MEEK-QEK-------------------
DRE21_PICSI      --SDC-EVS------TK--RKACKNCTCGRAE-LEEK-QTK-------------------
                     *               . * .* **                               

DRE2_BABBO       ---------------------ESTVNADGP-T------------SSCGKCYLGDAFRCAN
DRE2_PLABA       ---------------------EVEYNTENV-V------------SSCGNCYLGDAFRCGS
DRE2_PLAYO       ---------------------EVEYSTENV-V------------SSCGNCYLGDAFRCGS
DRE21_PARTE      ---------------------LEQLKNNSI-K-------------GCGSCYLGDAFRCAN
DRE22_PARTE      ---------------------LEQLKNNSV-K-------------GCGSCYLGDAFRCAN
DRE2_CRYHO       ---------------------QEKVETGTA-R------------SSCGNCYLGDAFRCSG
DRE2_CRYPI       ---------------------QEKVETGTA-R------------SSCGNCYLGDAFRCSG
DRE2_PHYIT       ----------------------PVMSEKDL-N---------SLVSGCGNCFKGDAFRCGS
DRE2_MALGO       EVTTT----------------VKGPNGEEHTVRRIQVDTRGAT-SSCGSCFLGDAFRCSS
DRE2_USTMA       TPATTKRTEVIET--------IIGKDGKPKTIKRIQVDTKGAT-SSCGSCFLGDAFRCSS
DRE2_CRYNJ       IPEN-----------------LKKATEGMEGIWPADKRAEAKKTSSCGSCYLGDAFRCSS
DRE2_CRYNB       IPEN-----------------LKKATEGMEGIWPADKRAEAKKTSSCGSCYLGDAFRCSS
DRE2_COPC7       ---------------------AKAVDKAERERLLEAAKNAPKATSSCGSCFLGDAFRCAG
DRE2_LACBS       ------------------AKEVSQDEKERL---IIAAKAAPKATSSCGSCFLGDAFRCAG
DRE2_CAEBR       ---------------------GKIAEASAA-K------------SSCGNCALGDAFRCAT
DRE2_CAEEL       ----------------------MGQIAAEP-K------------SSCGNCSLGDAFRCST
DRE2_SCHJY       ---------------------AVKLTDTME-IDFTELLKSKNAVSSCGSCYLGDAFRCSG
DRE2_SCHPO       ---------------------AVKLTDTTE-VDFTEKLKSKNAVSSCGNCYLGDAFRCSG
DRE2_SCHJA       -------------------------SVVSI--------------SSCGNCYLGDAFRCST
DRE2_SCHMA       --------------------------SDVP-I------------SSCGNCYLGDAFRCST
DRE2_ACYPI       ---------------------TPKPDTSNA-K------------SSCGSCYLGDAFRCAS
DRE2_MONBE       ----------------------PTLTGPLP-A------------SSCGNCYLGDAFRCAS
DRE2_TRIAD       -------------------------TNGNP-V------------SSCGSCYLGDAFRCSS
DRE2_DROWI       ---------------------AKQASTENA-K------------SSCGNCYLGDAFRCSS
DRE2_DROGR       ---------------------TSSANTENA-K------------SSCGNCYLGDAFRCST
DRE2_DROVI       ----------------------TKTVTENA-K------------SSCGNCYLGDAFRCST
DRE2_DROMO       ----------------------TKAATENA-K------------SSCGNCYLGDAFRCST
DRE2_DROPE       ----------------------TATASENA-K------------SSCGNCYLGDAFRCST
DRE2_DROPS       ----------------------TATASENA-K------------SSCGNCYLGDAFRCST
DRE2_DROAN       ----------------------SKAATENA-K------------SSCGNCYLGDAFRCST
DRE2_DROME       ----------------------SQKATENA-K------------SSCGNCYLGDAFRCST
DRE2_DROSE       ----------------------SQKATENA-K------------SSCGNCYLGDAFRCST
DRE2_DROSI       ----------------------SQKATENA-K------------SSCGNCYLGDAFRCST
DRE2_DROYA       ----------------------SQKANETA-K------------SSCGNCYLGDAFRCST
