CLUSTAL format seed alignment for MF_03141

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LIS1_AJECG       ----------MARLLTNRQADELHKSIIAYLSANDLPNTAAALR-------AEL-NLTEE
LIS1_AJECH       ----------MARLLTNRQADELHKSIIAYLSANDLPNTAAALR-------AEL-NLTEE
LIS12_ASPCL      ----------MARLLTNSQAEELHKSIIAYLSANGLPETTAILR-------KEL-GVTEH
LIS11_TALMQ      ----------MSRLLTIRQAEELHKSIIAYLSANNLSNAASALR-------GEL-GLSEE
LIS1_TALSN       ----------MSRLLTIRQAEELHKSIIAYLSANNLTNAAAALR-------AEL-GLSEE
LIS1_ASPFN       ----------MPPLLTNRQAEELHKSMIAYLVASDLPDTAAALR-------REV-NLSED
LIS1_ASPOR       ----------MPPLLTNRQAEELHKSMIAYLVASDLPDTAAALR-------REV-NLSED
LIS12_CHAGB      ----------MNPVLTSRQADELHKSIVAYLTANNLSTTAATLR-------EEL-SLGED
LIS1_ARTBC       ----------MSPILTNRQAEELHKSIIAYLTANNLLDTANTLR-------AEL-NLNED
LIS1_TRIVH       ----------MSPILTNRQAEELHKSIIAYLTANNLLDTANTLR-------AEL-NLNED
LIS1_ARTOC       ----------MSPILTNRQAEELHKSIIAYLTANNLLNTANTLR-------AEL-NLSEN
LIS1_MAGO7       ----------MTSILTPRQAEELHKAIIAYLSANNLSSSATALR-------TEL-GLAED
LIS12_UNCRE      ----------MKIGFWTWKSIKLSIAIPLMCS-----HVSSALR-------AEL-GLDEE
LIS1_GIBZE       ----------MSRTLTSRQAEELHKSIIAYLAANNLQDSANAMR-------TEL-GLGED
LIS1_NECH7       ----------MSRTLTSRQAEELHKSIIAYLAANNFQDSVTAMR-------TEL-NLGEE
LIS11_CHAGB      ----------MAQLLTSRQAEELHRALIAYLSSNNLTSTAAALR-------AEI-GLGED
LIS11_PODAN      ---------MNTNILTTRQAEELHKAIIAYLTANNLSNTASALR-------TEL-NLGED
LIS11_NEUCR      ----------MSQILTSRQADELHRALIAYLTAANLPNTAAALR-------EEL-NLSEE
LIS11_SORMK      ----------MSQILTSRQADELHRALIAYLTAANLPNTAAALR-------EEL-NLGED
LIS1_AJEDR       ----------MSQLLTPRQAEELHKSIIAYFLSAKLPKSAAALR-------EEI-ADSVQ
LIS1_BLAGS       ----------MSQLLTPRQAEELHKSIIAYFLSAKLPKSAAALR-------EEI-ADSVQ
LIS1_PARBP       ----------MSQLLTARQAEELHKAMIAYLLSANLPKSAAALR-------EEL-ADSVQ
LIS1_PARBD       ----------MSQLLTARQAEELHKAMIAYLLSANLPKSAAALR-------EEL-ADSVQ
LIS1_COCP7       ----------MSQLLTARQAEELHKSMIAYLLSVNLSKSAAALR-------EEL-ADSVH
LIS1_ASPFU       ----------MSQLLTARQAEELHKSIIAYLASVNLTESSAALR-------AEL-GDSVS
LIS1_NEOFI       ----------MSQLLTARQAEELHKSIIAYLASVNLTESSAALR-------AEL-GDSVS
LIS1_ASPFC       ----------MSQLLTARQAEELHKSIIAYLASVNLTESSAALR-------AEL-GDSVS
LIS11_ASPCL      ----------MSQLLTTRQAEELHKSIIAYLASVNLSESATTLR-------AEL-GDAVT
LIS11_PENRW      ----------MSQLLTSRQAEELHKGIIAYLTSVNLHHSSAALR-------EEL-GDSIR
LIS1_SCLS1       ----------MSQLLTSRQAEELHKSMIAYLNSANLLHSAATLR-------EEL-DIGES
LIS1_PHANO       ----------MSAILTDRQAEELHKAIIAYLGVINAPKTAAAFR-------EEV-NFSAA
LIS1_PYRTR       ----------MSAILTDRQAEELHKAIIAYLGVINAPKTAEAFR-------EEA-NVSAN
LIS12_NEUCR      --MAQASVQIGTPLLTTRQAEELHKSILAYLASKNLATTAATLR-------DEL-DLAEE
LIS12_SORMK      ----MAQAQIGTPLLTTRQAEELHKSILAYLSSKNLASTAATLR-------DELPDLAEV
LIS12_PODAN      ------MTMASRSFLTDRQAEELHKSIIAYLTSLNLATTANTLR-------AEL-NLPEE
LIS12_PENRW      ----------MPSSLTPQQAAELNKSIIAYLSAHGLAETLAAFR-------KES-DFPDN
LIS1_ASPTN       ----------MSQILTASQAEELHKSMVAYLSSIKASQSSNTLR-------EEL-GIGDN
LIS12_TALMQ      ----------MSQILTTRQAEELHKSMVAYLSSLEASKSTAALR-------EEL-VLPDT
LIS1_EMENI       ----------MSQILTAPQAEALHKAMLAYLSVINAPQTAETLR-------EEL-HFDES
LIS1_ASPNC       ----------MTKILTSSQAEELHKSIIAYLSSINASRSCEVLR-------EEL-QVDSS
LIS11_UNCRE      ----------MSQILTGRQAEELHKSLIAYLSSINASQSVTTLR-------EEL-QIGDN
LIS1_TUBMM       -------MSTPVNYLIPRQKDELHKAILAYFSASGLSNTGAALR-------EEL-GVGDE
LIS1_PANTR       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_PIG         ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_RAT         ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_FELCA       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_MOUSE       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_PONAB       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_BOVIN       ------------MVLSQRQRDELNRAIADYLRSNGYEAAYSVFK-------KEA-ELDM-
LIS1_MACFA       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_HUMAN       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDV-
LIS1_CHICK       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDV-
LIS1_XENLA       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_XENTR       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1B_SALSA      ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSTFK-------KEA-ELDM-
LIS1_TETNG       ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSTFK-------KEA-ELDN-
LIS1B_DANRE      ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSTFK-------KEA-ELDV-
LIS1A_SALSA      ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSTFK-------KEA-ELDM-
LIS1A_DANRE      ------------MVLSQRQRDELNRAIADYLRSNGYEEAYSVFK-------KEA-ELDM-
LIS1_BRAFL       ------------MVLSQRQREELNKAIADYLRSNGYESALEAFQ-------KEA-EMP--
LIS1_NEMVE       ------------MVLTPRQKEELNKAIADYLHQCGFEDTLNAFK-------QDA-NMP--
LIS1_IXOSC       ------------MVLSQRQREELNKAIADYLASNGFMEALESFK-------KET-DMP--
LIS1_DROGR       ----------MKMVLSQRQREELNQAIADYLGTNGYADSLEAFR-------KEA-DLS--
LIS1_DROWI       ------------MVLSQRQREELNQAIADYLGTNGYADSLEAFR-------KEA-DLS--
LIS1_DROVI       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLEAFR-------KEA-DLS--
LIS1_DROAN       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLEAFR-------KEA-DLS--
LIS1_DROPE       ----------MKMVLSQRQREELNQAIADYLGSNGYGDSLETFR-------KEA-DVS--
LIS1_DROPS       ----------MKMVLSQRQREELNQAIADYLGSNGYGDSLETFR-------KEA-DVS--
LIS1_DROMO       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLETFR-------KEA-DLS--
LIS1_DROER       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLETFR-------KEA-DLS--
LIS1_DROYA       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLETFR-------KEA-DLS--
LIS1_DROME       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLETFR-------KEA-DLS--
LIS1_DROSE       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLETFR-------KEA-DLS--
LIS1_DROSI       ----------MKMVLSQRQREELNQAIADYLGSNGYADSLETFR-------KEA-DLS--
LIS1_GLOMM       ----------MKMVLSQRQREELNQAIADYLGSNGYSSALEAFR-------KEA-DIS--
LIS1_AEDAE       ------------MYVRRLRRERSNQAIADYLGSNGYTDALEAFR-------KEA-DMP--
LIS1_TRIAD       ------------MVLSPKQEEELRFAVADYLQSCGYTNALEAFK-------KDA-SIP--
LIS1_CAEBR       ------------MSLSERQREEINRAVAEYLQNNGYSEAFNMLL-------KEA-SLS--
LIS1_CAEEL       ------------MSLSERQKEEINRAIAEYMQNNGYSESFSVFL-------KES-SLS--
LIS1_SCHMA       ------------MVLAQRQKEELNRAIADYLFANGYVKALNAFR-------EES-QLA--
LIS1_DICDI       ------------MVLTSKQKEELNGSILDYFESSQYKSSFEEFK-------KET-GTE--
LIS1_POLPP       ------------MVLTNKQKEELNGAILDYFDSSGYKLTSTEFT-------KET-NIE--
LIS1_MONBE       ------------MVLTARQQEELQLAVHAYLVEAGHAEAAAAMA-------KSA-NLG--
LIS11_PARTE      ------------MVLTARQRDELNQAIHQYLLIS-YQQSAQLFK-------TEA-AVK--
LIS12_PARTE      ------------MVLTARQRDELNQAIHQYLLIS-YQQSAQVFK-------TEA-VVK--
LIS1_PHATC       ------------MVLTDRQRADLHAGIYEYLQSR-GDAYQKVVE-------ALA-QADPE
LIS11_POSPM      -----------MSILSERQKDDLNKSIAEYLYAQDLTEIADSLC-------ARL-SLDYK
LIS12_POSPM      -----------MSILSERQKDDLNKSIAEYLYAQDLTEIADSLC-------ARL-SLDYK
LIS1_COPC7       -----------MSLLSDRQKDDLHKAMLDYLYANNHTAAFNALK-------ESA-GITYT
LIS1_CRYNJ       -----------MAALSDRQKDELHRAMLAYLHAAGMHNAYAALQ-------HDA-ALADV
LIS1_USTMA       MSGFNGTSTSSNSILSERQKDELHKSILDYFKTNNLHESFATLM-------REA-NQEGF
LIS1_YARLI       ----------MESLLTDKQRSDLETSIFGYVSRLTNDEALLSQL-------AAVLSQPSG
LIS1_CANAW       --------MEKLQILTERQQTELNHAIIQYLQPLCQQDNH-----------VLLDQLSKL
LIS1_CANAL       --------MEKLQILTERQQTELNHAIIQYLQPLCQQDNH-----------VLLDQLSKL
LIS1_CANDC       --------MEKLSILTERQQTELNYAIIQYLQPLCQQDNH-----------ALLDQLSKI
LIS1_CANTT       -------MMERSQILTERQQSELNKAIIQYLQPICSQENN-----------EVLDKLTSM
LIS1_DEBHA       --------MLQPQILTARQQQELNKAIIQYIKPIAEEAN-------------DGDLIQKL
LIS1_PICST       --------MNRSQILTDRQQQELNKAILQYLEPMLTESSS------------DQEVYRSL
LIS1_PICGU       -----------MSILSPRQQQELNRAIVQYIGKIISDNSENLEHGEKNGVLQHQDLVDKV
LIS1_ASHGO       --------MSQHHILPQHQRADLNRSICDYVQRCGAEE-------------SLVVGLRQL
LIS1_KLULA       -------------MLTYKQRQSLNHAICDYVRQNEGSD-------------ELLVQLESV
LIS1_LACTC       -----------MSLLPPEQRQLLHRCILNYIRSQVPGDGAEGETGGQTEERHVMNSLAKW
LIS1_YEAST       -----MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRH----------EHAQDYESV
LIS1_YEAS7       -----MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRH----------EHAQDYESV
LIS1_YEAS8       -----MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRH----------EHAQDYESV
LIS1_YEAS1       -----MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRH----------EHAQDYESV
LIS1_YEAS2       -----MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRH----------EHAQDYESV
LIS1_CANGA       -----------MSSLTDSQVNDLHCSIYRYVQWVSQNNGSS----------DLLNKLQSV
LIS1_ZYGRC       ----------MDLPLSDEQIRELDESTLDYLLWRNKGIDIT----------QLANSLQVD
LIS1_KOMPG       ----------MSDILTKKQDIELRRAVIQYLRYFVPEFAQDTAV-------NTISRLLLD
                               .   :                                         

LIS1_AJECG       D---------FDATAVKK-----------------YETLLEKKWTSIVRLQKKI------
LIS1_AJECH       D---------FDATAVKK-----------------YETLLEKKWTSIVRLQKKI------
LIS12_ASPCL      D---------FNATAVKK-----------------YETLLEKNGPLLFAYRES-------
LIS11_TALMQ      V---------FDTGTMVK-----------------YETLLEKKWTSIVRLQKKI------
LIS1_TALSN       V---------FDTGTMVK-----------------YETLLEKKWTSIVRLQKKI------
LIS1_ASPFN       V---------FDPTTAKR-----------------YEGMLEKKWTSIARLQKKI------
LIS1_ASPOR       V---------FDPTTAKR-----------------YEGMLEKKWTSIARLQKKI------
LIS12_CHAGB      V---------FDAEKTAK-----------------YQSLLEKKWTSVVRLQKKV------
LIS1_ARTBC       A---------FDPATAKK-----------------YETLLEKKWTSVVRLQKKI------
LIS1_TRIVH       A---------FDPATAKK-----------------YETLLEKKWTSVVRLQKKI------
LIS1_ARTOC       A---------FDTATAKK-----------------YETLLEKKWTSVVRLQKKI------
LIS1_MAGO7       V---------FDAATAKK-----------------YEGLIEKKWTSVVRLQKKI------
LIS12_UNCRE      A---------FGTAAAKK-----------------YETLLEKKWTSIVRLQKKI------
LIS1_GIBZE       A---------FDTATAKK-----------------YETLLEKKWTSVVRLQKKI------
LIS1_NECH7       I---------FDPATAKK-----------------YETLLEKKWTSVVRLQKK-------
