CLUSTAL format seed alignment for MF_03117

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ENOPH_DROER       --------------------------MTSSERMAKVVLVDIEGTTTSISFVHDILFPYAK
ENOPH_DROYA       --------------------------MTSSERVAKVVLVDIEGTTTSISFVHEVLFPYAK
ENOPH_DROSE       --------------------------MSSGERVAKVVLVDIEGTTTSISFVHDVLFPYAK
ENOPH_DROSI       --------------------------MSSGERVAKVVLVDIEGTTTSISFVHDVLFPYAK
ENOPH_DROME       --------------------------MSSSERVAKVVLVDIEGTTTSISFVHDVLFPYAK
ENOPH_DROAN       --------------------------MTAEKREAKVVLVDIEGTTTSISFVHQVLFPHAK
ENOPH_DROPE       --------------------------MPSTERVAKVVLVDIEGTTTSISFVHDVLFPYAK
ENOPH_DROPS       --------------------------MPTTERVAKVVLVDIEGTTTSISFVHDVLFPYAK
ENOPH_DROWI       --------------------------MLGNE--IKVILLDIEGTTTSIGFVHHILFPYAK
ENOPH_DROMO       --------------------------MALTDLSAKVVLVDIEGTTTSITFVHDVLFPYAK
ENOPH_DROVI       --------------------------MTIPDLTAKVVLVDIEGTTTSISFVHEVLFPYAK
ENOPH_DROGR       --------------------------MAQAESSTEVVLVDIEGTTTSISFVHDVLFPYAK
ENOPH_MONBE       ------------------MANSTDETATTTLAPAPCFLFDIEGTTTSISFVHEVLFPYAR
ENOPH_HUMAN       ------------------------MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIE
ENOPH_BOVIN       ------------------------MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYVK
ENOPH_MOUSE       ------------------------MVVVSVPAEVTVILLDIEGTTTPIAFVKDVLFPYIK
ENOPH_RAT         ------------------------MVVVSVPAEVTVILLDIEGTTTPIAFVKDILFPYIK
ENOPH_XENLA       ------------------------MALFSVPTPVTTILLDIEGTTTPITFVKDVLFPYIK
ENOPH_XENTR       ------------------------MALFSVPPPVTVILLDIEGTTTPITFVKDVLFPYVK
ENOPH_DANRE       ------------------------MAAIAIPENTRVFLLDIEGTTTPITFVKDILFPYIR
ENOPH_SALSA       ------------------------MATVSIPANTTALLLDIEGTTTPITFVKDILFPYIK
ENOPH_BRAFL       MSDSRLRRRQGTAGTDNKRRADGPHDISGLLDGVSVVLLDIEGTTTPITFVKDELFPYVC
ENOPH_DICDI       -----------------------------MTPNIHTVILDIEGTTTPISFVHDVLFPYIR
ENOPH_NAEGR       ----------------------MSAVKRISVSKYKTFMFDIEGTTTPIVFVAENLFPYIR
I1CJ93_RHIO9      ------------------------------MSNYDTVVVDIEGTITPITFVKETLFPYVV
ENOPH_ACYPI       -----------------------------MPVNENVILLDIEGTITSISFVKDTLFPYVT
ENOPH_CAEBR       -------------------------MTNTTTIQFNALLLDIEGTITSISFVKDELFPYAF
ENOPH_CAEEL       --------------------------MTTTTIQFNALLLDIEGTITSISFVKDELFPYAF
ENOPH_SCHJY       -----------------------------MPTPIRTILLDIEGTVGSISFVKNVLFPLAK
ENOPH_SCHPO       --------------------------------MVKNLLLDIEGTVGSISFVKDKLFPYAA
ENOPH_ASHGO       ---------------------------MEED--YGVFILDVEGTVCPIAFVREQLFPYFL
ENOPH_CANGA       ---------------------------MSPDPKYSAYLLDIEGTLCPLSFVKDTLYPFFV
ENOPH_KLULA       -------------------------------MSQLKYILDIEGTVCPISFVKDTLYPFFL
ENOPH_ZYGRC       -------------------------------MSVSVYLLDIEGTVCPISFVKETLFPYFS
ENOPH_YEAST       -----------------------------MGDNYSTYLLDIEGTVCPISFVKETLFPYFT
ENOPH_YEAS7       -----------------------------MGDNYSTYLLDIEGTVCPISFVKETLFPYFT
ENOPH_YEAS6       -----------------------------MGDNYSTYLLDIEGTVCPISFVKETLFPYFT
ENOPH_YEAS1       -----------------------------MGDNYSTYLLDIEGTVCPISFVKETLFPYFT
ENOPH_YEAS2       -----------------------------MGDNYSTYLLDIEGTVCPISFVKETLSPYFT
ENOPH_LACTC       -------------------------------MAYAAVLLDIEGTVCPISFVKESLFPFFL
ENOPH_VANPO       ----------------------------MVQESFDCYLLDIEGTICPISFVKETLFPFFL
ENOPH_CANAL       ----------------------MTTTAKTDDIPIDTVILDIEGTVCPITFVKDTLFPYFI
ENOPH_CANAW       ----------------------MTTTAKTDDIPIDTVILDIEGTVCPITFVKDTLFPYFI
ENOPH_CANDC       ------------------------MASTTNNTPIDTVILDIEGTVCPITFVKDTLFPYFI
ENOPH_CANTT       -------------------------------MTIDTVILDIEGTVCPITFVKDTLFPYFL
ENOPH_PICST       -------------------------------MAIDTVVLDIEGTVCPITFVKEKLFPYFL
ENOPH_DEBHA       -------------------------MPISFAAPIEVIVLDIEGTVCPISFVKTTLFPYFL
ENOPH_LODEL       -------------------------------MTIDTVILDIEGTICPISFVKSVLFPYFV
ENOPH_CLAL4       ---------------------------------MSIALLDIEGTVCPITFVKDCLFPYFS