DRE2_DROER       ----------------------SQKATENA-K------------SSCGNCYLGDAFRCST
DRE2_ANOGA       ---------------------KALTDTSAA-K------------SSCGSCYLGDAFRCAT
DRE2_AEDAE       ---------------------GSAVANSEP-K------------SSCGSCYLGDAFRCAT
DRE2_CULQU       ---------------------GAAVAAAQSAK------------SSCGSCYLGDAFRCAT
DRE2_IXOSC       -------------------------AKVQP-K------------SSCGNCYLGDAFRCAS
CPIN1_TETNG      ----------------------EKEKTNLP-K------------SACGSCYLGDAFRCAS
CPIN1_DANRE      ----------------------AAQKASQP-K------------SACGNCYLGDAFRCGS
CPN1B_SALSA      ----------------------GVQTISQP-K------------SACGSCYLGDAFRCAS
CPIN1_ONCMY      ----------------------GAKTISQP-K------------SACGSCYLGDAFRCAS
CPN1A_SALSA      ----------------------GAKTISQP-K------------SACGSCYLGDAFRCAS
CPIN1_XENLA      ---------------------PSTVPKAAP--------------SACGNCYLGDAFRCAS
CPIN1_XENTR      ---------------------PSTVPKAAP--------------SACGNCYLGDAFRCAS
CPIN1_CHICK      --------------------------SSQP-K------------SACGNCYLGDAFRCAS
CPIN1_HUMAN      ----------------------REQMSSQP-K------------SACGNCYLGDAFRCAS
CPIN1_BOVIN      ----------------------RDQISSQP-K------------SACGNCYLGDAFRCAS
CPIN1_MOUSE      -----------------------KAQSSQP-K------------SACGNCYLGDAFRCAN
CPIN1_RAT        -----------------------KAQSSQP-K------------SACGNCYLGDAFRCAN
DRE2_NEMVE       ------------------------TEKKSV-T------------SSCGSCYLGDAFRCST
DRE2_BRAFL       ----------------------GKTASKPA-T------------SACGNCYLGDAFRCAS
DRE2_ASHGO       ---------------------AVKFSEPEL-A-EIDFTIEGKKVGGCGSCSLGDAFRCSG
DRE2_ZYGRC       ---------------------VVKFSDQEL-T-EIDFTVQGKKVGGCGSCTLGDAFRCSG
DRE2_LACTC       ---------------------PVKFDEQEL-T-EIDFTIQGKKVGGCGSCSLGDAFRCSG
DRE2_CANGA       ---------------------VVKFTEDEL-T-EIDFTIDGKKVGGCGSCSLGDAFRCTG
DRE2_YEAST       ---------------------VVKFTEDEL-T-EIDFTIDGKKVGGCGSCSLGDAFRCSG
DRE2_YEAS2       ---------------------VVKFTEDEL-T-EIDFTIDGKKVGGCGSCSLGDAFRCSG
DRE2_YEAS8       ---------------------VVKFTEDEL-T-EIDFTIDGKKVGGCGSCSLGDAFRCSG
DRE2_YEAS1       ---------------------VVKFTEDEL-T-EIDFTIDGKKVGGCGSCSLGDAFRCSG
DRE2_YEAS7       ---------------------VVKFTEDEL-T-EIDFTIDGKKVGGCGSCSLGDAFRCSG
DRE2_YARLI       ---------------------TVTLSAEDT-A-EIDFTVQGKT-GGCGSCALGDAFRCDG
DRE2_KOMPG       AEAEKIEERLRRKQASKEGE-EVKFTEQEV-T-EIDFTIQGKT-GGCGSCALGDAFRCDG
DRE2_DEBHA       LEAMKIEEKMKN---------AVKFDDNDL-A-EIDFTVEGKK-GGCSSCSLGDAFRCDG
DRE2_CLAL4       LEAIKIEERLKKS--------QVQFSAQDL-T-EIDFTVEGKT-GGCSSCALGDAFRCDG
DRE2_CANTT       IEAIKIEERMKKN--------KIKFTEEDL-S-EIDFTVAGKT-GGCGSCSLGDAFRCDG
DRE2_CANAL       LEAIKIEERLKQQQQQQQQKVKVKFTEEDL-S-EIDFTVQGKT-GGCGSCALGDAFRCDG
DRE2_CANDC       LEAIKIEERLKQQSQK-----KIKFTEEDL-S-EIDFTVQGKT-GGCGSCALGDAFRCDG