LIS11_CHAGB      V---------FDATTAKK-----------------YEGLLEKKWTSVVRLQKK-------
LIS11_PODAN      V---------FDPATAKK-----------------YEGLLEKKWTSVVRLQKK-------
LIS11_NEUCR      V---------FDPATAKK-----------------YEGLLEKKWTSVVRLQKK-------
LIS11_SORMK      V---------FDPATAKK-----------------YEGLLEKKWTSVVRLQKKSLTPLVT
LIS1_AJEDR       ----------LDDSTAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_BLAGS       ----------LDDSTAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_PARBP       ----------LDDSTAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_PARBD       ----------LDDSTAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_COCP7       ----------LDDATAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_ASPFU       ----------IDDATLKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_NEOFI       ----------IDDATLKK-----------------YEGLLEKKWTSVVRLQKK-------
LIS1_ASPFC       ----------IDDATLKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS11_ASPCL      ----------IDDATIKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS11_PENRW      ----------VDDTTLKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_SCLS1       ----------FDSATSKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS1_PHANO       ----------FDDATRKK-----------------YEGLLEKKWTSVVRLQKKV------
LIS1_PYRTR       ----------FDDATRKK-----------------YEGLLEKKWTSVVRLQKKV------
LIS12_NEUCR      S---------FDAEKAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS12_SORMK      T---------FDTEKAKK-----------------YEGLLEKKWTSVVRLQKKI------
LIS12_PODAN      T---------FDLAKAKQ-----------------YEGLLEKKWTSVIRLQKKV------
LIS12_PENRW      M---------FDATAAKQ-----------------YENLLERKWTSNSTLMKKL------
LIS1_ASPTN       F----------DEATCKK-----------------YEGLLEKKWTGIARLQR--------
LIS12_TALMQ      F----------DDATCKK-----------------YAGLLEKKFLTCSLKANPSKDNGLS
LIS1_EMENI       Y----------NEATCKK-----------------FEGVLEKKWTGIARLQR--------
LIS1_ASPNC       F----------DDALCRK-----------------YEGLLEKKWTGIARLQK--------
LIS11_UNCRE      F----------TDAACKK-----------------YEGFLEKKWISVVRLQK--------
LIS1_TUBMM       F---------LDQNTMKK-----------------YEGVLEKKWTGVLRLQK--------
LIS1_PANTR       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_PIG         ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_RAT         ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_FELCA       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_MOUSE       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_PONAB       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_BOVIN       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_MACFA       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_HUMAN       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_CHICK       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_XENLA       ----------NEELDIK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_XENTR       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1B_SALSA      ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_TETNG       ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1B_DANRE      ----------NDELDKK------------------FAGLLEKKWTSVIRLQKKV------
LIS1A_SALSA      ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1A_DANRE      ----------NEELDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_BRAFL       -----------GEIEKK------------------YTGLLEKKWTSVIRLQKKV------
LIS1_NEMVE       -----------GELDKK------------------YTGLLEKKWTSVIRLQKKV------
LIS1_IXOSC       -----------GDIDKK------------------YAGLLEKKWTSVIRLQKKV------
LIS1_DROGR       -----------TEAEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROWI       -----------TEAEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROVI       -----------TEAEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROAN       -----------TEAEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROPE       -----------TESEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROPS       -----------TESEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROMO       -----------TESEKK------------------YGGLLEKKWTSVIRLQKKV------
LIS1_DROER       -----------TEVEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROYA       -----------TEVEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROME       -----------TEVEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROSE       -----------TEVEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_DROSI       -----------TEVEKK------------------FGGLLEKKWTSVIRLQKKV------
LIS1_GLOMM       -----------GEAERK------------------IVGLLEKKWTSVIRLQKKV------
LIS1_AEDAE       -----------NEIERK------------------YGGLLEKKWTSVIRLQKKV------
LIS1_TRIAD       -----------KEIDNKK-----------------YSGLLEKKWTSVVRLQKKV------
LIS1_CAEBR       ------------ENDIKP-----------------LGGILEKKWTTVLRLQRKV------
LIS1_CAEEL       ------------ENDIKP-----------------LGGILEKKWTTVLRLQRKV------
LIS1_SCHMA       -----------GENDRK------------------YDGLLEKKWTSVIRLQKKV------
LIS1_DICDI       -------------LDVK------------------KKGLLEKKWTSVIRLQKKV------
LIS1_POLPP       -------------LDPK------------------LKGLLEKKWTSVIRLQKKV------
LIS1_MONBE       -----------DDAGDAK-----------------YTGLLEKKWTTITRLQKRN------
LIS11_PARTE      --------------DGQI-----------------EADLLEKKWNSIVRLSKRV------
LIS12_PARTE      --------------DGQI-----------------EADLLEKKWNSIVRLSKRV------
LIS1_PHATC       CTIPHTTTTSNGSSAGLT-----------------KTPLLEKKWTAIPRLQKKV------
LIS11_POSPM      -----------SEPNSK------------------YAGLLEKKWVSVIRLQKKL------
LIS12_POSPM      -----------SEPNSK------------------YAGLLEKKWVSVIRLQKKL------
LIS1_COPC7       -----------PDPTAR------------------YTGLLEKKWTSVIRLQKKI------
LIS1_CRYNJ       ------------DPRDR------------------AVGLLEKKWTSVIRLQKKV------
LIS1_USTMA       V----------PDPRAK------------------YAGLLEKKWTSVIRLQKKI------
LIS1_YARLI       SEP-------VPADTLKA-----------------NALLLEKKWLSVIRLQRKV------
LIS1_CANAW       LNIDQSTQESNNVEKVDN--------------------YLEKRWSTVLRLQKKI------
LIS1_CANAL       LNIDQSTQESNNVEKVDN--------------------YLEKRWSTVLRLQKKI------
LIS1_CANDC       LNIDQWTQESNNVEKVDN--------------------YLEKRWSTVLRLQKKI------
LIS1_CANTT       LKIESTELDGS--DIVDN--------------------YLEKKWSTVLRLQKKI------
LIS1_DEBHA       SESLDVPLGSIDDSVIPN--------------------YLEKKWSTVLRLQHKI------
LIS1_PICST       QQILVPPSSSSSEAIVDN--------------------YLEKKWSTVLRLQRKI------
LIS1_PICGU       ANLLDVPTSS--EDLTTN--------------------YLEKKWSTVLRLQRKI------
LIS1_ASHGO       FGL----SAEECDATRN----------------GRDPDLLLKKWNSIIRLHRKI------
LIS1_KLULA       LLP----NGSDVIPQ--------------------DPNLLERKWNSIVRLQSKI------
LIS1_LACTC       LRV----DPDGLDGEK-----------------AADGSLLPRKWSSIVRLQRRI------
LIS1_YEAST       RHAIVTLSGFLLQESVDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKI------
LIS1_YEAS7       RHAIVTLSGFLLQESVDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKI------
LIS1_YEAS8       RHAIVTLSGFLLQESVDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKI------
LIS1_YEAS1       RHAIVTLSGFLLQESVDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKI------
LIS1_YEAS2       RHAIVTLSGFLLQESVDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKI------
LIS1_CANGA       ------LDIDELQLSLD----------------DGDQMLLPKKWGSIIRLQRAI------
LIS1_ZYGRC       --------APTLQEDTNR------------------LPLLARKWTAIARLQRRI------
LIS1_KOMPG       ADL-----NKFDNEIQRM----------------IPKQYLEKKWTAVLRLHRKV------
                                                        : :.                 

LIS1_AJECG       ----MDLEARNAALQSELDNLTP-------------ASLLKPRRDPTSWLPTHPP-RYSL
LIS1_AJECH       ----MDLEARNAALQSELDNLTP-------------ASLLKPRRDPTSWLPTHPP-RYSL
LIS12_ASPCL      -------------------------------------------RDSKAWLPQRP--RYSL
LIS11_TALMQ      ----MDLEARCGALQTELNNATP-------------TSLSKRNQDPASWLPKVPA-RYSL
LIS1_TALSN       ----MDLEARTVALQTELNNATP-------------TSLSKRNQDPASWLPKVPA-RYSL
LIS1_ASPFN       ----MDLESRNATLQSELDNSTP-------------ASRLKRNQDPASWLPSTV--RYSL
LIS1_ASPOR       ----MDLESRNATLQSELDNSTP-------------ASRLKRNQDPASWLPSTV--RYSL
LIS12_CHAGB      ----MDLESRSVALQSELEHSTP-------------ASLSKR-KDPTSWLPRSPP-RHSL
LIS1_ARTBC       ----MDLESRMSAMQAELDNATP-------------TSLSKRNKDPASWIPTAPA-RHAL
LIS1_TRIVH       ----MDLESRMSAMQAELDNATP-------------TSLSKRNKDPASWIPTAPA-RHAL
LIS1_ARTOC       ----MDLESRMSALQTELDNATP-------------ISLAKRNKDPASWIPTAPA-RHAL
LIS1_MAGO7       ----MDLESRNNALQSELDNATP-------------LSLAKRNTDPTAWLPAPRP-RYSL
LIS12_UNCRE      ----MDLESRNAALQTELANLTP-------------TALSKRHQDPASWLPRS-V-RHSL
LIS1_GIBZE       ----MDLEAQTQTLQTELNSATP-------------TS--NRRGDPSSWLPAGPP-RHVL
LIS1_NECH7       ---------------TELDSATP-------------TSLSNRKQDPASWLPAGPP-RHVL
LIS11_CHAGB      ---VRHT--------SQLSNATP-------------TS--RQNKDPVNWLPKSPA-RHTL
LIS11_PODAN      ---IMDLESRNSTLQSELANSTP-------------TS--RQNKDPVAWLPKSPA-RHTL
LIS11_NEUCR      ---IMDLESRNHILQSELDNATP-------------TS--RQNKDPVAWLPRAPP-RHTL
LIS11_SORMK      --QIMDLESRNHILQSELDNATP-------------TS--RQNKDPVAWLPRAPP-RHTL
LIS1_AJEDR       ----MDLEARNSALQSELDSATP-------------TSLSRRNQDPVSWLPRAPA-RHRL
LIS1_BLAGS       ----MDLEARNSALQSELDSATP-------------TSLSRRNQDPVSWLPRAPA-RHRL
LIS1_PARBP       ----MDLESRNNALQSELDSATP-------------TSLARRNQDPVSWLPHAPA-RHIL
LIS1_PARBD       ----MDLESRNNALQSELDSATP-------------TSLARRNQDPVSWLPHAPA-RHIL
LIS1_COCP7       ----MDLESRNAALQQELDSATP-------------TSLSRRNQDPASWLPRAPA-RHSL
LIS1_ASPFU       ----MDLESRCAALQSELDSATP-------------TSLLRKNQDPTSWLPRSPA-RHIL
LIS1_NEOFI       ------------------------------------------NQDPTSWLPRSPA-RHIL
LIS1_ASPFC       ----MDLESRCAALQSELDSATP-------------TSLLRKNQDPTSWLPRSPA-RHIL
LIS11_ASPCL      ----MDLESRCAALQSELDSATP-------------TSLLRKNQDPTAWLPRAPP-RHTL
LIS11_PENRW      ----MDLEARCASLQSELDTATP-------------TSLNRKNQDPVSWLPRAPA-RHDL
LIS1_SCLS1       ----MDLESRNAALQSEIDNATP-------------TSLSNRNTDPTAWLPKSPA-RHNL
LIS1_PHANO       ----LELEQRNQSLQSELDSTTP-------------TSLLRRNQDPSSWLPRAPA-RHTL
LIS1_PYRTR       ----MELEQRNQTLQSELDSTTP-------------TSLLRRNQDPASWLPRAPA-RHTL