ENOPH_PICGU       ------------------------MKTECRELFAMTVILDIEGTVCPITFVKDTLFPYFL
ENOPH_KOMPG       ------------------------------MAVYDTIILDIEGTVCSISFVKNVLFPYFL
ENOPH_BOTFB       ------------------MEGKPRV---------KVVLLDIEGTVCPISFVKDILFPYAL
ENOPH_SCLS1       ------------------MEAKPRV---------KVVLLDIEGTVCPISFVKDVLFPYAL
ENOPH_CHAGB       ------------------MAAAKKP---------RVVLLDIEGTVCPISFVKDVLFPYAL
ENOPH_MAGO7       ------------------MASAVK-----------VFLLDIEGTVCPISFVKDVLFPYAL
ENOPH_NEUCR       ------------------MAPI------------RVVLLDIEGTVCPISFVKDVLFPYAL
ENOPH_SORMK       ------------------MAPV------------KVVLLDIEGTVCPISFVKDVLFPYAL
ENOPH_PODAN       ------------------MASSGQP---------KVVLLDIEGTVCPISFVKDVLFPYAL
ENOPH_VERA1       ------------------MASATATTSAADLAAVKVVLLDIEGTVCPISFVKDVLFPYAL
I1RFL2_GIBZE      ------------------MTLNLND--------FDVLVFDIEGTVCPISFVKDVLFPYAL
ENOPH_NECH7       ------------------MTLNLAE--------YDVLVFDIEGTVCPISFVKDVLFPYAL
ENOPH_YARLI       ----------------------------------MATLLDIEGTVCSISFVHDILFPYAL
                                                       :.*:***  .: **   * *   

ENOPH_DROER       QNVEKFLRNSWEED-DIQHIV---------QDLQQVPQFADYKALLS-APPAEVDF----
ENOPH_DROYA       QNVEKFLRDSWKVD-DIQRIV---------QDMQQLPQFEEYKVLLR-APPAEVDV----
ENOPH_DROSE       QNVEKFLRDFWKED-DIKHIV---------QDLQQVPKFADYKALLS-APPTEVDI----
ENOPH_DROSI       QNVEKFLRDFWKED-DIKHIV---------QDLKQVPKFADYKALLS-APPTEVDV----
ENOPH_DROME       QNVEKFLRDSWEED-DIKRIV---------QDLQQVPQYADYKALLS-GPPTEVDV----
ENOPH_DROAN       ENVEKYLKEYWENE-ETKQIV---------EDLQQVPQYADYQATLS-APPAVVDV----
ENOPH_DROPE       NNVQKFLEESWESSSEVKQIV---------RELQQVPQYAEYTATLR-VPPKEVDV----
ENOPH_DROPS       NNVKKFLEESWESSSEVKQIV---------RELQQVPQYAEYTATLR-VPPKEVDV----
ENOPH_DROWI       QNVEEYLKKEWDSD-EIKQIV---------QDLQQVPSFEVYKATLVDSSASSITV----
ENOPH_DROMO       ANAGQYLSETWETD-DTKQIV---------EELTQLPQYTEYASTLE--TRPEINA----
ENOPH_DROVI       QNAEHYLLETWETD-ATKQIV---------QDLQLLPQFAEYASTLG--TQPAVDA----
ENOPH_DROGR       ENAKDYLLETWQTD-ETKLIV---------KELQQLPHYTEYAANLA--TQPTLDA----
ENOPH_MONBE       NQVEAFLAAHWDTD-AVKADV---------DKLREQVSGCGKRSVADEAGPKEHGA----
ENOPH_HUMAN       ENVKEYLQTHWEEE-ECQQDV---------SLLRKQAEEDAHLDGAVPIPAASGNG--VD
ENOPH_BOVIN       ENVEEYLQAHWEEE-ECQQDV---------RLLRKQAEEDSHLDGAVPIPAASGNG--AD
ENOPH_MOUSE       ENVKEYLQTHWEEE-ECQQDV---------SLLRKQAEEDAHLDGAVPIPVASGS-----
ENOPH_RAT         ENVKEYLQTHWEEE-ECQQDV---------SLLRKQAEEDAHLDGAVPIPVASGG-----
ENOPH_XENLA       ENIKKYLLEHWQEK-ECQEDI---------TQLQKQAEKDSHIDGFVPIPSAISD----N
ENOPH_XENTR       ENIKKYLLEHWQEK-ECQEDV---------TQLQKQAEKDSHLDGFVPIPSGVSD----N
ENOPH_DANRE       ENLEDYLSAHWEED-ECKQDV---------HLLKKQTEEDLRQNKACHVHTVDQTV--HT
ENOPH_SALSA       DHLEEHLSAHWEED-ECKQDV---------HLLKKQVEEDLRLNRACAQHALDQSG--HT
ENOPH_BRAFL       SHVRQHLEEHWKEE-ECQEDI---------AALRKQAKEDKEMDGVVLIPECTTKDDDEE
ENOPH_DICDI       DNLVRHINQKWGSE-ELKQDIKELYK----LYLEDNKASELVVNNQFNTPEILNPDDEST
ENOPH_NAEGR       KSLKTHIEETWESE-ETKKDV---------LSLKEQAEQDANSQSDFKDAPQINIDSQ--
I1CJ93_RHIO9      SGCKAFLDRTWDLP-ELKSYI---------ELLREQAEKDV--KDNLPEAVLIPTESEGS
ENOPH_ACYPI       KVLEDYIEKYWDDE-SFQQDL---------ELLRAQAVIDSNVEGFVPISTGDNAK----
ENOPH_CAEBR       ENVGKYLEEHYDKP-ATQIII---------EDLRRLAEQQLETDADVVKIRERKQE----
ENOPH_CAEEL       ENVGNYLEEHYDNP-ATQIIV---------EDLRHIADQQAENDVAVVRIREPRKE----
ENOPH_SCHJY       QQYAEYVHKHMD-DASVRVFG------------NSLDEIVDKLNTLH-------------
ENOPH_SCHPO       SRYESYVNENYESDENLRELG------------KTPEEALINLRKLH-------------
ENOPH_ASHGO       DKVEELI---------NNADET----------ERDLLADMQSRHGGA-------------
ENOPH_CANGA       LHVQRIVYENFN--EEHPKDEF----------IAEQLAKYDIKEEGQ-------------
ENOPH_KLULA       KQVESLV-------KTN--DPT----------LQNLLAQFPVPQ----------------
ENOPH_ZYGRC       AKLPSLV-------KSD--DVS----------IKSVLAQFPQHG----------------
ENOPH_YEAST       NKVPQLV-------QQDTRDSP----------VSNILSQFHID-----------------
ENOPH_YEAS7       NKVPQLV-------QQDTRDSP----------VSNILSQFHID-----------------