DRE2_BRUMA       ---------------------VAQLKPGKS-S--------------CGNCGLGDAFRCSA
DRE2_ARTOC       ---------------------ALKLNSGEI-A-EVDFTIQGKT-GSCGNCSLGDAFRCDG
DRE2_ASPCL       ---------------------AMKLSHGDL-A-EVDFTVQGKV-GSCGNCSLGDAFRCEG
DRE2_ASPFC       ---------------------AMRLLHDDL-A-EVDFTVQGKV-GSCGNCSLGDAFRCEG
DRE2_NEOFI       ---------------------AMKLLHDDL-A-EVDFTVRGKV-GSCGNCSLGDAFRCEG
DRE2_MAGO7       ---------------------PFKLASEDL-N-ELDFTVQGKT-GSCGSCALGDAFRCAD
DRE2_PODAN       ---------------------TLKLKSEDL-S-ELDFTVQGKT-GSCNSCYLGDAFRCAD
DRE2_NEUCR       ---------------------TLKLKSEDL-L-ELDLTVPGKT-GSCGSCALGDAFRCAG
DRE2_CHAGB       ---------------------TLKLKSEDL-N-ELDFTVQGKT-GSCGSCYLGDAFRCSD
DRE2_TALMQ       ---------------------VLKLKTDEL-NDEVDFTVQGKT-GSCNSCSLGDAFRCEG
DRE2_TALSN       ---------------------VLKLKTDEL-NDEVDFTVQGKT-GSCNSCSLGDAFRCAS
DRE2_ASPTN       ---------------------VLKLQSTDL-SDEVDFTVQGKT-SSCNSCSLGDAFRCSS
DRE2_ASPFN       ---------------------ILKLNTDDL-NDELDFTVQGKT-SSCNSCSLGDAFRCSS
DRE2_ASPOR       ---------------------ILKLNTDDL-NDELDFTVQGKT-SSCNSCSLGDAFRCSS
DRE2_PENRW       ---------------------VMKLDTGDL-N-ELDFTVEGKT-GSCGSCALGDAFRCDG
DRE2_ASPNC       ---------------------VMKLETEDL-N-ELDFTVQGKT-GSCGNCALGDAFRCAG
DRE2_EMENI       ---------------------VMKLESDDL-N-ELDFTVQGKT-GSCGNCALGDAFRCDG
DRE2_COCIM       ---------------------TMKLAPKEL-A-EVDFTVQGKL-GSCGNCALGDAFRCDG
DRE2_COCP7       ---------------------TMKLAPKEL-A-EVDFTVQGKL-GSCGNCALGDAFRCDG
DRE2_PARBA       ---------------------TLKLGTNDL-A-EVDFTVQGKV-GSCGNCALGDAFRCDG
DRE2_PARBD       ---------------------TLKLRTNDL-A-EVDFTVQGKV-GSCGNCALGDAFRCDG
DRE2_AJEDR       ---------------------TMKLGSSEL-A-EVDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_BLAGS       ---------------------TMKLGSSEL-A-EVDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_AJECN       ---------------------TMKLGSSEL-A-EVDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_AJECG       ---------------------TMKLGSSEL-A-EVDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_AJECH       ---------------------TMKLGSSEL-A-EVDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_PHANO       ---------------------TMKLGADDL-D-ELDFTVQGKV-GSCGNCALGDAFRCDG
DRE2_PYRTR       ---------------------SLKLDADDL-A-EVDFTVQGKV-GSCGNCALGDAFRCDG
DRE2_NECH7       ---------------------SVKLATDDL-A-EIDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_BOTFB       ---------------------ALKLDADDL-A-EVDFTVQGKV-GSCGNCSLGDAFRCDG
DRE2_SCLS1       ---------------------ALKLDADDL-A-EVDFTVKGKV-GSCGNCSLGDAFRCDG
DRE2_DICDI       ----------------------PKLTKEMI-E-------NPGVGSSCGNCSLGDAFRCGG
DRE2_OSTLU       ---------------------TTAASEETF-V------------SACGNCALGDAFRCAG
DRE2_OSTTA       ----------------------ANAKSEETFV------------SACGNCALGDAFRCAG
DRE2_ARATH       ----------------------LGLTEDQI-E---------NPQSSCGSCGLGDAFRCGT