LIS12_NEUCR      ----LDLESRNHLLQSEIDNATP-------------SSLSRRTQDPTNWLPKAPP-RYVL
LIS12_SORMK      ----LDLESRNTLLQSEIDNATP-------------SSLSRRTQDPTNWLPKAPP-RYVL
LIS12_PODAN      ----LDLQAENAHLKNEIENAGP-------------LALSRKNQDPANWLPKGPP-RYTL
LIS12_PENRW      ----LALESHNKALRNELNSTRP-------------SFL-NRNADVNDWLPQHP--IRSL
LIS1_ASPTN       --KILDLESKITSLQAELDSVPS-------------MARSKQHQDPDNWLPAQSS-AHTF
LIS12_TALMQ      ALQILDLESKVAGLQAELSSLTL-------------TSRSKGGQDPDNWLPGPAS-TRTF
LIS1_EMENI       --RINDLEAEVRSLQAELEASPS-------------AARAK-NQDPTNWLPKPSS-THTL
LIS1_ASPNC       --KILDLESKLAGLQTELDTISP-------------TARST-GKDPINWLP-TSS-RHTF
LIS11_UNCRE      --RILDLESKIASLQAELDSAPT-------------I-TSRANRDPKSWLPGTSP-THTL
LIS1_TUBMM       --KIMELESRLSSLQSELDSATP-------------TSLTRRNVDPSSWLPRAPA-KHVL
LIS1_PANTR       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_PIG         ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_RAT         ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_FELCA       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_MOUSE       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_PONAB       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_BOVIN       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_MACFA       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_HUMAN       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_CHICK       ----MELESKLNEAKEEFTS----------------GGPLGQKRDPKEWIPRPPE-KYAL
LIS1_XENLA       ----MELESKLNEAKEEFTS----------------GGPIGQKRDPKEWIPRPPE-KYAL
LIS1_XENTR       ----MELESKLNEAKEEFTS----------------GGPIGQKRDPKEWIPRPPE-KYAL
LIS1B_SALSA      ----MELESKLNEAKEEITL----------------GGPVAQKRDPKEWIPRPPE-RYAL
LIS1_TETNG       ----MELESKLNEAKEEITL----------------GGPVSQKRDPKEWIPRPPE-RYAL
LIS1B_DANRE      ----MELESKLNEAKEEITL----------------GGPVGQKRDPKEWIPRPPE-KYAL
LIS1A_SALSA      ----MELESKLNEAKEEITL----------------GGPIAQKRDPKEWIPRPPE-KYAL
LIS1A_DANRE      ----MELESKLNEAKEEINI----------------GGPIGQKRDPKEWIPRPPE-KYAL
LIS1_BRAFL       ----MDLEAKLAEAEKEFQS----------------GGPNKKERSPSEWIPRPPA-RYSL
LIS1_NEMVE       ----MDLETRLSEAEKEVHH----------------GGGPKKTRSPEDWIPRPPE-RYTL
LIS1_IXOSC       ----MDLEGRLAEAEKEYIS----------------GTPSREKRSPTEWIPRPPE-RSAL
LIS1_DROGR       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSL
LIS1_DROWI       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSL
LIS1_DROVI       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSL
LIS1_DROAN       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSM
LIS1_DROPE       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSL
LIS1_DROPS       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSL
LIS1_DROMO       ----MDLEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KYSL
LIS1_DROER       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KFSL
LIS1_DROYA       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KFSL
LIS1_DROME       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KFSL
LIS1_DROSE       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KFSL
LIS1_DROSI       ----MELEAKLTEAEKEVIE----------------GAPTKNKRTPGEWIPRPPE-KFSL
LIS1_GLOMM       ----MELEAKLSEAEKEVIE----------------GAPSRAKRSPGEWIPRPPE-KFSL
LIS1_AEDAE       ----MELEAKLSEAEKEAIE----------------GAPTKAKRTPTDWIPRPPE-KFAL
LIS1_TRIAD       ----MDLELRLNNTTREMNS----------------GVPTRNSRSSNDWIPRPPE-KHSL
LIS1_CAEBR       ----NDLEAKLLESQQEINH----------------GAPTRDKRQAADWIPRPPE-TQKL
LIS1_CAEEL       ----NDLESKLQESQREINH----------------GAPTRDKRQAADWIPRPPE-TQKL
LIS1_SCHMA       ----MDLEAKLNEAEKEFQSMQNAIGFGVAGAAPGSGLSDRSDRRDVDAIPRPPA-KFTL
LIS1_DICDI       ----LDLEAKVAQLEEELNSGGG--------------RGGGRGRGKEDALPRPPE-KHIL
LIS1_POLPP       ----MDLEAKVSQLEEELNNGG---------------RGPAR-RGKEDALPRQPE-KHVL
LIS1_MONBE       ----MELQAEVEELRSSARAP-----------------RSRTTTKMEEWVPRPPA-TVAV
LIS11_PARTE      ----ITLEQQVEQLNEQLAQAQAGK------IQFNKSDDEQRLTPIEKF---------KL
LIS12_PARTE      ----ITLEQQVEQLNEQLAQAQAGK------IQFNKSDDEQRLTPFEKF---------KL
LIS1_PHATC       ----LELERQASHHAKIHAHRSAAG------SGGGALEANDGAGGARRLLPRLPC-QHTL
LIS11_POSPM      ----IESENRYTALQEDIAAGPAR-----------------RRDAQVDWLPTAPA-RYTL
LIS12_POSPM      ----IESENRYTALQEDIAAGPAR-----------------RRDAQVDWLPTAPA-RYTL
LIS1_COPC7       ----MELENRNAALQEELSMSPAR-----------------RAASQADWLPRAPA-AHVL
LIS1_CRYNJ       ----IDLENRNAALLAELAAAA-------------------RPAAPGPFLPRPPP-RHTL
LIS1_USTMA       ----MEMESRISQLQEELSAAPSAK----------------RSASLNDWLPAASSARHTM
LIS1_YARLI       ----MDLETRLEAAEREASSTHK--------------ANGLGAGDPKTWLPKTSR---FS
LIS1_CANAW       ----IDLENEISNLNNIIN----------STN--SDNNGIILSKDKINWIPKGAVKQ-SY
LIS1_CANAL       ----IDLENEISNLNNIIN----------STN--SDNNGIILSKDKINWIPKGAVKQ-SY
LIS1_CANDC       ----IDLENEISNLNNIIN----------SSN--SDNNGIVLSKDKINWIPKGTAKQ-SY
LIS1_CANTT       ----IDLENEIHNLTNIIN----------TTN--SETNGVVLSKDKINWIPKGASKQ-TY
LIS1_DEBHA       ----IDLEGEVSNLRTVID----------SQQIVPSASASVIGKDKINWLPSSSIKAFKT
LIS1_PICST       ----IDLENEVGTLRSIVD----------GQQSVSNGAASVISKDRINWLPNRASKSFPT
LIS1_PICGU       ----MDLTDEVSNLKTIIE----------AKH---ANGGSEISKDKINWLPTSVFKTFPT
LIS1_ASHGO       ----LDLEQKCQQLTE-----------ELEAVPTEAYGKAGRGVSHVLWTPRS-NPTFQL
LIS1_KLULA       ----MELEKNCEELQK-----------SIDEQQSSTNQISNASSD---WCPRD-TPSFQI
LIS1_LACTC       ----IELEKEIQELTD-----------ENENLR-ENGPSSPANGALKSWLPRE-RPSFSI
LIS1_YEAST       ----IELEQNTETLVSQIKDLNTQV--SELAQFKPTTSNGTSAHNVLKWIPRN-LPSCLI
LIS1_YEAS7       ----IELEQNTETLVSQIKDLNTQV--SELAQFKPTTSNGTSAHNVLKWIPRN-LPSCLI
LIS1_YEAS8       ----IELEQNTETLVSQIKDLNTQV--SELAQFKPTTSNGTSAHNVLKWIPRN-LPSCLI
LIS1_YEAS1       ----IELEQNTETLVSQIKDLNTQV--SELAQFKPTTSNGASAHNVLKWIPRN-LPSCLI
LIS1_YEAS2       ----IELEQNTETLVSQIKDLNTQV--SELAQFKPTTSNGTSAHNVLKWIPRN-LPSCLI
LIS1_CANGA       ----TKLEQKCDALQQELDDKTKQL--ETIVPKDTQIATTTDVN----WLPPD-HIYASI
LIS1_ZYGRC       ----MSLEQNIRDLRE-----------ASIEMNAPAFSPESSESARIAWIAPA-QPRASI
LIS1_KOMPG       ----EELERTIGYQSNKVEIELQSQ---------PHSDITSNSLDRINWVPGIEPFQKLN
                                                                             

LIS1_AJECG       ESHRDTINCIAFHPKFSSLASGSDDFTIKIWDWEL---GELEMTLKGHTRAVLDVDYGSP
LIS1_AJECH       ESHRDTINCIAFHPKFSSLASGSDDFTIKIWDWEL---GELEMTLKGHTRAVLDVDYGSP
LIS12_ASPCL      HSHRDTINCIAFHPKYSSIASGSDDCTIKIWDWEL---GELEVTLKGHTRAVRDLDYGSP
LIS11_TALMQ      ESHRNTINCLAFHPKFSSIASGSDDCMIKIWDWEL---GELETTLKGHTRAVLDVDYGNT
LIS1_TALSN       ESHRSTVNCVAFHPKFSSIASGSDDSMIKIWDWEL---GELEATLKGHTRSVLGVDYGTA
LIS1_ASPFN       ESHRDKVNCVAFHPTFSSIASGSDDCTIKIWDWEL---GELERTLKGHTRAVRDVDYGGP
LIS1_ASPOR       ESHRDKVNCVAFHPTFSSIASGSDDCTIKIWDWEL---GELERTLKGHTRAVRDVDYGGP
LIS12_CHAGB      ESHQAIVNCLAFHPVFSSLASGSDDSTVKIWDWEL---GELERTLKGHTRAVLDIDFGGP
LIS1_ARTBC       ESHRDTINSVAFHPIFSSVASASDDCTIKIWDWEL---GELERTIKGHTRAVVDVDFGGP
LIS1_TRIVH       ESHRDTINSVAFHPIFSSVASASDDCTIKIWDWEL---GELERTIKGHTRAVVDVDFGGP
LIS1_ARTOC       ESHRDTINSVAFHPIFSSIASGSDDCTIKIWDWEL---GELERTIKGHTRAVVDVDFGGP
LIS1_MAGO7       ESHQNTINCIAFHPVYSSIASGSDDCTIKIWDWEL---GELERTIKSHTRPVLDVDFGGP
LIS12_UNCRE      ESHRDTINSIAFHPIYSSLASCSDDCTIKIWDWEL---GELERTVKGHTRAVLDVDYGGP
LIS1_GIBZE       QSHRTPINCVAFHPIFSSIASGDEDATIKIWDWEF---GELERTVKGHTKAVLDLDYGGP
LIS1_NECH7       QSHRTPINCVAFHPIYSSIASGDEDAIIKIWDWEF---GELERTVKGHTKAVLDLDYGGP
LIS11_CHAGB      QSHRQPITCVAFHPVFSSLASGSEDQTIKIWDWEL---GELERTIKGHTKTVLDVDFGGP
LIS11_PODAN      QSHRNPITCVAFHPVFSSLASGSEDQTIKIWDWEL---GELERTIKGHTKAVLDVDFGGP
LIS11_NEUCR      QSHRDPITCVAFHPVFSSLASGSEDQTIKIWDWEL---GELERTIKGHTKAVLDVDYGGP
LIS11_SORMK      QSHRDPITCVAFHPVFSSLASGSEDQTIKIWDWEL---GELERTIKGHTKAVLDVDYGGP
LIS1_AJEDR       ESHRNPVTSVAFHPVFSSLASGSEDTTIKIWDWEL---GELERTIKGHTRAVVDVDYGGP
LIS1_BLAGS       ESHRNPVTSVAFHPVFSSLASGSEDTTIKIWDWEL---GELERTIKGHTRAVVDVDYGGP
LIS1_PARBP       QSHREPVTCVGFHPVFSSLASGSDDTTIKIWDWEL---GELERTIKGHTKAVLDVDYGGP
LIS1_PARBD       QSHREPVTCVGFHPVFSSLASGSDDTTIKIWDWEL---GELERTIKGHTKAVLDVDYGGP
LIS1_COCP7       QSHRGPVTCVAFHPIFSSLASGSEDTTIKIWDWEL---GELERTIKGHTRAVLDVDYGGP
LIS1_ASPFU       EGHRNPVTCVAFHPVFSSLASGSDDTTIKIWDWEL---GELERTVKGHTKAVLDVDYGGP
LIS1_NEOFI       EGHREPVTCVAFHPVFSSLASGSDDTTIKIWDWEL---GELERTVKGHTKAVLDVDYGGP
LIS1_ASPFC       EGHRNPVTCVAFHPVFSSLASGSDDTTIKIWDWEL---GELERTVKGHTKAVLDVDYGGP
LIS11_ASPCL      ESHRSPVTCVAFHPVFSSLASGSDDTTIKIWDWEL---GELERTVKGHTKAVLDVDYGGP
LIS11_PENRW      ESHRSPVSCLAFHPIFSSLASGSDDTTIKIWDWEL---GELERTIKGHTRAVLDVDYGGP
LIS1_SCLS1       QSHREAITCVAFHPVFSSLASGSEDCTIKIWDWEL---GELELTVKGHTRAVLDVDFGGP
LIS1_PHANO       QSHRSPITCVAFHPVFSSLASGSEDTTIKIWDWEL---GELERTVKGHTKGVLDVDFGGP
LIS1_PYRTR       QSHRSPITCVAFHPVFSSLASGSEDTTIKIWDWEL---GELERTVKGHTKGVLDVDFGGP
LIS12_NEUCR      ESHRLPVTCVAFHPVFTSLASGSEDYTIKIWDWEL---GELERTIKGHTKAVLDVDFGGP
LIS12_SORMK      ESHRLPVTCVAFHPVFTSLASGSEDYTIKIWDWEL---GELERTIKGHTKAVLDVDFGGP
LIS12_PODAN      EGHRLPITSVAFHPVFSSLASASEDNTIKIWDWEL---GELERTLKGHTKAVLDVDFGGP
LIS12_PENRW      ESHRDSINCIAFHPKYSLIASGSGDLTIRIWDWED---STLERTLKGHTMAVCDVDYGDT
LIS1_ASPTN       ESHRDAITSIAFHPVFTSLASGSEDCTIKIWDWEL---GELERTLKGHMRGVSGLDFGGQ
LIS12_TALMQ      ESHRDAITCIAFHPIFTSLASSSEDCTIKIWDWEL---GELERTLKGHIRAVTGLDFGGQ
LIS1_EMENI       TSHRDAVTCVAFHPVFTSLASGSEDCTIKIWDWEL---GEIERTLKGHIRGVSGLDYGGQ
LIS1_ASPNC       ESHRDAVTCVAFHPVFTSLASGSEDCTIKIWDWEL---GELERTLKGHMRPVSDLDFGGQ
LIS11_UNCRE      GSHRGAITCVAFHPVFSSLASGSEDYSIKIWDWEL---GELERTLKGHTRTVTGLDFGGQ
LIS1_TUBMM       TSHRNSINSVAFHPIFSVLASGSDDTTIKIWDWEL---GELERTVKGHTKAVLDLDFGGP
LIS1_PANTR       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_PIG         SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_RAT         SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_FELCA       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_MOUSE       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_PONAB       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSIQDIPFDHS
LIS1_BOVIN       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVEDISFDHS
LIS1_MACFA       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_HUMAN       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_CHICK       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHT
LIS1_XENLA       SGHRSPVTRVIFHPVFSVMVTASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1_XENTR       SGHRSPVTRVIFHPVFSVMVTASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHS
LIS1B_SALSA      SGHRSPVTRVIFHPVFSVMVTSSEDATIKVWDYEA---GDFERTLKGHTDSVQDISFDQT
LIS1_TETNG       SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDLT
LIS1B_DANRE      SGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEA---GDFERTLKGHTDSVQDISFDQT
LIS1A_SALSA      SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYET---GDFERTLKGHTDSVQDISFDHT
LIS1A_DANRE      SGHRSPVTRVIFHPVFSVIVSASEDATIKVWDHET---GDFERTLKGHTDSVQDISFDHT
LIS1_BRAFL       SGHRSPITRVLFHPVYSVMVSASEDATIKIWDYET---GDFERTLKGHTDAVQDVSFDQQ
LIS1_NEMVE       TGHRSPITKVLFHPVYSVMVTSSEDATVKVWDYET---GDFERTLKGHTDAVQDLAFDHT
LIS1_IXOSC       LGHRAPITRVLFHPVYSVVVSASEDASIKVWDYET---GDFERTIKGHTDSVQDIAFDHT
LIS1_DROGR       TGHRASITRVIFHPIFGLMVSASEDATIKIWDFET---GEYERTLKGHTDSVQDVAFDAQ
LIS1_DROWI       TGHRASITRVIFHPIFGLMVSASEDATIKIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROVI       TGHRASITRVIFHPIFGLMVSASEDATIKIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROAN       SGHRASITRVIFHPIFGLVVSASEDATIKIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROPE       TGHRASITRVIFHPIFGLMVSASEDATIKIWDFET---GEYERSLKGHTDSVQDVAFDSQ
LIS1_DROPS       TGHRASITRVIFHPIFGLMVSASEDATIKIWDFET---GEYERSLKGHTDSVQDVAFDSQ
LIS1_DROMO       TGHRASITRVIFHPIFGLMVSASEDATIKIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROER       TGHRASITRVIFHPIFGLMVSASEDATIRIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROYA       TGHRASITRVIFHPIFGLMVSASEDATIRIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROME       TGHRASITRVIFHPIFALMVSASEDATIRIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROSE       TGHRASITRVIFHPIFALMVSASEDATIRIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_DROSI       TGHRASITRVIFHPIFALMVSASEDATIRIWDFET---GEYERSLKGHTDSVQDVAFDAQ
LIS1_GLOMM       SGHRASITRVIFHPTYSLMLSASEDAVIKIWDFET---GEYERSLKGHTSSVQDIAFDSQ
LIS1_AEDAE       AGHRATVTRVVFHPVFSMMASASEDATIKIWDFET---GEYERTLKGHTDSVQDLAFDSH
LIS1_TRIAD       SGHRSPITCVVFHPVYNVMVSSSEDASMKIWDYES---GDFERTLRGHTDSVQDLAFDSS
LIS1_CAEBR       IGHRLPVTRVIFHPLWTIMASCSEDATIKVWDYET---GQLEKTLKGHTDAVNDIAIDAA
LIS1_CAEEL       TGHRLPITRVIFHPLWTIMASCSEDATIKVWDYET---GQLERTLKGHTDAVNDIAIDAA
LIS1_SCHMA       TGHRSPITRVLFHPHYNVFVSASEDASIKVWDYET---GEFEHTLKGHTDSVQDVAFDPS
LIS1_DICDI       TGHRNCINSVKFHPSFSLMVSASEDATIKVWDFES---GEFERTLKGHTNAVQDIDFDKT
LIS1_POLPP       TGHRNCINAVRFHPLFSVIVSASEDATMRIWDFDS---GDFERTLKGHTNAVQDIDFDKS
LIS1_MONBE       DGHRLPITAVAIHPSFAVMASASEDASIKLWDMES---GNFERSLKGHTNAVNDIAYDRE
LIS11_PARTE      EGHRAGVNCVAFHPQYQILGSASDDGSIKLWDYES---GHFEKTLKGHTSNVNCLAFDPT
LIS12_PARTE      EGHRAGVNCVAFHPQYQILGSASDDGSIKLWDYES---GHFEKTLKGHTSNVNCLAFDPT
LIS1_PHATC       QGHSSVVTCVRVHPVFTVVVSGSEDGSVKVWDHES---GEYIRTLKGHTNTVNGLAFTPT
LIS11_POSPM      TSHRAPITRVAFHPTFSLLASASEDTTVKIWDWET---GSFERTLKGHTREVWGVDFDSK
LIS12_POSPM      TSHRAPITRVAFHPTFSLLASASEDTTVKIWDWET---GSFERTLKGHTREVWGVDFDSK
LIS1_COPC7       TGHRAPLTSIAFHPQYSILASASEDTTVKIWDWET---GEFERTLKGHTKPVNDLDFDHK
LIS1_CRYNJ       ASHRAPVTRLAFHPTWTLLASASEDATVKLWDWEA---GDMERTLKGHTKAVMDVDFDPR
LIS1_USTMA       QGHRLPVTKVSFHPVFSQIASASEDTTVKLWDWET---GDFERTLKGHTKAVQDVDFDSK
LIS1_YARLI       LLHKQPVNAVSFHPFHSTLASACEDGNIRIWDYEL---GEIETTIKAHTRGVLDVDFSQP
LIS1_CANAW       QCE-NIVTTVKLHPNLPLVLNGCNDGNLYIWNISNDDNTIPEKMIKAHTRAINKICFTYK
LIS1_CANAL       QCE-NIVTTVKLHPNLPLVLNGCNDGNLYIWNISNDDNTIPEKMIKAHTRAINKICFTYK
LIS1_CANDC       QCE-NIVTTVKLHPNLPLVLNGCNDGNLYIWNISNDDNTIPEKMIKAHTRAINKICFTYK
LIS1_CANTT       QCE-NVVATVRLHPNLPLVFNGCNDGNLYIWNLTNDDNTIPEKRIKAHTRSINKMCFSYR
LIS1_DEBHA       QSH-QLVQSVSIHPALPIILGGCSDGSLIIWNLVNDESLIPEKIIKAHIRGVNTIAWSKK
LIS1_PICST       QQN-QLVMASVIHPVLPVIFGGCSDGSIIVWNIVNDDTSIPEKIIRAHTRSINKLAFSVE
LIS1_PICGU       QTH-QSVNTVAVHPYLPLIMAGCSDGTLSVWNIANDDPSIPEKSIRAHSRAVNRIRWSNS
LIS1_ASHGO       DVG-ASVTDIKLHPSLPIAFLATDQGKVVAYDLFN--RSMPLHSTQAHMKGVTSLAV-ME
LIS1_KLULA       TLD-ASITALCLHPSLPIIFIGLDSGKLLRYDILN--VELPLQSTMAHMDGITSISISLP
LIS1_LACTC       SAG-ASVTSVKLHPELPLVFIATDAGKLQCYDLMN--YTMPVASVQAHMRGITAIDAYVG
LIS1_YEAST       NVE-SSVTSVKLHPNLPIVFVATDHGKLYAFDLFN--YTIPLASLQSHTKAITSMDVLFT
LIS1_YEAS7       NVE-SSVTSVKLHPNLPIVFVATDHGKLYAFDLFN--YTIPLASLQSHTKAITSMDVLFT
LIS1_YEAS8       NVE-SSVTSVKLHPNLPIVFVATDHGKLYAFDLFN--YTIPLASLQSHTKAITSMDVLFT
LIS1_YEAS1       NVE-SSVTSVKLHPNLPIVFVATDHGKLYAFDLFN--YTIPLASLQSHTKAITSMDVLFT
LIS1_YEAS2       NVE-SSVTSVKLHPNLPIVFVATDHGKLYAFDLFN--YTIPLASLQSHTKAITSMDVLFT
LIS1_CANGA       QNE-SPVTAIKLHPSLAIVYVGTDTGRLIAYDILN--YTIPLAVTTAHSKAITSIEVIEA
LIS1_ZYGRC       TLE-SPVTGVRLHPELAVVFVSTEQGRLHCFDLMD--ITLPLASIQAHTRAITSVDVFCW
LIS1_KOMPG       MHNGHPVTAIDIHPFQPIMATASQDGTIVIWNLLNL-TEPQQIIRNAHTRSINTIKFMNQ
                       :    .**             :  ::              .*   :  :     

LIS1_AJECG       QG--------------------ITMLASCSSDLSVKLWDPAE---GYKNVRTLLGHDHSV
LIS1_AJECH       QG--------------------ITMLASCSSDLSVKLWDPAE---GYKNVRTLLGHDHSV
LIS12_ASPCL      PGAV------------------GVLLASCSSDLTIKLWDPAD---GYKNIRTLQGHDHIV
LIS11_TALMQ      QS--------------------GVLLASCSSDLSIKIWNPLE---DYKNIRTLLGHEHSV
LIS1_TALSN       QS--------------------GVLLASCSSDLSIKIWNPSD---DYKNIRTLLGHEHSV
LIS1_ASPFN       RD--------------------NVLLASCSSDLSIKLWKPTD---NYKNIRTLQGHDHIV
LIS1_ASPOR       RD--------------------NVLLASCSSDLSIKLWKPTD---NYKNIRTLQGHDHIV
LIS12_CHAGB      RG--------------------AILLASCSSDSTIKLWDPAD---EYKNTRTLTGHDHSV
LIS1_ARTBC       RG--------------------GILLASCSSDLSIKLWDPSN---EYKNIRTLVGHDHSV
LIS1_TRIVH       RG--------------------GILLASCSSDLSIKLWDPSN---EYKNIRTLVGHDHSV
LIS1_ARTOC       RG--------------------GILLASCSSDLSIKLWDPAN---EYKNIRTLLGHDHSV
LIS1_MAGO7       RG--------------------GILLASCSSDLTIKLWDPSD---DYKNIRTLPGHDHSV
LIS12_UNCRE      RS--------------------SILLASCSSDLSIKLWDPAD---EYKNIRTLLGHDHSV
LIS1_GIBZE       KG--------------------HTLLASCSSDLTIKLWDPAN---EYQNIRTLPGHDHSV
LIS1_NECH7       KG--------------------HTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHSV
LIS11_CHAGB      RG--------------------NTLLASCSSDLTIKLWDPSD---DYKNIRTLPGHDHSV
LIS11_PODAN      RG--------------------NTLLASCSSDLTIKLWDPSD---DYKNIRTLPGHDHSV
LIS11_NEUCR      RG--------------------NTLLASCSSDLTIKLWDPLD---SYKNIRTLPGHDHSV
LIS11_SORMK      RG--------------------NTLLASCSSDLTIKLWDPLD---SYKNIRTLPGHDHSV
LIS1_AJEDR       HG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHSV
LIS1_BLAGS       HG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHSV
LIS1_PARBP       RG--------------------GTLLASCSSDLTIKLWDPSD---GYKNIRTLPGHDHSV
LIS1_PARBD       RG--------------------GTLLASCSSDLTIKLWDPSD---GYKNIRTLPGHDHSV
LIS1_COCP7       RG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHSV
LIS1_ASPFU       RG--------------------GTLLASCSSDLTIKLWDPSD---NYKNIRTLPGHDHSV
LIS1_NEOFI       RG--------------------GTLLASCSSDLTIKLWDPSD---NYKNIRTLPGHDHSV
LIS1_ASPFC       RG--------------------GTLLASCSSDLTIKLWDPSD---NYKNIRTLPGHDHSV
LIS11_ASPCL      RG--------------------GTLLASCSSDLTIKLWDPSD---DYKNIRTLPGHDHSV
LIS11_PENRW      RG--------------------GTLLASCSSDLTIKLWDPAD---EYKNIRTLPGHDHSV
LIS1_SCLS1       RG--------------------GTLLASCSSDLTIKLWDPSD---QYKNIRTLPGHDHSV
LIS1_PHANO       RG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHSV
LIS1_PYRTR       RG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHSV
LIS12_NEUCR      RG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHIV
LIS12_SORMK      RG--------------------GTLLASCSSDLTIKLWDPSD---EYKNIRTLPGHDHIV
LIS12_PODAN      RG--------------------NTLLASCSSDMSIKLWDPAD---QYKNIRTLHGHDHIV
LIS12_PENRW      SS--------------------GILLASCSSDFTIKLWDTTD---DYKNVKTLRGHDHIV
LIS1_ASPTN       KG--------------------HTLLASCSGDLTIKLWDPSK---DYANIRTLHGHDHSV
LIS12_TALMQ      KG--------------------NTLLASCSSDLTVKLWDPSK---GYANIRTLSGHDHSV
LIS1_EMENI       KG--------------------NTLLASCSSDLTIKLWDPSK---DYANIRTLSGHDHSV
LIS1_ASPNC       KG--------------------HTILASCSSDLQIKLWDPNK---DYANVRTLSGHDHSV
LIS11_UNCRE      KG--------------------RTLLASCSNDLTIKLWDPSN---DYANIRTLFGHDHSV
LIS1_TUBMM       KA--------------------GVLLVSCSSDLTIKLWDPNN---EYKNIRTLTGHDHSV
LIS1_PANTR       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_PIG         GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_RAT         GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_FELCA       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_MOUSE       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_PONAB       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_BOVIN       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_MACFA       GK----------------------LLTSCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_HUMAN       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_CHICK       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_XENLA       GK----------------------LLASCSADMTIKLWDFQ----GFECLRTMHGHDHNV
LIS1_XENTR       GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1B_SALSA      GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_TETNG       GK----------------------LLASCSADMTIKLWDFQ----SFECIRTMHGHDHNV
LIS1B_DANRE      GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1A_SALSA      GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1A_DANRE      GK----------------------LLASCSADMTIKLWDFQ----GFECIRTMHGHDHNV
LIS1_BRAFL       GK----------------------LLASCSADMTIKLWDFQ----TFENIKTMHGHDHNV
LIS1_NEMVE       GK----------------------FLASSSADMTIKLWDFQ----GFECIRTLHGHDHNV
LIS1_IXOSC       GQ----------------------FLASCSADMTIKLWDFK----SYECLRTMHGHDHNV
LIS1_DROGR       GK----------------------LLVSCSADLSIKLWDFQQ---SYECVKTMHGHDHNV
LIS1_DROWI       GK----------------------LLVSCSADLSIKLWDFQQ---SYACVKTMHGHDHNV
LIS1_DROVI       GK----------------------LLASCSADLSIKLWDFQQ---SYECVKTMHGHDHNV
LIS1_DROAN       GK----------------------LLASCSADLSIKLWDFQQ---TYECVKTMHGHDHNV
LIS1_DROPE       GK----------------------LLASCSADLSIKLWDFQQ---SYECVKTMHGHDHNV
LIS1_DROPS       GK----------------------LLASCSADLSIKLWDFQQ---SYECVKTMHGHDHNV
LIS1_DROMO       GK----------------------LLASCSADLSIKLWDFQQ---SYECVKTMHGHDHNV
LIS1_DROER       GK----------------------LLASCSADLSIKLWDFQQ---SYECIKTMHGHDHNV