ENOPH_YEAS6       KKVPQLV-------QQDTRDSP----------VSNILSQFHID-----------------
ENOPH_YEAS1       KKVPQLV-------QQDTRDSP----------VSNILSQFHID-----------------
ENOPH_YEAS2       KKVPQLV-------QQDTRDSP----------VSNILSQFHID-----------------
ENOPH_LACTC       KQVDTLC-------SSQ--DLQ----------VQRLLTQFQVD-----------------
ENOPH_VANPO       QNLSKII-------EHP--TDD----------QLTILSKFNIN-----------------
ENOPH_CANAL       EKLPSILDKFQY--PLSNTSASS------DDQVLNILKQLPDNIT---------------
ENOPH_CANAW       EKLPSILDKFQY--PLSNTSASS------DDQVLNILKQLPDNIT---------------
ENOPH_CANDC       EKLPSILQKFQY--PLPTTTTSDNDDDDDDDPVLNILKQLPENII---------------
ENOPH_CANTT       TKLPSILSSIEF--PLSTSSSTN------DDPIIQILKQLPESIT---------------
ENOPH_PICST       EKLPSFLSEISN--FTSLQADDK-------DPIKAILSQLPEQIR---------------
ENOPH_DEBHA       EKLPSELSALTY--PLKSTSNSP---------VEEICSQFPENVR---------------
ENOPH_LODEL       KQLPTTLNTIQF--PLNLNINDTNS---NQASIVQTLSKLPLSVT---------------
ENOPH_CLAL4       KQYPSYLRDVSF--PIDKSDGG----------LADVLAGFPKEAV---------------
ENOPH_PICGU       EQLHPILSSLQF--PLDKADP-----------VANICSQFPSHVQ---------------
ENOPH_KOMPG       DKLPFLLEQVEF--PLDHTDNVT---------VTQILAKFPERYT---------------
ENOPH_BOTFB       AALPETLSTQ--------WDSPS---------FLPYRSAFPPEHA---------------
ENOPH_SCLS1       AALPETLSTE--------WDSSS---------FLPYRSAFPPEHS---------------
ENOPH_CHAGB       SALPSTLAQE--------WDAPA---------FARYRAAFPAEHA---------------
ENOPH_MAGO7       EALPHTLDSQ--------WDDPA---------FAQYRDAFPAEYA---------------
ENOPH_NEUCR       EALPGTLKAK--------WDSPE---------FAPYRAAFPAEHA---------------
ENOPH_SORMK       EALPGTLKAK--------WDSPG---------FASYRAAFPAEHA---------------
ENOPH_PODAN       SALPATLEAQ--------WDKPE---------FSQYRDAFPAEHA---------------
ENOPH_VERA1       QALPVTLDKK--------WDSPD---------FAPYRNAFPEPAA---------------
I1RFL2_GIBZE      EALPKVLEQE--------WDSSE---------FAKYRDAFPEEYR---------------
ENOPH_NECH7       EALPKVLDQE--------WDSPE---------FAKYRDAFPEEYR---------------
ENOPH_YARLI       EKLPQLLKNEQFPIKPGGNQTSD---------LTPYLESFPEEYK---------------
                                                                              

ENOPH_DROER       ---ELIAGFVR------YLIDQDLKVTPMKTLQ------GLIWAQGYTNGELKGHV----
ENOPH_DROYA       ---ELIAGFVR------YLIDQDLKVTPMKTLQ------GLIWEQGYTNGELKGHV----
ENOPH_DROSE       ---ELIAGFVR------YLIDQDLKVTPMKTLQ------GLIWAQGYANGELKGHV----
ENOPH_DROSI       ---ELIAGFVR------YLIDQDLKVTPMKTLQ------GLIWAQGYANGELKGHV----
ENOPH_DROME       ---DLIAGFVR------YLIDQDLKVTPMKTLQ------GLIWAQGYANGELKGHV----
ENOPH_DROAN       ---KVIAGFVR------YLIDKDLKVTPMKTLQ------GLIWACGYASGELKGHV----
ENOPH_DROPE       ---QVITGFVR------YLIDKDLKVTPLKTLQ------GLIWQQGYETGELMGHV----
ENOPH_DROPS       ---QVITGFVR------YLIDKDLKVTPLKTLQ------GLIWQQGYETGELMGHV----
ENOPH_DROWI       ---ELITGFVR------YLIDKDLKVTPLKTLQ------GLIWANGYESGELKGHV----
ENOPH_DROMO       ---AHIADFSR------YLIEKDLKVTPLKTLQ------GHIWAKGYASGELKGHV----
ENOPH_DROVI       ---QLIAGFVR------YLIERDLKVTPLKTLQ------GLIWAKGYASGQLRGHV----
ENOPH_DROGR       ---EAISRFVR------YLIERDLKVTPLKTLQ------GLIWAKGYADGQLRGHV----
ENOPH_MONBE       ---EAASRLCASRPILLNLLEKIILTWPLVPTAHPLLELGHIWKDAYTSGNVKGHI----
ENOPH_HUMAN       DLQQMIQAVVDN---VCWQMSLDRKTTALKQLQ------GHMWRAAFTAGRMKAEF----
ENOPH_BOVIN       DPQWMIQAVVDN---VYWQMSLDRKTTALKQLQ------GHMWRAAFKAGHMKAEF----
ENOPH_MOUSE       DLQQMIQAVVDN---VYWQMSHDRKTTALKQLQ------GHMWKAAFTAGRMKAEF----
ENOPH_RAT         DVQQMIQAVVDN---VSWQMSHDRKTTALKQLQ------GHMWKAAFTAGRMKAEV----
ENOPH_XENLA       ETENMIQAVVDN---VYWQMSLDRKTTALKQLQ------GHMWRSAYITGQLKGEV----
ENOPH_XENTR       TTEHMIQAVVDN---VYWQMSFDRKTTALKQLQ------GHMWRSAYISGQLKGEV----
ENOPH_DANRE       DEEKAIREVVEN---VLWQMAADRKTTALKQLQ------GHMWRAAYMMGRIKGEV----
ENOPH_SALSA       DEEKAIREVVDN---VLWQMASDRKTTALKQLQ------GHMWRAAYAAGRIKGEV----
ENOPH_BRAFL       ARKKVLSAVVDN---VLLNMDADRKVTALKQLQ------GHMWRAAYQTGKIKGEYVKLT
ENOPH_DICDI       DKEKLIESVIRN---VIYQMDNDRKSTPLKQLQ------GHMWLEGYENELVKGVV----