DRE2_MAIZE       ----------------------LELTAEQI-N---------NPQSACGSCGLGDAFRCGT
DRE21_ORYSI      ----------------------LNLTSEQI-N---------NPQSACGNCGLGDAFRCGT
DRE21_ORYSJ      ----------------------LNLTSEQI-N---------NPQSACGNCGLGDAFRCGT
DRE22_ORYSJ      ----------------------LNLTSEQI-N---------NPQSACGNCGLGDAFRCGT
DRE22_ORYSI      ----------------------LNLTSEQI-N---------NPQSACGNCGLGDAFRCGT
DRE2_SOYBN       ----------------------LGLTTEQI-D---------NPQSACGNCGLGDAFRCST
DRE2_MEDTR       ----------------------LGLTAEQI-N---------NPQSACGSCGLGDAFRCST
DRE2_RICCO       ---------------------KLGPTMEQL-N---------NPQSACGSCGLGDAFRCST
DRE2_POPTR       --------------------VKLGPTMDQL-S---------NPQSACGSCGLGDAFRCGT
DRE2_VITVI       ----------------------LGLTMDQL-N---------NPQSACGSCGLGDAFRCGT
DRE22_PICSI      ----------------------LGLPSDLL-D---------NPQSSCGSCGLGDAFRCST
DRE21_PICSI      ----------------------LGLTVEQL-N---------NPQSACGNCGLGDAFRCSS
                                                               *..*  ******  

DRE2_BABBO       CPYR-G---MPAFA----PG-DKIRLE---------------------------------
DRE2_PLABA       CPYKAG---LPAFQ----PG-ENVKLNLNVC-----------------------------
DRE2_PLAYO       CPYK-G---LPAFQ----PG-ENVKLNLNVC-----------------------------
DRE21_PARTE      CPYR-G---LPAFK----DG-EQVKVLQDDVFLQEQEEKDQVKLENGKVKLKI-------
DRE22_PARTE      CPFR-G---LPAFK----DG-EQVKVLQDDVFLKEKEETDQIKLENGKVKLMI-------
DRE2_CRYHO       CPYK-G---MPAFK----PG-EKVSLANAEGDANDRTVDMNLIHEEKVDLITTTFDDDGS
DRE2_CRYPI       CPYK-G---MPAFK----PG-EKVSLANAEGDANDHTVDMNLIHEEKVDLITTTFDDDGS
DRE2_PHYIT       CPFL-G---KPAFK----PGMEKVLLNLDS-----SDDI---------------------
DRE2_MALGO       CPYL-G---LPAFE----PG-QKVEIPANM-----DDDL---------------------
DRE2_USTMA       CPYL-G---LPAFE----PG-QKVEIPVGM------DDDI--------------------
DRE2_CRYNJ       CPYL-G---LPPFK----PG-EQVQVSIGD-------DI---------------------
DRE2_CRYNB       CPYL-G---LPPFK----PG-EQVQVSIGD-------DI---------------------
DRE2_COPC7       CPYL-G---LPAFK----PG-EKVEIDFGM------DDF---------------------
DRE2_LACBS       CPYL-G---LPAFK----PG-EKVEIDFGM------DDF---------------------
DRE2_CAEBR       CPYL-G---QPPFK----PG-ETVKLSSVD-------DF---------------------
DRE2_CAEEL       CPYL-G---QPPFK----PG-ETVKIS-TV------DDF---------------------
DRE2_SCHJY       CPYI-G---LPAFK----PG-EQVLISENRDKLSWMADDL--------------------
DRE2_SCHPO       CPYI-G---MPAFN----PG-DTVILAENRDKMSWMADDI--------------------
DRE2_SCHJA       CPYR-G---LPPFK----PG-DRILIPDDV-----LKADL--------------------
DRE2_SCHMA       CPYR-G---LPPFK----PG-ERILIPDDV-----LRADL--------------------
DRE2_ACYPI       CPYL-G---MPAFR----PG-EKVQLAGNL-----LQDDF--------------------
DRE2_MONBE       CPYL-G---MPAFK----PG-EKVTLSDRQ-----LKADA--------------------