LIS1_DROYA       GK----------------------LLASCSADLSIKLWDFQQ---SYECIKTMHGHDHNV
LIS1_DROME       GK----------------------LLASCSADLSIKLWDFQQ---SYECIKTMHGHDHNV
LIS1_DROSE       GK----------------------LLASCSADLSIKLWDFQQ---SYECIKTMHGHDHNV
LIS1_DROSI       GK----------------------LLASCSADLSIKLWDFQQ---SYECIKTMHGHDHNV
LIS1_GLOMM       GK----------------------LLASCSADLSIKLWDFQQ---SYDCVKTMLGHDHNV
LIS1_AEDAE       GK----------------------LLASCSSDLSIKLWDFQQ---TFECVKTMHGHDHNV
LIS1_TRIAD       GK----------------------LLASSSADMTVKIWDFQ----TFECRMTLRGHDHNV
LIS1_CAEBR       GK----------------------QLVSCSTDLTIKLWDFGQ---SYDCLKSLKGHEHTV
LIS1_CAEEL       GK----------------------QLVSCSSDLSIKLWDFGQ---TYDCLKSLKGHEHTV
LIS1_SCHMA       GK----------------------FLASCSADMQVKLWDFT----IYQCIKTLTGHDHNV
LIS1_DICDI       GN----------------------LLASCSADLTIKLWDFQ----TYDCVKTLHGHDHNV
LIS1_POLPP       GN----------------------LLASCSADLTIKLWDFQ----SFDCIKTLHGHDHNV
LIS1_MONBE       GN----------------------RLVSCSTDMTIKVWNMD----NFTCTKTLSGHDHTV
LIS11_PARTE      GK----------------------YICSASSDLSIKIWELK----NHTCVKTLIGHEHSV
LIS12_PARTE      GK----------------------YICSASSDLSIKLWELK----NHTCVKTLIGHEHSV
LIS1_PHATC       GS----------------------HLASCSTDLSIKLWDFQ----TYACIKTLRGHDHTI
LIS11_POSPM      GS----------------------FLATCSSDLSIKVWDTQQWDNAGYSGKTLRGHEHTV
LIS12_POSPM      GS----------------------FLATCSSDLSIKVWDTQQWDNAGYSGKTLRGHEHTV
LIS1_COPC7       GH----------------------LLVTCSSDLFIKIWDSQ---NEWKNTKTFVGHDHAV
LIS1_CRYNJ       GG----------------------LMATCSSDLTLKLWDTA---NQYTNVKTLHGHDHSV
LIS1_USTMA       GN----------------------YVLSCSSDLSIKVWDAN---NDYKNIKTLQGHDHSV
LIS1_YARLI       DTGASRDKSHDKPRADVSHAQPRALLVSCSSDLTIRIWDPQN---EYANVKTLTGHDHTI
LIS1_CANAW       ---------------------KPYYLATCSSDLTIKIWD-EKFNH----IRTLNGHEHTV
LIS1_CANAL       ---------------------KPYYLATCSSDLTIKIWD-EKFNH----IRTLNGHEHTV
LIS1_CANDC       ---------------------KPYYLATCSSDLTIKIWD-EKFNH----IRTLNGHEHTV
LIS1_CANTT       ---------------------KPYYLATCSSDLTIKIWD-EKFNH----IRTLNGHEHTV
LIS1_DEBHA       PVDLSG--------KGSEAKGIAHVMATCSSDLSIKIWDGATFKH----IRTLTGHEHTI
LIS1_PICST       PADLS----------KDLTKSKTYIFASCSADLSIKIWDSSSYRH----IRTLTGHDHTV
LIS1_PICGU       PVELS---------VKAGASNKSYIFASCSSDLSIKIWDGNSNSQ----IRILTGHDHTV
LIS1_ASHGO       AENG------------------SLLISTTSKDLQCKIW-SFTDNAAFQLLRTLSSHEHIV
LIS1_KLULA       NENGR-----------------PAYLATTSKDLNTKIW-ELELDSTLSHIKTLAGHEHTV
LIS1_LACTC       EDSQ-------------------CLVATASKDLHCKVF-RFV-DSELQLIRTLSGHEHIV
LIS1_YEAST       NYTNS-------------SKKNYLVIVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIV
LIS1_YEAS7       NYTNS-------------SKKNYLVIVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIV
LIS1_YEAS8       NFTNS-------------SKKNYLVVVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIV
LIS1_YEAS1       NFTNS-------------SKKNYLVVVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIV
LIS1_YEAS2       NFTNS-------------SKKNYLVVVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIV
LIS1_CANGA       HNFEE-------------FIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTV
LIS1_ZYGRC       QQT--------------------TYVVTGSKDMQVRVFTWSAGQG-LKLLRSFAGHEHVV
LIS1_KOMPG       EVMDGHSTK-----------KNRLLLATGSSDLLIKIWDIED-SANLKALRTLTGHENII
                                          . : * *   .::              : .*:  :

LIS1_AJECG       SAVRFIPCR---------NLLASASRDKDVRIWDVTTGYCVRSIQG-HTGWVRDVCPSFD
LIS1_AJECH       SAVRFIPCR---------NLLASASRDKDVRIWDVTTGYCVRSIQG-HTGWVRDVCPSFD
LIS12_ASPCL      SAVRFIPNG---------SLLASASRDMDVRLWDVTNGYCVKTIQG-HTGWVRDVCASLD
LIS11_TALMQ      SAVRFIPGR---------NLLTSASRDKDLRIWDVTTGFCVKTIQG-HSGWVRDVCPSFD
LIS1_TALSN       SAVRFIPGR---------NLLVSASRDKDLRIWDVTTGFCVKTIQG-HSGWVRDVCPSFD
LIS1_ASPFN       SAVRFIPSR---------NLLVSASRDNDMRIWDVTTGYCVKTING-HTDWVRDVSISFD
LIS1_ASPOR       SAVRFIPSR---------NLLVSASRDNDMRIWDVTTGYCVKTING-HTDWVRDVSISFD
LIS12_CHAGB      SAVRFVTSRPR-----SENLLVSASGDKTLKVWDITAGYCIKTLQG-HTGWVRDVVPSLD
LIS1_ARTBC       SAVRFIPLGASGAP-SSGNLLASASRDKSLKIWDANTGYCLRTLQG-HTAWVRDVFPSPD
LIS1_TRIVH       SAVRFIPLGASGAP-SSGNLLASASRDKSLKIWDANTGYCLRTLQG-HTAWVRDVFPSPD
LIS1_ARTOC       SAVRFIPLGASGAP-SSGNLLVSASRDKSLKIWDVNTGYCVRTLQG-HTAWVRDVYPSPD
LIS1_MAGO7       SAIRFMPSGASGAA-MSGNLLVSASRDMTLKIWDVSTGFCLKTIRG-HTAWIRDVYPSLD
LIS12_UNCRE      GAVRFIPSGASGTL-SSGNLLVSASRDGTLRIWDVVTGYCVKTLRG-HTAWVRDVCPSFD
LIS1_GIBZE       SAVRFIPSGAPGAP-LSGNLLASASRDVTVRIWDVTTGYCVKTIRG-HADWIRDVSPSLD
LIS1_NECH7       SAVRFIPSGAPGAP-LSGNLLASASRDVTVRIWDVTTGYCLKTIRG-HSDWIRDVSPSLD
LIS11_CHAGB      SAVRFIPSGVAG---GAGNLLVSASRDKTLRIWDVSTGYCVKTLRG-HAEWVRDVCPSVD
LIS11_PODAN      SAVRFIPSGVAG---GTGNLLVSASRDKTLRIWDVSTGYCVKTLRG-HAEWVRDVCPSID
LIS11_NEUCR      SAVRFIP--------GSGNLLVSASRDKTLRIWDVSTGYCVKTLRG-HAEWVRDVCPSLD
LIS11_SORMK      SAVRFIP--------GSGNLLVSASRDKTLRIWDVSTGYCVKTLRG-HAEWVRDVCPSFD
LIS1_AJEDR       SAVRFIPSGAAGSP-LSGNLLVSASRDKTLRIWDVTTGYCVRTLHG-HVEWVRDVVPSPD
LIS1_BLAGS       SAVRFIPSGAAGSP-LSGNLLVSASRDKTLRIWDVTTGYCVRTLHG-HVEWVRDVVPSPD
LIS1_PARBP       SAVRFIPSGAAGSP-LSGNLLVSASRDKTLRIWDVTTGYCVKTLRG-HVDWVRDVVASPD
LIS1_PARBD       SAVRFIPSGAAGSP-LSGNLLVSASRDKTLRIWDVTTGYCVKTLRG-HVDWVRDVAASPD
LIS1_COCP7       SAVRFIPSGAAGSP-MSGNLLASASRDKTIRIWDVTTGYCVKTIQG-HLDWVRDVFPSPD
LIS1_ASPFU       SSVRFIPSGAAGSP-MSGNLLVSASRDKTLRIWDVTTGYCVKTLSG-HVDWVRAVAPSID
LIS1_NEOFI       SSVRFIPSGAAGSP-MSGNLLVSASRDKTLRIWDVTTGYCVKTLSG-HVDWVRAVAPSLD
LIS1_ASPFC       SSVRFIPSGAAGSP-MSGNLLVSASRDKTLRIWDVTTGYCVKTLSG-HVDWVRAVAPSID
LIS11_ASPCL      SSVRFIPSGAAGSP-MSGNLLVSASRDKTLRIWDVTTGYCVKTLSG-HVDWVRAVAPSID
LIS11_PENRW      SAVRFIPSGAAGSP-MSGNLLVSASRDLTLRIWDVTTGYCVKSMQG-HGDWIRDVTPSPD
LIS1_SCLS1       SAVRFIPSGAAGSP-SSGNLLVSASRDKTLRIWDVSTGYCVKTVRG-HADWVRDVAPSYD
LIS1_PHANO       SAIRFVPSGAAGSP-SSGNLLVSASRDKTLRVWDVTTGYCVKTIRG-HADWVRDVSPSFD
LIS1_PYRTR       SAIRFVPSGAAGSP-SSGNLLVSASRDKTLRIWDVTTGYCVKTIRG-HADWVRDVAPSFD
LIS12_NEUCR      SSVRFIPSGAAGAP-ASGNLLVSASKDNSLKIWDVTTGYCVKTILG-HVDWPRAVCPSHD
LIS12_SORMK      SSVRFIPSGAAGAP-ASGNLLVSASKDNSLKIWDVTTGYCVKTILG-HVDWPRAVCPSHD
LIS12_PODAN      SSVRFVPANGT-AG-AGGNLLVSASKDNTLKLWDVTTGYCVKTIEG-HNDWPRAVAPSAD
LIS12_PENRW      SAVRFIPSG---------NLLASASRDMKVILWNVINGYRVKTIED-HTGWVRDISPSFD
LIS1_ASPTN       SAVRFLTST--------ENLLVSASRDASIRIWDVSTGYCVRTITS-NSIWFLDVSPSFD
LIS12_TALMQ      SAVRFLTST--------ENLLVSAGRDASIRIWDVSTGYCVKVLRS-SDAWIRDISSSFD
LIS1_EMENI       SSVRFLTSN--------DNHLISASRDGTLRIWDVSTGFCVKVIKSATESWIRDVSPSFD
LIS1_ASPNC       SAVRFLRQT--------DNILISASRDATIRIWDVSTGYCVKVIDS-QGSWINDVSPSFD
LIS11_UNCRE      SSVRFLIPG--------GNILISASRDTTLRMWDTSTGFCVKTIHT-QGDWVRDVFPSFD
LIS1_TUBMM       SAVRFIPSAA-------GEYLVSASRDKTLRVWEVATGYCVKTISG-HSDWIRDVEPSHD
LIS1_PANTR       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_PIG         SSVAIMPNG---------DHIVSAARDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_RAT         SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_FELCA       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_MOUSE       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_PONAB       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_BOVIN       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_MACFA       SSVAIMPNG---------DHLVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_HUMAN       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_CHICK       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_XENLA       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1_XENTR       SSVAIMPNG---------DHIVSASRDKTIKMWEVQTGYCVKTFTG-HREWVRMVRPNQD
LIS1B_SALSA      SSVAIMPNG---------DHIVSASRDKTIKMWEVATGYCVKTFTG-HREWVRMVRPNQD
LIS1_TETNG       SSVAIMPNG---------DHIISASRDKTMKMWEVATGYCVKTFTG-HREWVRMVRPNQD
LIS1B_DANRE      SSVAIMPNG---------DHIVSASRDKTMKMWEVATGYCVKTFTG-HREWVRMVRPNQD
LIS1A_SALSA      SSVAIMPNG---------DHIVSASRDKTIKMWEVATGYCVKTFTG-HREWVRMVRPNQD
LIS1A_DANRE      SSVAIMPNG---------DHIVSASRDKTIKMWEVATGYCVKTFTG-HREWVRMVRPNQD
LIS1_BRAFL       SSVHFMPNG---------DFLISASRDKTIKMWELATGYCVKTFTG-HREWVRTVRVNQD
LIS1_NEMVE       SSISFLPSG---------DHLVSASRDKTIKMWEIATGYCVKTFQG-HGEWVRRVRPNAD
LIS1_IXOSC       SSVCFLPSG---------DHVVSCSRDKSIKMWEVATGYCVRTFTG-HRDWVRMVRVNSD
LIS1_DROGR       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROWI       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROVI       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROAN       SSVAFVPAG---------DYVLSASRDRTVKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROPE       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROPS       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROMO       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROER       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROYA       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROME       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROSE       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_DROSI       SSVAFVPAG---------DYVLSASRDRTIKMWEVATGYCVKTYTG-HREWVRMVRVHIE
LIS1_GLOMM       SSVAFVPAG---------DYVLSASRDQTIKMWEVATGYCVKTYSG-HREWIRMVRVHMD
LIS1_AEDAE       SSVSFVPAG---------DYLLSASRDKTIKMWEVATGYCVKTFTG-HREWVRMVRVNVD
LIS1_TRIAD       SSVCFLPSG---------DFLLSSSRDKTIKMWEVATGYCVYNFEG-HREWVRRVAVASD
LIS1_CAEBR       SSVTFLPTG---------DFVLSASRDHTIKQWDISTGYCVFTFRG-HNDWVRMIRISHD
LIS1_CAEEL       SSVTFLPTG---------DFVLSASRDHTIKQWDISTGYCVYTFRG-HNDWVRMIRISND
LIS1_SCHMA       SSVAFLPSG---------DFLVSASRDKTIKMWEVSTGYCTKTFIG-HTEWIRSVRPSPE
LIS1_DICDI       SCVRFTPSG---------DQLISSSRDKTIKVWEAATGYCIKTLVG-HEDWVRKITVSED
LIS1_POLPP       SCVRFLPSG---------DQLVSSSRDKSIKVWETATGYCTKTLTG-HEDWVRKVIVSED
LIS1_MONBE       SSVRFDHTG---------DRVFSASRDKTIKIWELATGYCLQTLQG-HSDWVRSIDVSAD
LIS11_PARTE      STVQFSDHG---------DFILSASRDKNIKLWEVATGFCKKTFSE-HQEWVRCAVFSND
LIS12_PARTE      STVQFSDHG---------DFILSASRDKSIKLWEVQTGFCKKTFSE-HQEWVRCAVFSND
LIS1_PHATC       SSVVFLPFGGDLLTTTKCKRLLSASRDCTVKVWDLETGFCDQTIHD-HNDWVRTLATRAD
LIS11_POSPM      STVKFLPGD---------DLIASASRDKTIRIWEVATTFCIRMITG-HEDWVRMTVPSTD
LIS12_POSPM      STVKFLPGD---------DLIASASRDKTIRIWEVATTFCIRTITG-HEDWVRMTVPSTD