ENOPH_NAEGR       ------QSVIDN---VVYNMDKDRKMTALKQLQ------GHMWRSGYESGNILGEV----
I1CJ93_RHIO9      -AEEIKSSIIKN---IKWQVKADRKIGALKAFQ------GYMWKEGYESGELRGVI----
ENOPH_ACYPI       ------TSVINN---VLWQMTNDKKTTALKQLQ------GHIWKDGYESGLLRGHL----
ENOPH_CAEBR       ----CIEDVTKN---VRHWIKRDKKLTPMKALQ------GLIWEEAYQRGYVKGHV----
ENOPH_CAEEL       ----CIEDVTKN---VRHWIKRDKKLTPMKALQ------GLIWEEAYQRGDVKGHV----
ENOPH_SCHJY       --------------------DSGSKDQAFKALQ------GSIWKDAYENGKVVAHL----
ENOPH_SCHPO       --------------------AEGSKERSFKMVQ------GRIWKKGYESNELTSHL----
ENOPH_ASHGO       ------AAAS----LLRQLVAEDVKDPALKALQ------GRVWERGYASGEITAPV----
ENOPH_CANGA       ------AGKNKLVEHLLDLVANDTKDSTLKALQ------GHVWEVGYNSGELEVPL----
ENOPH_KLULA       -------DASSLHEHIESLVNNDIKDSVLKQLQ------GYIWEQGYKSGEIKAPV----
ENOPH_ZYGRC       -------DSQALQTHIQSLVSNDVKDPTLKQLQ------GTVWSQGYTSGEIKAPV----
ENOPH_YEAST       -------NKEQLQAHILELVAKDVKDPILKQLQ------GYVWAHGYESGQIKAPV----
ENOPH_YEAS7       -------DKEQLQAHILELVAKDVKDPILKQLQ------GYVWAQGYESGQIKAPV----
ENOPH_YEAS6       -------DKEQLQAHILELVAKDVKDPILKQLQ------GYIWAQGYESGQIKAPV----
ENOPH_YEAS1       -------DKEQLQAHILELVAKDVKDPILKQLQ------GYIWAQGYESGQIKAPV----
ENOPH_YEAS2       -------DKEQLQAHILELVAKDVKDPILKQLQ------GYIWAQGYESGQIKAPV----
ENOPH_LACTC       ----------DVAGHIRSLVARDVKDPILKQLQ------GLVWENGYKDGQIKAPV----
ENOPH_VANPO       -------DSTELYNHINNLVLNDIKDPILKQLQ------GHVWQEGYENGLIKAPI----
ENOPH_CANAL       ------KSSESIYKHFKNLVDQDIKDPILKSLQ------GLIWKQGYEKNELQAPI----
ENOPH_CANAW       ------KSSESIYKHFKNLVDQDIKDPILKSLQ------GLIWKQGYENNELQAPI----
ENOPH_CANDC       ------QSWESIFNHFKNLVDQDIKDPILKSLQ------GLIWKQGYENNELKAPI----
ENOPH_CANTT       ------ISNESVFSYLKNLVDQDIKDPILKSLQ------GYIWEKGYEIGDLKAPI----
ENOPH_PICST       ------TSKDSVLEYFNDLVRRDIKDPILKQLQ------GFIWKLGYENGDLKAPV----
ENOPH_DEBHA       ------VSSDSLLEYTTSLVNNDIKDPILKSLQ------GFIWKLGYENGELMAPV----
ENOPH_LODEL       ------TSSESTYNYLKGLVDNDVKDPVLKALQ------GLIWKQGYESGEIKSPV----
ENOPH_CLAL4       ------ASIDQLKNHIDDLVARDVKDPVLKSFQ------GLVWKEGYAKGDLKAPV----
ENOPH_PICGU       ------QDETSLITYIRQLVASDTKDPVLKSLQ------GLVWKKGYDNGDLVAPI----
ENOPH_KOMPG       ------KSKECLKTYINELVANDIKDPTLKQLQ------GIVWQAGYEEGEIVVDL----
ENOPH_BOTFB       ------STPDALLSHVRDLMAQDLKIPYLKSLQ------GYLWLRGYESGELKCPL----
ENOPH_SCLS1       ------STPEALLSHVRDLMAQDLKIPYLKSLQ------GYLWLRGYESGTLKCPL----
ENOPH_CHAGB       ------STPSALAAHARDLMARDVKIGYLKALQ------GYLWEAGYASGALRAPL----
ENOPH_MAGO7       ------SSKEALAAHVRDLVSRDVKAPYLKSLQ------GYLWKNGYDSGEIRAPL----
ENOPH_NEUCR       ------GSQESLAAHVRDLMSKDLKISYLKSLQ------GYLWETGYRNGELKAPL----
ENOPH_SORMK       ------GSQETLAAHVRDLMSKDLKISYLKSLQ------GYLWETGYRNGELKAPL----
ENOPH_PODAN       ------SSQEALTAHVKDLMSRDVKIAYLKSLQ------GYLWESGYKSGELKAPL----
ENOPH_VERA1       ------SSRPVFEAHVADLVKRDVKVSYLKALQ------GYLWLAGYESGDIKAPL----
I1RFL2_GIBZE      ------NSPSDFEAHVRDLVKRDVKIAYLKSLQ------GYLWLQGYESGNIVAPL----
ENOPH_NECH7       ------NSRPDFEAHVRDLVKRDVKIAYLKSLQ------GYLWLQGYKSGDIVAPL----
ENOPH_YARLI       ------QSAQALEDHVIDLTEKNVKAPYLKALQ------GYIWKSGYQSGEIKAPL----
                                              :          * :*  .:    :        

ENOPH_DROER       YEDVPTAFKAWRAAGLQ------IAVYSSGSVAAQKLIFGHSLVG---------------
ENOPH_DROYA       YEDVPAAFEAWRAAGLQ------IAVYSSGSVAAQKLIFGHSLVG---------------
ENOPH_DROSE       YEDVPAAFEAWRAAGLR------IAVYSSGSVAAQKLIFGHSLAG---------------
ENOPH_DROSI       YEDVPAAFEAWRAAGLR------IAVYSSGSVAAQKLIFGHSLAG---------------
ENOPH_DROME       YEDVPAAFEAWRAAGLQ------IAVYSSGSVAAQKLIFGHSLAG---------------
ENOPH_DROAN       YEDVPDAFRAWQKAGLR------IAVYSSGSVDAQKLIFGYSVAG---------------
ENOPH_DROPE       FNDVPGAFEAWREAGLR------IAVYSSGSVAAQKLIFRYSIVG---------------
ENOPH_DROPS       FNDVPGAFEAWREAGLR------IAVYSSGSVAAQKLIFKYSIVG---------------
ENOPH_DROWI       YDDVKEAFEHWNNSGLK------LAIYSSGSVAAQKLIFGYSTSG---------------
ENOPH_DROMO       YEDVAVAFQAWSDAGLR------IAVYSSGSVAAQKLIFQHSIAG---------------
ENOPH_DROVI       YEDVATAFHTWREAGLR------IAVYSSGSVAAQKLIFQHSIAG---------------