DRE2_TRIAD       CPYL-G---MPAFK----PG-EKVALPSRL-----LQADV--------------------
DRE2_DROWI       CPYL-G---MPAFK----PG-EKVQLVDNL-----LKSDI--------------------
DRE2_DROGR       CPYL-G---MPAFK----PG-EKVQLANNL-----LKSDI--------------------
DRE2_DROVI       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROMO       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROPE       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROPS       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROAN       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROME       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROSE       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROSI       CPYL-G---MPAFK----PG-EKVQLADNL-----LKSDI--------------------
DRE2_DROYA       CPYL-G---MPAFK----PG-EKVQLGDNL-----LKSDI--------------------
DRE2_DROER       CPYL-G---MPAFK----PG-EKVQLGDNL-----LKSDI--------------------
DRE2_ANOGA       CPYL-G---MPAFK----PG-EKIVLTDTQ-----MQADI--------------------
DRE2_AEDAE       CPYL-G---MPAFK----PG-EKIQLTDTQ-----MRADI--------------------
DRE2_CULQU       CPYL-G---MPAFK----PG-EKIQLSDTQ-----MQADV--------------------
DRE2_IXOSC       CPYK-G---LPAFK----PG-EKIVLSEDQ-----LAADS--------------------
CPIN1_TETNG      CPYL-G---MPAFK----PG-EKILLDNKT-----LTDA---------------------
CPIN1_DANRE      CPYL-G---MPAFK----PG-EKVLLANTD-----IADK---------------------
CPN1B_SALSA      CPYL-G---MPAFK----PG-EKVVLANTG-----LNDA---------------------
CPIN1_ONCMY      CPYI-G---MPAFK----PG-EKIVLANTG-----LNDA---------------------
CPN1A_SALSA      CPYI-G---MPAFK----PG-EKIVLANTG-----LNDT---------------------
CPIN1_XENLA      CPYL-G---MPAFK----PG-EKVLLNPTK-----LQDA---------------------
CPIN1_XENTR      CPYL-G---MPAFK----PG-EKVLLNPTQ-----LQDA---------------------
CPIN1_CHICK      CPYL-GDACLQAWR--EDPA-EREPAA---------------------------------
CPIN1_HUMAN      CPYL-G---MPAFK----PG-EKVLLSDSN-----LHDA---------------------
CPIN1_BOVIN      CPYL-G---MPAFK----PG-EKVLLSDSN-----LHDA---------------------
CPIN1_MOUSE      CPYL-G---MPAFK----PG-EQVLLSNSN-----LQDA---------------------
CPIN1_RAT        CPYL-G---MPAFK----PG-EQVLLSSSN-----LQDA---------------------
DRE2_NEMVE       CPYL-G---MPAFK----PG-EKIALTDRQ-----LKGDL--------------------
DRE2_BRAFL       CPYL-G---MPAFK----PG-EKITLTDRQ-----LKGDI--------------------
DRE2_ASHGO       CPYL-G---LPAFK----PG-QPINLSAIS------DDL---------------------
DRE2_ZYGRC       CPYL-G---LPAFK----PG-QQIDLSSMG------DDL---------------------
DRE2_LACTC       CPYL-G---LPAFK----PG-QPISLDTIA------DDL---------------------
DRE2_CANGA       CPYL-G---LPAFK----PG-EPINLDSIT------DDL---------------------
DRE2_YEAST       CPYL-G---LPAFK----PG-QPINLDSIS------DDL---------------------
DRE2_YEAS2       CPYL-G---LPAFK----PG-QPINLDSIS------DDL---------------------
DRE2_YEAS8       CPYL-G---LPAFK----PG-QPINLDSIS------DDL---------------------