LIS1_COPC7       SAVRFMPGD---------QLIVSASRDRTIRVFDVASTHQVRTLSG-HSEWVRCVIPSAD
LIS1_CRYNJ       SSVRFMPDG---------ETLVSASRDKTIRVWQVSSGYCIKTFSG-HAEWVREAVPSED
LIS1_USTMA       SSVRFLPGD---------DYIVSASRDKTIKIWEFSTGFCTKTLQG-HAEWVRSAIPSDD
LIS1_YARLI       SAVKFTASG---------NHVISASRDKTVRVWSVQSGYCVRTVHG-HTDWVKSCA-ALN
LIS1_CANAW       SSIQFSPV--------DNSILYSVSRDKNIRVWDIFQGISLKSFVG-HSEWCRDLDIISS
LIS1_CANAL       SSIQFSPV--------DNSILYSVSRDKNIRVWDIFQGISLKSFVG-HSEWCRDLDIISS
LIS1_CANDC       SSIQFSPI--------DNSILYSVSRDKNIRVWDIFQGISLKSFVG-HSEWCRDLDIVSS
LIS1_CANTT       SSVKFSPS--------DSNILYSVSRDKNIRVWDISQGVCLKSFVG-HSEWCRDLDAVAS
LIS1_DEBHA       SSIVFSAS--------KPNILYSVSRDKSVKVWDLVNGYCIKTFIG-HSDWVRDIDVISV
LIS1_PICST       SSVAFSQS--------NPDHLYSVSRDKTVKIWDLVNGYCVKSFTG-HSEWVRDIDVASV
LIS1_PICGU       SSIAFSPS--------KPSILYSVSRDKTTKIWDSTNGYCTRTFIG-HSDWVRDLDVIAA
LIS1_ASHGO       SQSCFLRS-------GSDLLLATCSRDLTVKVWDTKSGWCIKSFQP-HNQWVRTLELH--
LIS1_KLULA       SDCQFFER-------GADLLLATCSRDLYLKIWDISNGWCIKSFQP-HTQWIRSLHVH--
LIS1_LACTC       SHIKIWNN-------STNTLVASCSRDLTCKVWDIANGWCLKSFQP-HTEWVRCLDVM--
LIS1_YEAST       SAVKIWQK-------NNDVHIASCSRDQTVKIWDFHNGWSLKTFQP-HSQWVRSIDVL--
LIS1_YEAS7       SAVKIWQK-------NNDVHIASCSRDQTVKIWDFHNGWSLKTFQP-HSQWVRSIDVL--
LIS1_YEAS8       SAVKIWQK-------NNDVHIASCSRDQTVKIWDFHNGWSLKTFQP-HSQWVRSIDVL--
LIS1_YEAS1       SAVKIWQK-------NNDVHIASCSRDQTVKIWDFHNGWSLKTFQP-HSQWVRSIDVL--
LIS1_YEAS2       SAVKIWQK-------NNDVHIASCSRDQTVKIWDFHNGWSLKTFQP-HSQWVRSIDVL--
LIS1_CANGA       SSQKTWQK-------DNDVLLASSSRDATVKVWRVNDSRCLQSFSP-HSEWVKSIDVL--
LIS1_ZYGRC       SGVRIWVGPRTTNIGGGSLLLASCSRDTSVKIWDVNSGWCLKSFQP-HSDWVRCLDVY--
LIS1_KOMPG       SCLCFHPTE--------PSKLVSCSKDKTTKVWDTRTGSIVLSFVG-HSNWVRSVDINRT
                 .                   : : . *     :                 *         

LIS1_AJECG       ---------------GNFLFSSGDDMTARLWDISAIPNPENKVTMAGHEHFIECCALAPP
LIS1_AJECH       ---------------GNFLFSSGDDMTARLWDISAIPNPENKVTMAGHEHFIECCALAPP
LIS12_ASPCL      ---------------GRFILSTGDDMTVRLWDISAK--PENKLTMVGHENFNECCAIAPP
LIS11_TALMQ      ---------------GNYLFSAGDDVTARLWDITNISNPEAKLTMVGHDHVIECCAVAPQ
LIS1_TALSN       ---------------GNYLLSAGDDITARLWDITNISNPEAKLTMVGHDHVIECCAVAPQ
LIS1_ASPFN       ---------------GRFLFSTGQDMTARLWDISTVSNIEHKRTMLGHENFIECCAFAPP
LIS1_ASPOR       ---------------GRFLFSTGQDMTARLWDISTVSNIEHKRTMLGHENFIECCAFAPP
LIS12_CHAGB      ---------------GRFLLSSGTDQTARLWDISAAD-PESKLVMVGHENGIRCCAFAPP
LIS1_ARTBC       ---------------GRFLLSTGDDSTARLWDISVS-NPETKVTMFGHDHFNECCAIAPS
LIS1_TRIVH       ---------------GRFLLSTGDDSTARLWDISVS-NPETKVTMFGHDHFNECCAIAPS
LIS1_ARTOC       ---------------GRFLLSTGDDSTARLWDISVS-NPESKVTMFGHDHFNECCALAPS
LIS1_MAGO7       ---------------GRYLLSTGDDSTVRLWDLSVT-NPENRLTMIGHDHYIECCALAPP
LIS12_UNCRE      ---------------GRFLLSAGDDMTTRLWNISGS-NSDHKLTMLGHEHVIECCALAPF
LIS1_GIBZE       ---------------GKYLLSTGNDRTVRLWDISVP-NPEAKLVMIGHEHFVECCTFAPP
LIS1_NECH7       ---------------GKYLLSTGNDRTLRLWDISMN-TPETKMVMIGHEHCVECCAFAPP
LIS11_CHAGB      ---------------GRFILSTSDDYTSRLWDVSIA-NPEPKTTLIGHEHVVLCCAIAPS
LIS11_PODAN      ---------------GRFILSTSDDYTGRLWDVSIP-NPEPKTTLIGHEHVVLCCAIAPA
LIS11_NEUCR      ---------------GKYILSTSDDYTSRLWDVTIT-NPEPKVTLIGHEHVVLCCAIAPP
LIS11_SORMK      ---------------GKYILSTSDDYTSRLWDVTVT-NPEPRVTLIGHEHVVLCCAIAPP
LIS1_AJEDR       ---------------GRFLFSAGDDRVARLWDVS---SGETKSTFLGHEHFIECVALAPP
LIS1_BLAGS       ---------------GRFLFSAGDDRVARLWDVS---SGETKSTFLGHEHFIECVALAPP
LIS1_PARBP       ---------------GRFLFSAGNDQVARLWDVS---SGETKSTFLGHEHAVECVAFAPP
LIS1_PARBD       ---------------GRFLFSAGNDQVARLWDVS---SGETKSTFLGHEHAVECVAFAPP
LIS1_COCP7       ---------------GRFLMSGGDDRVPRLLDAS---SGETKSTFIGHEHVVECVTIAPA
LIS1_ASPFU       ---------------GRFLLAAGDDRIPRLWDLS---SAETKSTFLGHEHVIECVAIAPA
LIS1_NEOFI       ---------------GRFLFAAGDDRIPRLWDLS---SAETKSTFLGHEHVIECVAIAPA
LIS1_ASPFC       ---------------GRFLLAAGDDRIPRLWDLS---SAETKSTFLGHEHVIECVAIAPA
LIS11_ASPCL      ---------------GRFLFAAGDDRIPRLWDLS---AAETRSTFLGHEHVIECVAIAPA
LIS11_PENRW      ---------------GRFLFSGGDDRVARLWDIS---SGDTKSTFLGHEHYIECVAFAPP
LIS1_SCLS1       ---------------GRWLLSAGVDQTARIWDAS---SGEPKATLLGHENTIECCVFAPP
LIS1_PHANO       ---------------GRWLLSAGNDQTARLWDAS---SGEAKCTFLGHEHVIECVTIAPP
LIS1_PYRTR       ---------------GRWLLSAGNDQTARLWDAS---SGEPKCTFIGHEHVVECVTIAPP
LIS12_NEUCR      ---------------GRYLLSTGSDKSVRLWDLAGGRDAECRLVMFGHENYNLCCAFAPP
LIS12_SORMK      ---------------GRYLLSTGSDKSVRLWDLAGGRDAECRLVMFGHENYNLCCAFAPP
LIS12_PODAN      ---------------GRWLLSTGSDKAARLWDI-GGTEPECRVVMFGHENFNLCCEFAPS
LIS12_PENRW      ---------------GQFLLSTGDDMTVRLWEISAS-QPICKFTATGHENRILCCAVAPA
LIS1_ASPTN       ---------------GKWLVAGGRDQAVTVWEVS---SAEPRAALLGHDNDVQCCVFAPP
LIS12_TALMQ      ---------------GKWLVAGGRDQAVTVWEVA---TAEQKSALLGHENYIECCVIAPP
LIS1_EMENI       ---------------GKWLVSGGRDQAITVWEVS---SAEPKAALLGHENFIECCVFAPP
LIS1_ASPNC       ---------------GKWLVTGGRDQAAMVWEVA---SAKSVASLIGHENFIECCVFAPP
LIS11_UNCRE      ---------------GKWLVSGGRDQAATIWEVS---SGEARASLLGHENYIECCTFAPP
LIS1_TUBMM       ---------------GRWLLSAGGDQTTRLWDAS---TAEHKATFLGHEHVVNCCVFAPP
LIS1_PANTR       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_PIG         ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_RAT         ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_FELCA       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_MOUSE       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_PONAB       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_BOVIN       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_MACFA       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_HUMAN       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_CHICK       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_XENLA       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_XENTR       ---------------GTLIASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1B_SALSA      ---------------GSLIASCSNDQTVRVWVAT---SKECKAELREHEHVVECIAWAPD
LIS1_TETNG       ---------------GTLIASCSNDQTVRVWVVA---SKECKAELREHEHVVECISWAPE
LIS1B_DANRE      ---------------GTLLASCSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1A_SALSA      ---------------GTLIASCSNDQTVRVWVVA---SKECKAELREHEHVVECISWAPE
LIS1A_DANRE      ---------------GTLIASSSNDQTVRVWVVA---TKECKAELREHEHVVECISWAPE
LIS1_BRAFL       ---------------GSLLASCSNDQTVRVWVVA---NKECKAELREHEHVVECIAWAPE
LIS1_NEMVE       ---------------GSLIASCSNDQTIRVWVVA---SRECKCDLRDHDHVIEDLNWAPE
LIS1_IXOSC       ---------------GSLLASCSNDQTVRVWVVG---TKECKLELREHDHVVECVAWAPA
LIS1_DROGR       ---------------GSIFATCSNDHTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROWI       ---------------GSLFATCSNDHTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROVI       ---------------GSIFATCSNDHTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROAN       ---------------GSIFATCSNDHTIRVWLTN---SRDCKVELRDHEHTVECIAWAPE
LIS1_DROPE       ---------------GSIFATCSNDHTIRVWLMN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROPS       ---------------GSIFATCSNDHTIRVWLMN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROMO       ---------------GSIFATCSNDHTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROER       ---------------GSIFATCSNDQTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROYA       ---------------GSIFATCSNDQTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROME       ---------------GSIFATCSNDQTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROSE       ---------------GSIFATCSNDQTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_DROSI       ---------------GSIFATCSNDQTIRVWLTN---SKDCKVELRDHEHTVECIAWAPE
LIS1_GLOMM       ---------------GNIFASCSIDHSIRIWSIN---SRDCKAELRAHDHTVECIAWAPD
LIS1_AEDAE       ---------------GSLMASCSNDHSVRVWQTN---SKECKAELREHENTVECIAWAPE
LIS1_TRIAD       ---------------GSLMASCSNDQTVRIWSLS---SKECKEELRGHEHVVECIKWAPE
LIS1_CAEBR       ---------------GTLFASGSLDQTVSVWSLP---RKQ-----RNWYFEIMSMRWSVS
LIS1_CAEEL       ---------------GTLFASASLDQTVTVWSFA---TKSAKLVLRDHEHAVECVEWAPD
LIS1_SCHMA       ---------------GNLLASCSNDHTIRIWSVE---SRECQVVLRGHEHVVECIAWASH
LIS1_DICDI       ---------------GSCIASCSNDQTIKTWNIV---KGECLATYREHSHVVECLAFSTA
LIS1_POLPP       ---------------GTTLASCSNDQTARVWNLA---KGECLLTFREHSHVVECLAYSPA
LIS1_MONBE       ---------------GAWICSASSDHTVRVWSVA---SGECKHVWSDHEHVVEHASFAPL
LIS11_PARTE      ---------------EKQIASCSQDQMIYIWVID---SGQVLHQLSGHEHVVEQVKYIPE
LIS12_PARTE      ---------------EKQMASCSQDQMIYIWVID---SGQILHQLSGHEHVVEQVKYVPE
LIS1_PHATC       ---------------GSVWASAGNDTVIYVYEQD---RMKKAVELRGHEQVVESIAFLTQ
LIS11_POSPM      ---------------GTLLGSCSSDNTARVWDPT---SGVMKMEFRGHGHIVEVIAFAPL
LIS12_POSPM      ---------------GTLLGSCSSDNTARVWDPT---SGVMKMEFRGHGHIVEVIAFAPL
LIS1_COPC7       ---------------GTMLASGSKDQTVRLWDPL---TGEPKSELRGHENDVEAVAFAPI
LIS1_CRYNJ       ---------------GRWLVSASNDQTSRIWDFS---TGETKMELRGHEHVVECAVFAPV
LIS1_USTMA       ---------------AKWLVSCSTDQTARVWDVS---SGETKVELRGHEHVVEVAIFAPV
LIS1_YARLI       ---------------EEFIFSAGIDHVTRVSEFVS---GDGKMTLLGHEHVIEGVAVYPK
LIS1_CANAW       DTY------------GDFVLTCSNDQSARLSHAN---SGAGVAMIVGHSHVVETVKFLPS
LIS1_CANAL       DTY------------GDFVLTCSNDQSARLSHAN---SGAGVAMIVGHSHVVETVKFLPS
LIS1_CANDC       DNN------------GDFVLTCSNDQSARLSHAS---SGAGLAMIVGHGHVVETVKFLPA
LIS1_CANTT       ETQ------------GDFVLTCSNDQSARLSHIN---SGVGVAMFVGHTHVVESVKFLPK
LIS1_DEBHA       NSNLLQEQSDINPELGDFLVTCSNDQSIRLSHAE---SGTGLSLSIGHTHVIECVKFLP-
LIS1_PICST       NSQLSLNNMKVSAELGDFVVTCSNDQSVRVSHAE---SGAGLALLIGHTHVIEKVKFLP-
LIS1_PICGU       KQK----------SLGDFILTCSNDQSVRLSHAD---SGTGLCLLVGHSHVIESVRFLP-
LIS1_ASHGO       ---------------GDYVITGSNDATIRLSHWP---SGNGLSMAVMHEFPIERVLIIPM
LIS1_KLULA       ---------------GEFVLTGSNDSAIRLTHWP---SGNGLSMGIGHDFPVEKVLILIP
LIS1_LACTC       ---------------GDFVVTGSNDCTVRLSHWP---TGRSLSFGTGHEFPVEKIRIIPL
LIS1_YEAST       ---------------GDYIISGSHDTTLRLTHWP---SGNGLSVGTGHEFPIEKVKFIHF
LIS1_YEAS7       ---------------GDYIISGSHDTTLRLTHWP---SGNGLSVGTGHEFPIEKVKFIHF
LIS1_YEAS8       ---------------GDYIISGSHDTTLRLTHWP---SGNGLSVGTGHEFPIEKVKFIHF
LIS1_YEAS1       ---------------GDYIISGSHDTTLRLTHWP---SGNGLSVGTGHEFPIEKVKFIHF