ENOPH_DROGR       YEDVAGAFGKWHQDGIR------IAVYSSGSVAAQKLIFQHSIAG---------------
ENOPH_MONBE       YEDVVPAFQRLTEAGAQ------LYIYSSGSIAAQKLLFGHSEAG---------------
ENOPH_HUMAN       FADVVPAVRKWREAGMK------VYIYSSGSVEAQKLLFGHSTEG---------------
ENOPH_BOVIN       FEDVVPAVRKWREAGMK------VYVYSSGSVEAQKLLFGHSTEG---------------
ENOPH_MOUSE       FADVVPAVRRWREAGMK------VYIYSSGSVEAQKLLFGHSTEG---------------
ENOPH_RAT         FADVVPAVRRWREAGMK------VYIYSSGSVEAQKLLFGHSTEG---------------
ENOPH_XENLA       YEDVVPSIRQWRELGFK------LYIYSSGSVEAQKLLFGFSIEG---------------
ENOPH_XENTR       YEDVVPSIRQWRELGIK------LYIYSSGSIDAQKLLFGYSIEG---------------
ENOPH_DANRE       YQDVVPAIRRWRHHGLK------IYIYSSGSVEAQKLLFGYSVQG---------------
ENOPH_SALSA       YQDVVPSIRRWRRQGLK------VYIYSSGSVEAQKLLFGYSVEG---------------
ENOPH_BRAFL       FADVVPAIRGWLETGRQ------VYIYSSGSVEAQKLLFGFSTEG---------------
ENOPH_DICDI       FPEVPKAFENWNLNHID------IYIYSSGSIAAQKLLFNYSNFG---------------
ENOPH_NAEGR       YDDAFDFFERIKKQGKN------IYIYSSGSVQAQKLLFQYSTHG---------------
I1CJ93_RHIO9      YDDVVPKFDQWISQGKK------IYIYSSGSVPAQKLLVSFSTKG---------------
ENOPH_ACYPI       YEDVLPVLNKLTDFGKK------IYTYSSGSTKAQEYLFQYSMYG---------------
ENOPH_CAEBR       YPDVLPILKIIESRQIP------IYIYSSGSVHAQKLLFANSVEG---------------
ENOPH_CAEEL       YPDVLPVLKIVENRKIP------IYIYSSGSVHAQKLLFANSIEG---------------
ENOPH_SCHJY       FPDVVPLLKRAADKGVR------VCIYSSGSVPAQKLYFHYSEYG---------------
ENOPH_SCHPO       FPDVVPAIQRSLQLGMR------VYIYSSGSVPAQKLYFEHSDAG---------------
ENOPH_ASHGO       YADAVRFIQRNAGR---------VYIYSSGSVQAQRLLFGHVSNPSG---------DGVL
ENOPH_CANGA       YPDVIDFLVRNDGRGDDKV---PVYIYSSGSIHAQKLLFGHVKNSGNSH----AKIAGNW
ENOPH_KLULA       YPDAIDFIQRHAPN---------VYIYSSGSVKAQILLFQHV--------------EGDI
ENOPH_ZYGRC       YKDAIEFMKRKE-N---------VYIYSSGSVQAQKLLFGHVANPDNS-----GSNESSL
ENOPH_YEAST       YADAIDFIKRKK-R---------VFIYSSGSVKAQKLLFGYVQDPN-------APAHDSL
ENOPH_YEAS7       YADAIDFIKRKK-R---------VFIYSSGSVKAQKLLFGYVQDPN-------APAHDSL
ENOPH_YEAS6       YADAIDFIKRKK-R---------VFIYSSGSVKAQKLLFGYVQDPN-------APAHDSL
ENOPH_YEAS1       YADAIDFIKRKK-R---------VFIYSSGSVKAQKLLFGYVQDPN-------APAHDSL
ENOPH_YEAS2       YADAIDFIKRKK-R---------VFIYSSGSVKAQKLLFGYVQDPN-------APAHDSL
ENOPH_LACTC       YDDAIKFIKNSDVP---------VYIYSSGSVKAQKLLFQYVESRS-----------NTL
ENOPH_VANPO       YQDSIEFIKDNGNR---------IYIYSSGSVRAQKLLFEFVACND---------GKETI
ENOPH_CANAL       YQDSIEFIESFPTKSSTNN---KIYIYSSGSIKAQILLFGHVKSTTTT------ITNEVI
ENOPH_CANAW       YQDSVEFIESFPTKSSTNN---KIYIYSSGSIKAQILLFGHVKSTTTTTTTTTTITNEVI
ENOPH_CANDC       YQDSIKFIESFPTVKSKDNQ-RKIYIYSSGSIKAQILLFGHVKNSSTSTTSSS-IDNDTI
ENOPH_CANTT       YKDSIKFIENFNKK---------IYIYSSGSIKAQILLFGHAEK-----------DQESI
ENOPH_PICST       YEDSIEFIKTFPSKTENKR----IYIYSSGSIKAQILLFGYVDE-----------NGKSV
ENOPH_DEBHA       YEDAIEFVTDLSKTRK-------IYIYSSGSIKAQVLLFGHVKGA----------NGSPV
ENOPH_LODEL       YPDSIDFIEKFPKREANCK----IYIYSSGSINAQKLLFSHVDNG----------TGIAM
ENOPH_CLAL4       YEDAIAFINRS-KS---------VYIYSSGSVGAQKLLFSHVDVNG-----------ASV
ENOPH_PICGU       YDDAIALITTSSEP---------IYIYSSGSVAAQKLLFSHVKGN--------------L
ENOPH_KOMPG       YNDVIEALDRWKKEDKS------VYIYSSGSIKAQKLLFSHVKFK-----------SETR
ENOPH_BOTFB       FPDVYPALKKWRDNGAK------ICIYSSGSVAAQKLLWRYTTEGDLRSC--IWNGLEGD
ENOPH_SCLS1       FPDVYPAMKKWKENGAK------ICIYSSGSVAAQKLLWRYTAEGDLRGC--IWNGVDGA
ENOPH_CHAGB       FEDVAPKVREWTSAAGEEGGVARVMIYSSGSVPAQKLLFRHTSG-------------EPA
ENOPH_MAGO7       FADVAPKFAAWQAAG------IAIMIYSSGSVPAQKLLFGHTNS-------------EPA
ENOPH_NEUCR       FLDVAPQLARWREHGGVK-----VMIYSSGSVPAQKLLFGHTNG-------------EPS
ENOPH_SORMK       FADVAPQLARWREHNGAK-----VMIYSSGSVPAQKLLFGHTNG-------------EPS
ENOPH_PODAN       FDDVAPKFVQWKK-AGEE-----IMIYSSGSVAAQKLLFKHTNG-------------HPA
ENOPH_VERA1       FPDVSPSMRAWHDAGIK------LIIYSSGSVPAQKLLFGHTNA-------------SPP
I1RFL2_GIBZE      FPDVETFFNEATQSGKK------IIIYSSGSVPAQKLLFAHTNS-------------EKS
ENOPH_NECH7       FPDVDPFFNQAVKDGKK------IIIYSSGSVPAQKLLFSHTNS-------------EKS