DRE2_YEAS1       CPYL-G---LPAFK----PG-QPINLDSIS------DDL---------------------
DRE2_YEAS7       CPYL-G---LPAFK----PG-QPINLDSIS------DDL---------------------
DRE2_YARLI       CPYL-G---LPPFK----PG-EAVSIGGAS-------DL---------------------
DRE2_KOMPG       CPYL-G---LPPFK----PG-QAISIEGLG------ADI---------------------
DRE2_DEBHA       CPYL-G---LPPFK----PG-EVVSIDNFG------EDI---------------------
DRE2_CLAL4       CPYL-G---LPPFK----PG-EVVTLDSFG------EDI---------------------
DRE2_CANTT       CPFL-G---LPPFK----PG-EVVRID---------------------------------
DRE2_CANAL       CPYL-G---LPPFK----PG-EVVKLDGFG------EDI---------------------
DRE2_CANDC       CPYL-G---LPPFK----PG-EVVKLDGFG------EDI---------------------
DRE2_BRUMA       CPYW-G---LPPFK----PG-EEGRIKLET-----VNDL---------------------
DRE2_ARTOC       CPYI-G---LPPFK----PG-EEVKLFDND------VQL---------------------
DRE2_ASPCL       CPFI-G---LPAFQ----PG-EEIRLLNDD------IQL---------------------
DRE2_ASPFC       CPFI-G---LPAFQ----PG-EEVRLLNND------VQL---------------------
DRE2_NEOFI       CPFI-G---LPAFQ----PG-EEVRLLNND------VQL---------------------
DRE2_MAGO7       CPYI-G---LPAFK----PG-EEVTILNNV------AQL---------------------
DRE2_PODAN       CPYI-G---LPAFK----PG-EQVKILNNT------AQI---------------------
DRE2_NEUCR       CPYL-G---LPPFK----VG-EEVSILNNV------PQL---------------------
DRE2_CHAGB       CPYI-G---LPAFK----PG-EEVKIVNNA------IQL---------------------
DRE2_TALMQ       CPFI-G---LPAFK----PG-EEVRIMNDM------AQL---------------------
DRE2_TALSN       CPFI-G---LPAFK----PG-EEVRIMNDM------AQL---------------------
DRE2_ASPTN       CPYI-G---LPPFK----PG-EEVKILNNM------VQL---------------------
DRE2_ASPFN       CPYI-G---LPPFK----PG-EEVKIMNDM------VQL---------------------
DRE2_ASPOR       CPYI-G---LPPFK----PG-EEVKIMNDM------VQL---------------------
DRE2_PENRW       CPYM-G---LPAFK----PG-QEVQILNDV------AQL---------------------
DRE2_ASPNC       CPFI-G---LPAFK----PG-QEVQILENV------AQL---------------------
DRE2_EMENI       CPFI-G---LPAFK----PG-QEVQILNDV------AQL---------------------
DRE2_COCIM       CPYI-G---LPPFK----PG-EEVRLLSND------VQL---------------------
DRE2_COCP7       CPYI-G---LPPFK----PG-EEVRLLSND------VQL---------------------
DRE2_PARBA       CPYI-G---LPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_PARBD       CPYI-G---LPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_AJEDR       CPYI-G---LPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_BLAGS       CPYI-G---LPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_AJECN       CPYI-G---LPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_AJECG       CPYI-G---LPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_AJECH       CPYI-G---LPAFK----QG-EEVRLLNND------VQL---------------------
DRE2_PHANO       CPYI-G---LPAFK----PG-EEVRLLNND------IQL---------------------