LIS1_YEAS2       ---------------GDYIISGSHDTTLRLTHWP---SGNGLSVGTGHEFPIEKVKFIHF
LIS1_CANGA       ---------------DEYILSGSLDSTLRLTHWP---SGNGLSVGTGHEFPIERVLIIPF
LIS1_ZYGRC       ---------------GEFLITGCQDSTLRLTHWP---SGNGLSVGLGHDFPVESVRFIGS
LIS1_KOMPG       ---------------GEFTLTSSNDHSIRLSSLL---TGTGIGLMIGHEQVVEKVKFLPM
                                     :   *                                   

LIS1_AJECG       TSYQYLAPVAGLK----------GPSYPK-----SAAEFMATGSRDKTIKVWDVR-----
LIS1_AJECH       TSYQYLAPVAGLK----------GPSYPK-----SAAEFMATGSRDKTIKVWDVR-----
LIS12_ASPCL      TSYQYLAPLARLA----------KVSRAG-----STAEFMATGSRDKTIKLWDAR-----
LIS11_TALMQ      TSYQYLAPMAGLK----------KEALSKM----SAVEFTATGSRDKTIKVWDRR-----
LIS1_TALSN       TSYQYLAPMAGVK----------KEAVSKL----GAVEFIATGSRDKTIKVWDRR-----
LIS1_ASPFN       TSYQFLAPLAGLG----------KRPSST-----NGADFMATGSRDNTIKIWDSR-----
LIS1_ASPOR       TSYQFLAPLAGLG----------KRPSST-----NGADFMATGSRDNTIKIWDSR-----
LIS12_CHAGB      ASYVHMAALAGLK----------KPPPST-----STAEFMATGSRDKTIKLWNST-----
LIS1_ARTBC       TSYQYLSPLTGLK----------KPPPAS-----STAEFMATGSRDKKIKIWDAR-----
LIS1_TRIVH       TSYQYLSPLTGLK----------KPPPAS-----STAEFMATGSRDKKIKIWDAR-----
LIS1_ARTOC       SSYQYLSPLTGLK----------KPPAAS-----STAEFMATGSRDKTIKLWDAR-----
LIS1_MAGO7       SSYPFLSRLAGLK----------KPPAAT-----STAEFMASGSRDKTIKLWDAR-----
LIS12_UNCRE      ASYQYLAALTGLK----------APP-AS-----SAAEFMATGSRDKTIKLWDAH-----
LIS1_GIBZE       AAYSHLATLAGVK----------KPPPAS-----STAEFMATGGRDKTIRLWDGR-----
LIS1_NECH7       TSYQHLATMAGLK----------KAPPAS-----STAEFMATGSRDKTIRLWDSR-----
LIS11_CHAGB      ASYPHLAAIAGVK----------KPP-TT-----SAVEFMATGSRDKTIRLWDAR-----
LIS11_PODAN      AAYPHLAAMAGIK----------KPP-AT-----SAVEFMATGSRDKTIRLWDAR-----
LIS11_NEUCR      AAYQNLAAMAGIK----------KPP-AT-----SSAEFMATGSRDKSIRLWDAR-----
LIS11_SORMK      AAYQNLAAMAGIK----------KPP-AT-----SSAEFMATGSRDKSIRLWDAR-----
LIS1_AJEDR       TTYPYLAALAGLK----------KPPPPS-----SSAEYVATGSRDKTIRVWDSR-----
LIS1_BLAGS       TTYPYLAALAGLK----------KPPPPS-----SSAEYVATGSRDKTIRVWDSR-----
LIS1_PARBP       TSYPHLAALAGLK----------KAPPSS-----SSAEYVATGSRDKSIRIWDAR-----
LIS1_PARBD       TSYPHLSALAGLK----------KAPPSS-----SSAEYVATGSRDKSIRIWDAR-----
LIS1_COCP7       ASYPHLAALAGLK----------KPPPAS-----SSAEFVATGSRDKTIKIWDSR-----
LIS1_ASPFU       ASYPHLAVLSGLK----------KPPPAS-----SSAEFFATGSRDKTIRLWDSR-----
LIS1_NEOFI       ASYPHLAVLSGLK----------KPPPVS-----SSAEFFATGSRDKTIRLWDSR-----
LIS1_ASPFC       ASYPHLAVLSGLK----------KPPPAS-----SSAEFFATGSRDKTIRLWDSR-----
LIS11_ASPCL      ASYPHLAVLSGLK----------KPPSAS-----SSAEFFATGSRDKTIRLWDSR-----
LIS11_PENRW      TSYPHFAALAGLK----------KPPPAS-----SSAEFVATGSRDKTIRLWDTR-----
LIS1_SCLS1       ASYPHLAAMAGLK----------KPPAAS-----SSAEYIATGARDKSIRIWDAR-----
LIS1_PHANO       VSYANLASLAGLK----------KPPPLS-----SSAEFVATGSRDKTIKIWDGR-----
LIS1_PYRTR       VSYANLASLAGLK----------KPPPLS-----SSAEYIATGSRDKTIKIWDGR-----
LIS12_NEUCR      TAYPHLAKLAGLE----------RAPPPS-----SSAEFMATGSRDKQIRLWDGR-----
LIS12_SORMK      TAYAYLAKLAGLD----------RPPPLG-----ASAEFMATGSRDKQIRLWDGR-----
LIS12_PODAN      TSYPHLARLAGHE----------KVPPAN-----SAAEFMATGSRDKQIRLWDRR-----
LIS12_PENRW      TSFRYLASFLESR----------GSTIAA--------EITATGSRDKSIKLWDSH-----
LIS1_ASPTN       ASYEYLATLAGHK----------KAPLAS-----SSSEFIATGSRDKTIKLWEAR-----
LIS12_TALMQ      TSYEHLATLAGLK----------KPPAPS-----SSCEFIATGARDKTIRLWESR-----
LIS1_EMENI       ASYEHLATLAGLK----------KPPPAT-----SSCEFVATGARDKTIKLWEAR-----
LIS1_ASPNC       SSYKHLAAIAGLK----------TAPPAS-----SSSEFIATGARDKTIKLWESR-----
LIS11_UNCRE      SSYGYLATLAGLK----------KPPSTN-----SSAEFVATGARDKTVKLWDSR-----
LIS1_TUBMM       SSYPHLATIAGLK----------KPPPAT-----SSSEFIATGSRDKTIKLWDAR-----
LIS1_PANTR       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_PIG         SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_RAT         SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_FELCA       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_MOUSE       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_PONAB       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_BOVIN       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_MACFA       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_HUMAN       SSYSSISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1_CHICK       SSYSTISEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDIST----
LIS1_XENLA       SSYSTISDATGSE-------TKRSGKPGP---------FLLSGSRDKTIKMWDISI----
LIS1_XENTR       SSYSTISDATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDISI----
LIS1B_SALSA      TAHPTILEATSSE-------SKKNGKSGP---------FLLSGSRDKTIKMWDIST----
LIS1_TETNG       SAHPTILDATSSE-------SKKSGKPGP---------FLLSGSRDKTIKMWDVST----
LIS1B_DANRE      SAHPTISEATGSE-------NKKSGKPGP---------FLLSGSRDKTIKMWDIST----
LIS1A_SALSA      SAHPTILEATGSE-------SKKSGKPGP---------FLLSGSRDKTIKMWDVSI----
LIS1A_DANRE      SAHPTILEATGSE-------TKKSGKPGP---------FLLSGSRDKTIKMWDVSI----
LIS1_BRAFL       SCNGHVSEVMGAE-------KK--GRSGP---------FLLSGSRDKTIKMWDIST----
LIS1_NEMVE       SATPVINEAAGVEG------GKKAMSPGP---------FLVSASRDKSIKIWDVSA----
LIS1_IXOSC       HAQLCGAAGDSNRRPG----AGGAQGTGP---------FLVSGSRDKTIKVWDVST----
LIS1_DROGR       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROWI       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROVI       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROAN       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROPE       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROPS       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROMO       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROER       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROYA       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROME       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROSE       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_DROSI       AAASAINEAAGAD-------NKKGHHQGP---------FLASGSRDKTIRIWDVSV----
LIS1_GLOMM       ISTTHINEAAGSD-------NKKGHHQGP---------FLASGSRDKTIRVWDVGV----
LIS1_AEDAE       SAAAAINEAAGAD-------NKKGAHQGP---------FLASGSRDKTIRVWDVNS----
LIS1_TRIAD       SCNRYINEASGTE-------VPKGQKSGP---------FLASGSRDRVIKIWDVTT----
LIS1_CAEBR       ---------------------KPEGNSTH---------ILFSGSRDRSIKAWNIST----
LIS1_CAEEL       TAYTNVTG------------QQPEGNSTH---------ILFSGSRDRSIKAWNINT----
LIS1_SCHMA       PQNLNS--------------LPSSMNSSL---------LLVSGSRDRTIRFWDVNI----
LIS1_DICDI       NIIDIPGSLLSTPE------GKSKVKQGPGGNLVGQCGYLATGSRDKTIKIWELAT----
LIS1_POLPP       NIVEVPGSLLSTPE------GKAKAKAGAGGTSFGQAGYLATGSRDKTIKIWELAT----
LIS1_MONBE       VAHEALNLMIFGSKP-----SAEAASKGP---------FVASASRDKSICLFDVST----
LIS11_PARTE      HGAKQILTQQQQQ----------NIQTI---------NLLVSVSRDKEIKIWNTIL----
LIS12_PARTE      HGAKQILTQQQQQ----------NIQTI---------NLLVSVSRDKEIKIWNTIL----
LIS1_PHATC       DTIPKNNAQRPSK----------HIETVR--------DYLVSGSRDRTVRLWKVSE----
LIS11_POSPM      ASYAAIRELAGL----------KAATKAPG-------AYIATGSRDKTVKIWDVHS----
LIS12_POSPM      ASYAAIRELAGL----------KAATKAPG-------AYIATGSRDKTVKIWDVHS----
LIS1_COPC7       SAYAAIRELAGIP---------NDRTKRHG-------LFLASGARDKTVKLWDTQT----
LIS1_CRYNJ       NAYPAIRELAGLKPPA----PRDTRAKSPG-------VYAATGSRDKTIKLWDALS----
LIS1_USTMA       ASYAAIRQLASLDPNA----SKDASASMAG-------QFVATGSRDKTIRIWDSIS----
LIS1_YARLI       SAAGCLAKLDKTS-----------------------SYFVVSWSRDKTIRVWSSR-----
LIS1_CANAW       LQANKILDEYITKNTEQFPTIPLELLKDKTYNQ-LGFKYCITASRDNTIKLWLIPPPTIA
LIS1_CANAL       LQANKILDEYITKNTEQFPTIPLELLKDKTYNQ-LGFKYCITASRDNTIKLWLIPPPTIA
LIS1_CANDC       LQANKILDEYITKNIEQFPTIPLELLKDKTYNQ-LGFKYCITASRDNTIKLWLIPPPKIA
LIS1_CANTT       IQANELIDEYITKNIDQFPSIPSELLKDPIYDE-LGFKYCVSASRDNTIKLWLIPPPTLI
LIS1_DEBHA       FHSNYIIDKYIKENESLFPNISPEVLDDPNYTNLLGYKYCISGGRDNSVKLWLLPPPVFR
LIS1_PICST       AVSNTILDKFLKENHAQFPSIPQELVSDEIFTTTLGYKYCISGGRDNLLKLWLIPPPTLI
LIS1_PICGU       MHSNAHIDKYLKENSDRFPSMPPELVSAPIYDDVLGYKYCVSAGRDNIVKLWLMPPAVVR
LIS1_ASHGO       RANTAQKTEADD------DQVELEYRKYDPDYSPLGFKYCISCSRDNLIVLWKIPLPKFI
LIS1_KLULA       -----------------------DPQHLQPQYQPLGFQHVASASRDGTIRLWKVSLPKFI
LIS1_LACTC       QP-------PES------AEHSHRFNTHDEDYLPLGFSHVISTSRDGTLRIWQVPLPRFV
LIS1_YEAST       IED---------------SPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLM
LIS1_YEAS7       IED---------------SPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLM
LIS1_YEAS8       IED---------------SPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLM
LIS1_YEAS1       IED---------------SPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLM
LIS1_YEAS2       IED---------------SPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLM
LIS1_CANGA       SDSKI-------------CTSPYRDQNEHSAFAPLRFKYCASAARDNTIKIWEVPLPQLK
LIS1_ZYGRC       LQD----------------------AVTTEGRTNNWLGHCVSTSRDRTSKIWLLPQPRRL
LIS1_KOMPG       ACNKYLDHIAGVK-------FQNELKINDDNYNKVDYKYCISGGRDNSVCIWLLPLPLIR
                                                          : .**     :        

LIS1_AJECG       --------------GTCLMTLIGHDNWVRGIVFHPAGKYLLSVSDDRTLRCWDL----SQ
LIS1_AJECH       --------------GTCLMTLIGHDNWVRGIVFHPAGKYLLSVSDDRTLRCWDL----SQ
LIS12_ASPCL      --------------GTCLMTLTGHDNWVRAIVFHPGGRYLLSVSDDKTLRCWDL----SQ
LIS11_TALMQ      --------------GSCLMTLVGHDNWVRAIVFHPGGKYLLSASDDKSIRCWDL----SQ
LIS1_TALSN       --------------GSCLMTLVGHDNWIRAIVFHPGGKYLLSSSDDRSIRCWDL----SQ
LIS1_ASPFN       --------------GTCLMTLVGHDSWVQALVFHPGGKYLLSVSDDKTLRCWDL----NQ
LIS1_ASPOR       --------------GTCLMTLVGHDSWVQALVFHPGGKYLLSVSDDKTLRCWDL----NQ
LIS12_CHAGB      --------------GTCIKTLVGHDNWVSGLVFHPGGKYLLSVADDKTLRCWDL----GD
LIS1_ARTBC       --------------GTCLLTLAGHDNWIRALAFHPGGKYLFSVSDDRTLRCWDL----SQ
LIS1_TRIVH       --------------GTCLLTLAGHDNWIRALAFHPGGKYLFSVSDDRTLRCWDL----SQ
LIS1_ARTOC       --------------GTCLMTLVGHDNWIRALAFHPGGKYLFSVSDDRTLRCWDL----SQ
LIS1_MAGO7       --------------GTLLKTLIGHDNWVRALVFHPGGRYLLSVSDDKTLRCWDL----EQ
LIS12_UNCRE      --------------GRCLGTLIGHDNWVRALAFHPGGKYLLSVSDDKTLRCWDL----SQ
LIS1_GIBZE       --------------GNCIKTLIGHDNWVRGLVFHPSGKFLLSVSDDKTIRCWDL----SQ