ENOPH_YARLI       YPDAVDYMKRVVDGGNK------VFIYSSGSVPAQKLLFGYSSA---------------G
                  : :    .               :  *****  **                         

ENOPH_DROER       NLQPYLSAYFDTH-VGHKQEQQSYETIAKLLK----EDPKHILFLTDIPGEAAAARSAGL
ENOPH_DROYA       NLQPHLSAYFDTH-VGHKQDQKSYENIANLLK----EDPKQILFLTDIPGEAAAARSAGL
ENOPH_DROSE       NLQPHLSAYFDTH-VGHKQEQQSYENIAKQLK----EDPKQILFLTDIPGEAAAACSAGL
ENOPH_DROSI       NLQPHLSAYFDTH-VGHKQEQQSYENIAQQLK----EDPKQILFLTDIPGEAAAARSAGL
ENOPH_DROME       NLQPYLSAYFDTH-VGHKQEQQSYKNIAKQLK----EDPKQILFLTDIPGEAAAARCAGL
ENOPH_DROAN       NLLPYLSDHFDTH-VGHKQEQQSYVNISNSLR----EKPQNILFLTDIPGEASAALSAGL
ENOPH_DROPE       DLLTHLSAHFDTH-VGHKQESQSYANIAQSLG----EDPSHILFLTDIPGEAAAARSAGL
ENOPH_DROPS       DLLTHLSTHFDTH-VGHKQESQSYANIAQSLG----EDPSHILFLTDIPGEAAAARSAGL
ENOPH_DROWI       NLLPYLSAHFDTH-VGHKQEKDSYINIAKSLE----TNPEHILFLTDIPGEADAARAAGL
ENOPH_DROMO       DLLPLLSAHFDTN-VGHKQQTESYTRIAESLG----VEPQHVLFLTDVPEEASAARDAGM
ENOPH_DROVI       DLLPHLSAHFDTH-VGHKQQTESYTKISQILQ----VEPQHVLFLTDVPLEAAAARAAGM
ENOPH_DROGR       DLLPHLSAHFDTH-IGHKQQSESYTKIAESLQ----VQPQHVLFLTDVPQEAAAARAAGM
ENOPH_MONBE       DLQPYLSGYFDTT-TGPKRDAASYSDIAAAIG----VTPQSIIFLSDRIEECRAASAAAM
ENOPH_HUMAN       DILELVDGHFDTK-IGHKVESESYRKIADSI----GCSTNNILFLTDVTREASAAEEADV
ENOPH_BOVIN       DILELVDGHFDTK-IGHKVESESYQKIASSI----GCSTNNILFLTDVSREASAAEEAGV
ENOPH_MOUSE       DILELIDGHFDTK-IGHKVDSESYRKIADSI----GCSTNNILFLTDVTVEASAAEEADV
ENOPH_RAT         DILELIDGHFDTK-IGHKVESDSYRKIADSI----GCSTNNILFLTDVTVEASAAEEADV
ENOPH_XENLA       NLLKLLDGHFDTT-VGHKVESKSYRNIADSI----RCSPENILFLTDVVKDMPLYLVTQE
ENOPH_XENTR       DLLKLLDGHFDTN-IGHKVESKSYRNIADNI----GCLPENILFLTDVVKEALAAEKAGL
ENOPH_DANRE       DILDLFDGHFDTN-IGAKVESKSYENIAERI----GCQPEEIMFLTDVTREAKAAEDAGV
ENOPH_SALSA       DVLDLFDGHFDTN-IGAKVESKSYERIAERM----GCLSEEIMFLTDITREAKAAEDAGV
ENOPH_BRAFL       DLLELFSGHFDTT-TGLKVETESYRRIAKTV----GCDPANILFLTDVVREAKPSREAGM
ENOPH_DICDI       SLLPYIKGHFDTT-IGGKLHPSSYEKILSTINN--GSPNS-YLFVTDSILEAKAARESGL
ENOPH_NAEGR       NLLPYFVDHFDTSNIGNKLEKSSYVKILERT----GIPNSDILFLTDNIGEAIAAREAGI
I1CJ93_RHIO9      DLTNYFSGYFDTT-IGLKVQTESYEAIAKEIN----KSSHSILFVSDNIKEIVAAHQAGY
ENOPH_ACYPI       DVSGIFLKYFDTK-MGPKGSETSYINIANEI----NVNCSDILFLTDVVVEAEAAVKAGC
ENOPH_CAEBR       DMTKILYGYFDTN-IGLKGETSSYTKISEQI----GVPEKDILFLTDVEAEAAAASKAGL
ENOPH_CAEEL       DMTKILYGYFDTN-IGLKGESNSYTKISERI----KIPPSEILFLTDVEAEAAAAKKAGL
ENOPH_SCHJY       DLSNYISEYYDTS-IGPKVEADSYKRIVGSD------DPATWLFLSDNVHELDAARQSGL
ENOPH_SCHPO       NLLKYFSGYYDTT-IGLKTECGSYVKIVGNS------NPREWLFLSDNINELKAARKVGL
ENOPH_ASHGO       DLTGHLAGFFDIPAAGRKTEAKSYERILAAIGLE--RQPGAAIFVSDSVAELDAASASGL
ENOPH_CANGA       DLNRFIDGYFDINTAGKKTESNSYKKILDEIKMT--DKPHDVLFLSDNAKELDAAKECGI
ENOPH_KLULA       DLTKSIAGYFDINTSGKKTEPQSYTNILKSIGVPP-SSASDVVFISDNDKELDAALDVGI
ENOPH_ZYGRC       DLNPLIKGYFDINTSGKKLESSSYEKIVTQIGV----AAEQVLFISDNVKELEAAHAAGV
ENOPH_YEAST       DLNSYIDGYFDINTSGKKTETQSYANILRDIGA----KASEVLFLSDNPLELDAAAGVGI
ENOPH_YEAS7       DLNSYIDGYFDINTSGKKTETQSYANILRDIGA----KASEVLFLSDNPLELDAAAGVGI
ENOPH_YEAS6       DLNSYIDGYFDINTSGKKTETQSYANILRDIGA----KASEVLFLSDNPLELDAAAGVGI
ENOPH_YEAS1       DLNSYIDGYFDINTSGKKTETQSYANILRDIGA----KASEVLFLSDNPLELDAAAGVGI
ENOPH_YEAS2       DLNSYIDGYFDINTSGKKTETQSYANILRDIGA----KASEVLFLSDNPLELDAAAGVGI
ENOPH_LACTC       DLRPFIKGYFDINTSGVKTQSESYARIANNVGI----KPNGVLFISDNPFELDAAKITGM
ENOPH_VANPO       DLRPSILDYFDINTSGVKTESSSYDKIAKTIEHS--EHRERILFLSDNPKELEAASSAGL
ENOPH_CANAL       DLNPKLNGYFDITTAGFKNQSNSYKKILQEINKS--STPKSVLFLSDNINEVNAAIEAGM
ENOPH_CANAW       DLNPKLNGYFDITTAGFKNQSNSYKKILQEINKS--STPKSVLFLSDNINEVNAAIEAGM
ENOPH_CANDC       DLNDKLNGYFDITTVGFKNQSNSYIKILQEINKS--QYPQSVLFLSDNINEVNAAINAGM
ENOPH_CANTT       NLNPFLKGYFDITTAGFKNKSESYIKILNEINKS--NDPSSVLFLSDNVNEVKSAIESGM
ENOPH_PICST       DLNEYLSGYFDITTAGFKTQSSSYTKILEDIGK---EHGGSVLFLSDNVLEVEAALEAGM
ENOPH_DEBHA       DMNRYLSGYYDITTAGFKQESGSYVSILKDIGYE--SKQSSVLFLSDNVREVDAAIQAGM
ENOPH_LODEL       DLNPQLSGYFDITTAGFKQEASSYTKIIDQIDKK--DNEKSVLFLSDYINEVNAAIESGM
ENOPH_CLAL4       DLTPKLKGYFDITTAGFKQEKDSYLKIAADIGC----DPADVIFYSDNVLEVKAALEAGM