DRE2_PYRTR       CPYI-G---LPAFK----PG-EEVRLLNND------IQL---------------------
DRE2_NECH7       CPYI-G---LPPFK----PG-EEVRLLNND------VQL---------------------
DRE2_BOTFB       CPYI-G---MPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_SCLS1       CPYI-G---MPAFK----PG-EEVRLLNND------VQL---------------------
DRE2_DICDI       CPYR-G---LPTFK----VG-EKIQLPDDF-----LVDDI--------------------
DRE2_OSTLU       CPYL-G---QPAFK--DQPG-TKVELDLGD-------DL---------------------
DRE2_OSTTA       CPYL-G---QPAFKDTDAVG-TKVELDLGD-------DL---------------------
DRE2_ARATH       CPYK-G---LPPFK----LG-EKVTLSQNF-----LEADI--------------------
DRE2_MAIZE       CPYR-G---LPPFK----PG-EKVSLSGNF-----LAADI--------------------
DRE21_ORYSI      CPYR-G---LPAFK----PG-EKIALPGNF-----LAADM--------------------
DRE21_ORYSJ      CPYR-G---LPAFK----PG-EKIALPGNF-----LAADM--------------------
DRE22_ORYSJ      CPYR-G---LPAFK----PG-EKIALPGNF-----LAADL--------------------
DRE22_ORYSI      CPYR-G---LPAFK----PG-EKIALPGNF-----LAADL--------------------
DRE2_SOYBN       CPYK-G---LPAFK----LG-EKVALSGNF-----LAADI--------------------
DRE2_MEDTR       CPYK-G---LPAFK----MG-EKVALSGNF-----LAADI--------------------
DRE2_RICCO       CPYK-G---LPPFK----LG-EKVSLSGNF-----LAADI--------------------
DRE2_POPTR       CPYK-G---LPPFK----LG-EKVSLSENF-----LVADI--------------------
DRE2_VITVI       CPYK-G---LPPFK----LG-DKVSLSGNF-----LVADI--------------------
DRE22_PICSI      CPYK-G---LPPFK----LG-EKISLSQSF-----LTADI--------------------
DRE21_PICSI      CPYK-G---LSPFK----LG-EKVSLPGTL-----LTADM--------------------
                 **:  *     .:      .                                        

DRE2_BABBO       ----------------
DRE2_PLABA       ----------------
DRE2_PLAYO       ----------------
DRE21_PARTE      ----------------
DRE22_PARTE      ----------------
DRE2_CRYHO       GVSNVQSKGGVLKLNI
DRE2_CRYPI       GVNNVQSKGGVLKLNI
DRE2_PHYIT       ----------------
DRE2_MALGO       ----------------
DRE2_USTMA       ----------------
DRE2_CRYNJ       ----------------
DRE2_CRYNB       ----------------
DRE2_COPC7       ----------------
DRE2_LACBS       ----------------
DRE2_CAEBR       ----------------
DRE2_CAEEL       ----------------
DRE2_SCHJY       ----------------
DRE2_SCHPO       ----------------
DRE2_SCHJA       ----------------
DRE2_SCHMA       ----------------
DRE2_ACYPI       ----------------
DRE2_MONBE       ----------------
DRE2_TRIAD       ----------------
DRE2_DROWI       ----------------
DRE2_DROGR       ----------------
DRE2_DROVI       ----------------
DRE2_DROMO       ----------------
DRE2_DROPE       ----------------
DRE2_DROPS       ----------------
DRE2_DROAN       ----------------
DRE2_DROME       ----------------
DRE2_DROSE       ----------------
DRE2_DROSI       ----------------
DRE2_DROYA       ----------------