ENOPH_PICGU       DLTPHLAGYFDITTSGHKQDSTSYKSILHAIGNP---EPATVTFYSDSPAEVRAAIEAGM
ENOPH_KOMPG       DLTNYIKGYYDPTSVGSKIESESYLNILKDLNK----DPESAIFLSDNIKEVAASIRAGI
ENOPH_BOTFB       DGRELEGGYWDTVNAGLKQHMASYEKIAKANSALGE--VGEWLFLSDNIKEVRAAREAGM
ENOPH_SCLS1       E--EIEGGYWDTVNAGLKQESTSYEKIAKANRALGE--VGEWLFLSDNVKEVRAAKESGM
ENOPH_CHAGB       DLTDAITDYFDTVNAGPKTEPASYERIAAKYPEVP---AGEWLFLSDNVREVEAAREAGM
ENOPH_MAGO7       DLTSAIADFFDTVNAGPKTEIASYEKIASMHPQYP---KNEWLFLSDNVKEVDAALGAGF
ENOPH_NEUCR       DILPWLSDFFDTVNAGPKQEKASYEKIAAKHQEYP---IGEWLFLSDNVKEVEAAKQAGM
ENOPH_SORMK       DILPWLSDFFDTVNAGPKQEKASYEKIAAKHQEYP---IGEWLFLSDNVKEVEAAKQAGM
ENOPH_PODAN       DLIPEISDFFDTVNAGPKQEASSYQTILAAHPEFPE--ANSWLFLSDNVKEVEAAKQAGM
ENOPH_VERA1       SLIPIISDWFDTVNAGMKMESSSYTSILSRYPDTQ---PQEWLFLSDNVDEVSAARAAGM
I1RFL2_GIBZE      DMTPLIADYFDTTNAGPKTEVDSYSKIISHHPEHKD--LNRWLFLSDNIDEVKAAVGASM
ENOPH_NECH7       DMTPLIADYFDTTNAGPKTEVDSYRKIISSHPEHKD--LGRWLFLSDNIHEVSAAVEAGI
ENOPH_YARLI       DLTPLISDYFDTVNAGPKMEAASYTTILKAIGFEA----DRVLFLSDNVREIEAAKKAGL
                  .        :*    * *    **  *                * :*   :         

ENOPH_DROER       QAIILQRPGNAALADDQK-----ASFELIPDFKPLQNLKLPLNKYQA-------------
ENOPH_DROYA       QAVILQRPGNAALADDQK-----ASFELMPDFKSLQNLKLPINKYQA-------------
ENOPH_DROSE       QAIILQRPGNAALADDQK-----ASFELIPDFKPLHNLKLPINKSQA-------------
ENOPH_DROSI       QAIILQRPGNAGLADDQK-----ASFELIPDFKPLHNLKLPINKSQA-------------
ENOPH_DROME       QAIILKRPGNAALADDQK-----TGFELIPDFKPLHNLKVPVNKSQA-------------
ENOPH_DROAN       QTIILHRPGNGPLSDDQK-----SNYEVIPDFKSLYSLQLPQK-----------------
ENOPH_DROPE       QTIILQRPGNTPLTDDQK-----YSNELIADFSSLHTLQLPE------------------
ENOPH_DROPS       QTIILQRPGNTPLTDDQK-----YSNELIADFSSLHTLQLPE------------------
ENOPH_DROWI       QAIILQRFGNAPLTDDEK-----SLNKIINDFSVLKVDK---------------------
ENOPH_DROMO       QTVLLARPGNAPLTAEHT-----SAFPVVANFVALQSLKQP-------------------
ENOPH_DROVI       LTILLQRPGNVPLSEEER-----SSYPVVEDFVALHTLKQP-------------------
ENOPH_DROGR       LTTLLERPGNAPLSEEER-----KKFSSVADFTGIVV-----------------------
ENOPH_MONBE       RTALVVRPGNAPLSEAER-----TEFPILHDFTGLRGAKFTQAQAGDTEAKRSASGDGAL
ENOPH_HUMAN       HVAVVVRPGNAGLTDDEK-----TYYSLITSFSELYLPSST-------------------
ENOPH_BOVIN       HVAVVVRPGNAGLTDDEK-----THFSLITSFSELYLPSST-------------------
ENOPH_MOUSE       HVAVVVRPGNAGLTDDEK-----TYYNLITSFSELYLPST--------------------
ENOPH_RAT         HVAVVVRPGNAGLTDDEK-----TYYNLISSFSELYLPSTQSKV----------------
ENOPH_XENLA       SYPEAVIRG----------------VCC--------------------------------
ENOPH_XENTR       HVAVVVRPGNAALTDEDK-----SNCCCITSFHQIHFPSQK-------------------
ENOPH_DANRE       NVAVVVRPGNMELTEEER-----DHYRIITSFNQLELIGNV-------------------
ENOPH_SALSA       NVAVVVRPGNMELTEEER-----SHYNLITTFSQLEVMGRV-------------------
ENOPH_BRAFL       KTCLTVRPGNAPLTEEDW-----ANYPVIKSFSELACDVSPTKMRSRGKAAT--------
ENOPH_DICDI       NVCLSIRDGNPPIVDRELL----NTFDQVSSFDQLFNKFNFKN-----------------
ENOPH_NAEGR       DSVLSVRPGTMKLPED-------HTFEAVTSFEHLEF-----------------------
I1CJ93_RHIO9      QVVISDRPGNAPLDVES------EQFKIITSFDQID------------------------
ENOPH_ACYPI       NSIFLVRPGNAPLDPEKS-----SKFRIIKTLDELLETE---------------------
ENOPH_CAEBR       QTRLVIRPGNATLTQEAK-----NAYGTIHTLEEIL------------------------
ENOPH_CAEEL       QTKLVVRPGNAGLTQEAI-----NAYGTIESLEEIL------------------------
ENOPH_SCHJY       KVGLAVRPGNEP-VSSSG-------YSEYGSFDSLL------------------------
ENOPH_SCHPO       HTGLVVRPGNDPVVDTSG-------FPVYNSFEILFTE----------------------
ENOPH_ASHGO       SVRLAVRPGNERVSG-------A-RYTTLTDFEGL-------------------------
ENOPH_CANGA       SVGLAMRAGNVTVPN-------AIDYKQYFQFTKL-------------------------
ENOPH_KLULA       STILALRPGNNPVSN-------AEKYKALNNFSSI-------------------------
ENOPH_ZYGRC       KTLLAIRPGNPPVQE-------NHGFRTVEKFDSL-------------------------
ENOPH_YEAST       ATGLASRPGNAPVPD-------GQKYQVYKNFETL-------------------------
ENOPH_YEAS7       ATGLASRPGNAPVPD-------GQKYQVYKNFETL-------------------------
ENOPH_YEAS6       ATGLASRPGNAPVPD-------GQKYQVYKDFETL-------------------------
ENOPH_YEAS1       ATGLASRPGNAPVPD-------GQKYQVYKDFETL-------------------------
ENOPH_YEAS2       ATGLASRPGNAPVPD-------GQKYQVYKDFETL-------------------------
ENOPH_LACTC       QTMLAVRPGNSEVRD-------ALKYNPVTNFDDL-------------------------
ENOPH_VANPO       STRLVIRPGNAPVED-------DTKYTSIRSLSEL-------------------------
ENOPH_CANAL       KSYIVIRPGNPPIDDDDDGNDDKINHKIIYSLDELDL-----------------------
ENOPH_CANAW       KSYIVIRPGNPPIDDDDDGNDDKINHKIIYSLDELDL-----------------------
ENOPH_CANDC       KSYIVIRPGNSPIND-----EDKKFHKIIYSLDELDL-----------------------
ENOPH_CANTT       NSYIVIRPGNAPLSD-----DDKSTYKTIHSLDELTL-----------------------
ENOPH_PICST       ESYVVVRPGNAPLTE-----DDKTKYKIITSLEQL-------------------------
ENOPH_DEBHA       NSLVVDRPGNAPLSE-----ADKKSFSIIETFRDLKL-----------------------
ENOPH_LODEL       NSYVVIREGNTPIPD-----KELASHKIIYSLSELNL-----------------------
ENOPH_CLAL4       ASKVVVRPGNAELSE-----SDKKSYECISSFTAE-------------------------
ENOPH_PICGU       KATIVVRPGNGPLTD-----QDRQ-LGTITSFP---------------------------
ENOPH_KOMPG       KSLVVKRPGNTVHHD-------NQSFDFVYSFDNV-------------------------
ENOPH_BOTFB       KSFVVVREGNAEVTA-----EEREGQVLVESFAEVEKWVEVTADKA--------------
ENOPH_SCLS1       KSFVVVREGNADVSV-----EEKNRQVLITSFREVEAMVEVTGESA--------------
ENOPH_CHAGB       RACVVQRPGNAELPE-----DVRGRLEVVESFEEL-------------------------
ENOPH_MAGO7       QSFVVQRPGNPELPD-----GVEDRHKVIRSFEEL-------------------------
ENOPH_NEUCR       QSYIVDRPGNAELSE-----EARKEHRVIKSFEEIGDL----------------------
ENOPH_SORMK       QSYIVDRPGNAELSE-----EARKEHRVVKSFEEIGDL----------------------
ENOPH_PODAN       QSFVVERPGNAELSA-----EDREKHRVIKTFAEI-------------------------
ENOPH_VERA1       HSLVVVRPGNAPLPE-----CHVGEGQAVQTFEGLAVGGKRNESSKSS------------
I1RFL2_GIBZE      RSLPVVRPGNAPLPP-----NEPLSKVAITEFKHSEFASLGV------------------
ENOPH_NECH7       RSVPVIRDGNAPLPP-----DNSLTKLAISEFKHSEDA----------------------
ENOPH_YARLI       RAYVAERPGNAKLTP-----QEKEDNVIKTSFEGIEI-----------------------
                          *                                                   

ENOPH_DROER       -----------
ENOPH_DROYA       -----------
ENOPH_DROSE       -----------
ENOPH_DROSI       -----------
ENOPH_DROME       -----------
ENOPH_DROAN       -----------
ENOPH_DROPE       -----------
ENOPH_DROPS       -----------
ENOPH_DROWI       -----------
ENOPH_DROMO       -----------
ENOPH_DROVI       -----------
ENOPH_DROGR       -----------
ENOPH_MONBE       AAKKAPPTHDF
ENOPH_HUMAN       -----------
ENOPH_BOVIN       -----------
ENOPH_MOUSE       -----------
ENOPH_RAT         -----------
ENOPH_XENLA       -----------
ENOPH_XENTR       -----------
ENOPH_DANRE       -----------
ENOPH_SALSA       -----------
ENOPH_BRAFL       -----------
ENOPH_DICDI       -----------
ENOPH_NAEGR       -----------
I1CJ93_RHIO9      -----------
ENOPH_ACYPI       -----------
ENOPH_CAEBR       -----------
ENOPH_CAEEL       -----------
ENOPH_SCHJY       -----------
ENOPH_SCHPO       -----------
ENOPH_ASHGO       -----------
ENOPH_CANGA       -----------
ENOPH_KLULA       -----------
ENOPH_ZYGRC       -----------
ENOPH_YEAST       -----------
ENOPH_YEAS7       -----------
ENOPH_YEAS6       -----------
ENOPH_YEAS1       -----------
ENOPH_YEAS2       -----------
ENOPH_LACTC       -----------
ENOPH_VANPO       -----------
ENOPH_CANAL       -----------
ENOPH_CANAW       -----------
ENOPH_CANDC       -----------
ENOPH_CANTT       -----------
ENOPH_PICST       -----------
ENOPH_DEBHA       -----------
ENOPH_LODEL       -----------
ENOPH_CLAL4       -----------
ENOPH_PICGU       -----------
ENOPH_KOMPG       -----------
ENOPH_BOTFB       -----------
ENOPH_SCLS1       -----------
ENOPH_CHAGB       -----------
ENOPH_MAGO7       -----------
ENOPH_NEUCR       -----------
ENOPH_SORMK       -----------
ENOPH_PODAN       -----------
ENOPH_VERA1       -----------
I1RFL2_GIBZE      -----------
ENOPH_NECH7       -----------
ENOPH_YARLI       -----------