DRE2_DROER       ----------------
DRE2_ANOGA       ----------------
DRE2_AEDAE       ----------------
DRE2_CULQU       ----------------
DRE2_IXOSC       ----------------
CPIN1_TETNG      ----------------
CPIN1_DANRE      ----------------
CPN1B_SALSA      ----------------
CPIN1_ONCMY      ----------------
CPN1A_SALSA      ----------------
CPIN1_XENLA      ----------------
CPIN1_XENTR      ----------------
CPIN1_CHICK      ----------------
CPIN1_HUMAN      ----------------
CPIN1_BOVIN      ----------------
CPIN1_MOUSE      ----------------
CPIN1_RAT        ----------------
DRE2_NEMVE       ----------------
DRE2_BRAFL       ----------------
DRE2_ASHGO       ----------------
DRE2_ZYGRC       ----------------
DRE2_LACTC       ----------------
DRE2_CANGA       ----------------
DRE2_YEAST       ----------------
DRE2_YEAS2       ----------------
DRE2_YEAS8       ----------------
DRE2_YEAS1       ----------------
DRE2_YEAS7       ----------------
DRE2_YARLI       ----------------
DRE2_KOMPG       ----------------
DRE2_DEBHA       ----------------
DRE2_CLAL4       ----------------
DRE2_CANTT       ----------------
DRE2_CANAL       ----------------
DRE2_CANDC       ----------------
DRE2_BRUMA       ----------------
DRE2_ARTOC       ----------------
DRE2_ASPCL       ----------------
DRE2_ASPFC       ----------------
DRE2_NEOFI       ----------------
DRE2_MAGO7       ----------------
DRE2_PODAN       ----------------
DRE2_NEUCR       ----------------
DRE2_CHAGB       ----------------
DRE2_TALMQ       ----------------
DRE2_TALSN       ----------------
DRE2_ASPTN       ----------------
DRE2_ASPFN       ----------------
DRE2_ASPOR       ----------------
DRE2_PENRW       ----------------
DRE2_ASPNC       ----------------
DRE2_EMENI       ----------------
DRE2_COCIM       ----------------
DRE2_COCP7       ----------------
DRE2_PARBA       ----------------
DRE2_PARBD       ----------------
DRE2_AJEDR       ----------------
DRE2_BLAGS       ----------------
DRE2_AJECN       ----------------
DRE2_AJECG       ----------------
DRE2_AJECH       ----------------
DRE2_PHANO       ----------------
DRE2_PYRTR       ----------------
DRE2_NECH7       ----------------
DRE2_BOTFB       ----------------
DRE2_SCLS1       ----------------
DRE2_DICDI       ----------------
DRE2_OSTLU       ----------------
DRE2_OSTTA       ----------------
DRE2_ARATH       ----------------
DRE2_MAIZE       ----------------
DRE21_ORYSI      ----------------
DRE21_ORYSJ      ----------------
DRE22_ORYSJ      ----------------
DRE22_ORYSI      ----------------
DRE2_SOYBN       ----------------
DRE2_MEDTR       ----------------
DRE2_RICCO       ----------------
DRE2_POPTR       ----------------
DRE2_VITVI       ----------------
DRE22_PICSI      ----------------
DRE21_PICSI      ----------------