LIS1_NECH7       --------------GTCIKTLIGHDNWVRSLVFHPSGKFLLSVSDDKTIRCWDL----SQ
LIS11_CHAGB      --------------GTCIKILVGHDNWVRGLVFHPGGKYLLSASDDYTLRCWDL----TQ
LIS11_PODAN      --------------GTCIKILVGHDNWVRGLVFHPGGQYLLSVADDYTLRCWDL----TQ
LIS11_NEUCR      --------------GTCIKTLVGHDNWVRGLVFHPGGKYLLSVSDDKTLRCWDL----TQ
LIS11_SORMK      --------------GTCIKTLAGHDNWVRGLVFHPGGKYLLSVSDDKTLRCWDL----TQ
LIS1_AJEDR       --------------GTLIKTLIGHDNWVRALVFHPGGKYLLSVSDDKTIRCWDL----SQ
LIS1_BLAGS       --------------GTLIKTLIGHDNWVRALVFHPGGKYLLSVSDDKTIRCWDL----SQ
LIS1_PARBP       --------------GTLIKTLIGHDNWVRALAFHPGGKYLLSVSDDKTLRCWDL----TQ
LIS1_PARBD       --------------GTLIKTLIGHDNWVRALAFHPGGKYLLSVSDDKTLRCWDL----TQ
LIS1_COCP7       --------------GTLIKTLVGHDNWIRALVFHPGGKYLLSVSDDKTLRCWDL----SQ
LIS1_ASPFU       --------------GNLIKTLVGHDNWVRALAFHPGGKHLLSVADDKTIRCWDL----TQ
LIS1_NEOFI       --------------GNLIKTLVGHDNWVRALAFHPGGKHLLSVADDKTIRCWDL----TQ
LIS1_ASPFC       --------------GNLIKTLVGHDNWVRALAFHPGGKHLLSVADDKTIRCWDL----TQ
LIS11_ASPCL      --------------GNLIKTLVGHDNWVRALAFHPGGKYLLSVSDDKTIRCWDL----TQ
LIS11_PENRW      --------------GNCIKTLVGHDNWVRSLVFHPGGKYLLSVSDDKTLRCWDL----TQ
LIS1_SCLS1       --------------GTLIKTLIGHDNWIRALVFHPGGKYLLSVADDRTLRCWDL----AQ
LIS1_PHANO       --------------GTLIKTLAGHDNWVRALIFHPGGKYLLSASDDKTIRCWDL----TQ
LIS1_PYRTR       --------------GTLIKTLTGHDNWIRSLVFHPGGKYLLSASDDKTIRCWDL----TQ
LIS12_NEUCR      --------------GNCIKVLVGHDNWVRGLVFHPGGKYLLSVADDRTMRCWDL----SQ
LIS12_SORMK      --------------GNCVKVLVGHDNWVRGLVFHPGGKYLLSVADDRTMRCWDL----SQ
LIS12_PODAN      --------------GQCIKVLEGHDNWVRGLAFHPAGKFLISVADDRTMRCWDL----SQ
LIS12_PENRW      --------------GRCIMTLTGHASWVRAIAFHPGGKYLLSVSDDKTMRCWDL----SQ
LIS1_ASPTN       --------------GRLIKTLVGHDNWIRGLVFHPSGKYLFSVSDDKTIRCWDL----SQ
LIS12_TALMQ      --------------GRLIKTLVGHDNWVRDLVFHPNGKHLISVADDKTIRCWDL----SQ
LIS1_EMENI       --------------GRLIKTLHGHDNWVRGLVFHPGGKYLFSVSDDKTIRCWDL----SQ
LIS1_ASPNC       --------------GRLIKTLVGHDNWVRGLLFHPGGKYLISVADDKTIRCWDL----SQ
LIS11_UNCRE      --------------GSLIKTLIGHNNWVRGLVFHPGGKYLFSVGDDKTIRCWDL----SQ
LIS1_TUBMM       --------------GTLLKTLVGHDNWIRALAFHPAGKYLLSVSDDKTIRCWDL----TQ
LIS1_PANTR       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_PIG         --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_RAT         --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_FELCA       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_MOUSE       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_PONAB       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_BOVIN       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_MACFA       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_HUMAN       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY----KN
LIS1_CHICK       --------------GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDF----KN
LIS1_XENLA       --------------GMCLMTLVGHDNWVRGVQFHPGGKFILSCADDKTIRIWDY----KN
LIS1_XENTR       --------------GMCLMTLVGHDNWVRGVQFHPGGKFILSCADDKTIRIWDY----KN
LIS1B_SALSA      --------------GMCLMTLVGHDNWVRGVLVHPGGRFIVSCADDKTLRIWDY----KN
LIS1_TETNG       --------------GMCLMTLVGHDNWVRGVLFHPGGKFIVTCADDKTLRIWDY----KN
LIS1B_DANRE      --------------GMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDY----KN
LIS1A_SALSA      --------------GMCLMTLVGHDNWVRGMLVHPGGKFILSCADDKTLRIWDY----KN
LIS1A_DANRE      --------------GMCLMTLVGHDNWVRGVLVHPGGKYIVSCADDKTLRIWDY----KN
LIS1_BRAFL       --------------GVCIMTLVGHDNWVRGVVWHPGGKYIISASDDKTIRVWDY----KN
LIS1_NEMVE       --------------GVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIWDY----KN
LIS1_IXOSC       --------------GLALFTLVGHDNWVRGVKFHPGGKYLLSASDDKTLRVWEL----AH
LIS1_DROGR       --------------GQCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROWI       --------------GLCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROVI       --------------GQCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROAN       --------------GLCLFTLNGHDNWVRGLAFHPAGKYLVSASDDKTIRVWDL----RN
LIS1_DROPE       --------------GLCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROPS       --------------GLCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROMO       --------------GLCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROER       --------------GLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROYA       --------------GLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROME       --------------GLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROSE       --------------GLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_DROSI       --------------GLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_GLOMM       --------------GLCLFVLTGHDNWVRELTFHPGGKYLVSASDDKTIRVWDL----RN
LIS1_AEDAE       --------------GLCLFTLVGHDNWVRGIVFHPGGKYMLSASDDKTLRIWDL----RN
LIS1_TRIAD       --------------AVCLFSLVGHDNWVRGLAFHAGGKYLTSASDDKTIKIWEL----RH
LIS1_CAEBR       --------------GEVIFTLSAHENWVRGLAFHPKGKYLVSVADDKMMRIWEL----SA
LIS1_CAEEL       --------------GDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWEL----SA
LIS1_SCHMA       --------------GICLFVLIGHDNWVRQLVFHPHGRLLLSASDDKTIRVWDL----KN
LIS1_DICDI       --------------GRCLATYIGHDNWVRAVRFHPCGKFLLSVGDDKTIRVWDI----AQ
LIS1_POLPP       --------------GRCLQTYIGHDNWVRSIKFHPCGKYLISVGDDKSIRVWDI----AQ
LIS1_MONBE       --------------GQHLARLTGHDNWVRATAWSRGGRYLFSVADDKTMRVWDI----AT
LIS11_PARTE      --------------GTNLFTLSGHDNWVNGVSFHPDGVHMLSVSDDKTIRVWNL----KE
LIS12_PARTE      --------------GTNLFTLSGHDNWVNGVSFHPDGVHMLSVSDDKTIRVWNL----KE
LIS1_PHATC       --------------ASCLMVLKAHDNWVRSVLIHPNGNYILSSSDDKSIRVFDI----KN
LIS11_POSPM      --------------GQELRTLSGHNDWIRGLVFHPSGKHLLSASDDKTIRVWEL----ST
LIS12_POSPM      --------------GQELRTVSGHNDWIRGLVFHPSGKHLLSASDDKTIRVWEL----ST
LIS1_COPC7       --------------GQMIRNLAGHDNWVRALAFHPSGKYLLSSSDDKTVRVWEL----ST
LIS1_CRYNJ       --------------GQCLRTLVGHDNWIRALVFHPSGKYLLSASDDKTIKVWDL----AN
LIS1_USTMA       --------------GQCLKTLTGHDNWVRGLAFSPNGKSLLSVSDDKTMRLWDL----QS
LIS1_YARLI       --------------GDPLLILRGHDNWVRGVVLHPAGRYLVSVSDDKTMRCWDL----EQ
LIS1_CANAW       PHRPPLPSKYNNSQSWLIAELKGHSSWVKSLCVHPNGKFIISGSDDKTIKFWDLSGLLET
LIS1_CANAL       PHRPPLPSKYNNSQSWLIAELKGHSSWVKSLCVHPNGKFIISGSDDKTIKFWDLSGLLET
LIS1_CANDC       PHRPPLPSKYNNSQSWMIAELRGHSSWVKCLCVHPNGRFIISGSDDKTIKFWDLSSLLET
LIS1_CANTT       PHRSPLPSKYNNSQGWLIAEFKGHSSWVKCLSVHPNGKFIISGSDDKTIKFWDLSGLIET
LIS1_DEBHA       PHRHPLPSQLNNSQGWLIADLVGHQSWVKSLHIHPNGRFVFSGSDDKTIKIWDLSSLNVN
LIS1_PICST       PHRSPLPAQHNNSQGWAIADLVGHQSWVKAIAIHPNGRFIFSGSDDKTIKVWDLANLNVT
LIS1_PICGU       PNAHPLPAATNNSQGWHIADLTGHQSWVKTLQVHPNGRFIFSAGDDKSIRVWDLSTLATG
LIS1_ASHGO       PHRPPQPNLLQTNF-EKVHVFKGHTSWVRDIKVR--GRHLFSCSDDRSIRCW-----DLV
LIS1_KLULA       PHRPPRPNPLDTTF-KVIAVLTDHNSWVRDLRQF--NDMLFSCSDDGSVKCWSLDWTNLS
LIS1_LACTC       AHRAPQPNPARPYF-NLVATLKGHSSWVRDVRVR--GKHAFSCSDDRSIKVW-----DLS
LIS1_YEAST       AHRAPIPNPTDSNF-RCVLTLKGHLSWVRDISIR--GQYLFSCADDKSVRCW-----DLN
LIS1_YEAS7       AHRAPIPNPTDSNF-RCVLTLKGHLSWVRDISIR--GQYLFSCADDKSVRCW-----DLN
LIS1_YEAS8       AHRAPIPNPTDSNF-RCVLTFKGHLSWVRDISIR--GQYLFSCADDKSVRCW-----DLN
LIS1_YEAS1       AHRAPIPNPTDSNF-RCVLTLKGHLSWVRDISIR--GQYLFSCADDKSVRCW-----DLN
LIS1_YEAS2       AHRAPIPNPTDSNF-RCVLTLKGHLSWVRDISIR--GQYLFSCADDKSVRCW-----DLN
LIS1_CANGA       PNSAPVPSTTNTTF-KCVMTLRGHTSWVKDLKLR--GDHLFSCSDDETIKCW-----DLN
LIS1_ZYGRC       PQRPPVPHSTDAQF-LCKWTLRGHDSWIKAVGSR--GDHVFTASDDKSVICW-----NWT
LIS1_KOMPG       SDGTMHPSTNPE--GKLILKLTEHKSWVKDIAIHPNSRFIISVGDDRKINIWDL-GLLLE
                                        * .*:        .    : .**  :  :        

LIS1_AJECG       EGKCVKTIKDAHDRFVTCLSWAPGVAKDVPAIPSNTAKGE---SSEIKETLKS-------
LIS1_AJECH       EGKCVKTIKDAHDRFVTCLSWAPGVAKDVPAIPSNTAKGE---SSEIKETLKS-------
LIS12_ASPCL      EGKCVKTIRDTHGGFITCLRWAPAILKDTPTDAARALVRQ---IPDVAEIMKNA------
LIS11_TALMQ      DGKCVKTLSDAHGRFVTCLRWAPSVVKEVAPSAESANGQ-----TDTNDLLKS-------
LIS1_TALSN       DGKCVKTLSEAHGHFISSLRWAPNVVKEVANNADSGNGK-----TDSNGLLKG-------
LIS1_ASPFN       QGKCVKTL-DAHESFVTSLRWAPGVAKNVPGGDGAAEGEG---NDKNGAGSEN-------
LIS1_ASPOR       QGKCVKTL-DAHESFVTSLRWAPGVAKNVPGGDGAAEGEG---NDKNGAGSEN-------
LIS12_CHAGB      DGRCVKVLADAHGQFITCLRWAPGIVKKGADQGA----------EDTGPLEKT-------
LIS1_ARTBC       EGKCIKVMRDAHERFITCLRWAPSIFK-DAPTGNGAS------DGKNGD-----------
LIS1_TRIVH       EGKCIKVMRDAHERFITCLRWAPSIFK-DAPTGNGAS------DGKNGD-----------
LIS1_ARTOC       EGKCIKVMRDAHERFITCLRWAPSIFK-DTPTGHGAG------DGRNGD-----------
LIS1_MAGO7       DGKCVKTIGDVHERFVTCLRWAPGVVM-DAPAEADGQ------SNGTPR-----------
LIS12_UNCRE      GGKCVKTLKDAHERFITCLRWAPGIFK-NVPGVSTRD------ANGESNGVLNT------
LIS1_GIBZE       EGKCVKTVEGSHEHFITSLRWAPPIIKDKGPGEETNG------DVGTPK-----------
LIS1_NECH7       EGKCVKTLEGMHEHFITSLRWAPPIT--KGPADEANG------EIGTPK-----------
LIS11_CHAGB      EGRCVKTISDAHAHFVQCIRWAPSVVKDVSVANGGDG------QGGEANGTPRQ------
LIS11_PODAN      EGRCVKTIGDAHGHFVQCIRWAPSIVKDVPAVNG-EG------ANGESNGTPRK------
LIS11_NEUCR      EGKCVKTIGDAHGHFVQCIKWAPSVIKDASVNGD----------NGEPNGTPKK------
LIS11_SORMK      EGKCVKTIGDAHGHFVQCIRWAPSVIKDVSVNGD----------NGEPNGTPKK------
LIS1_AJEDR       EFKCVRVVTDAHA-FVTCIRWAPNIIKDAGGMGVNGDING----GGSLALSGVNGIIPGS
LIS1_BLAGS       EFKCVRVVTDAHA-FVTCIRWAPNIIKDAGGMGVNGDING----GGSLALSGVNGIIPGS
LIS1_PARBP       ECKCVRTVKDAHGHFISCIRWAPNIIKDAGVVNGDDTSTAASANGGALGASAINGVVPTG
LIS1_PARBD       ECKCVRTVKDAHGHFISCIRWAPNIIKDAGVVNGDDTSTAASANGGALAASAINGVVPTG
LIS1_COCP7       ECKCVRTVSDAHGHFVSCIRWAPNIINESGLVSGEGGING----QGTPSMNGVS-ISTTS
LIS1_ASPFU       ECKCVRVISDAHGHFVTCLRWAPPLIKDGGANGEAE-------TNGTPAATSTT----NG
LIS1_NEOFI       ECKCVRVISDAHGHFVTCLRWAPPLIKDGGANGESE-------TNGAPAATATT----NG
LIS1_ASPFC       ECKCVRVISDAHGHFVTCLRWAPPLIKDGGANGEAE-------TNGTPAATSTT----NG
LIS11_ASPCL      ECKCVRTIADTHEHFVTCLRWAPPLIKDSGANGDAG-------ANGTPAATTTS----NG
LIS11_PENRW      ECKCVRTIV-AHGHFISSLRWAPPLVKDAGAN------------EGANGTEAAS----NG
LIS1_SCLS1       EGKCVKTISDAHGHFVSCMRWAPSVIKDAPLLNGENG-------VGTPIKNGNG----AT
LIS1_PHANO       EGRCVKVVTDAHSHFVSCMRWAPNVVKDAPTNGDAP--------NGTTANGASK------
LIS1_PYRTR       EGRCVKTVTDAHGHFVSCMRWAPNVIKDVPVNGDAT--------NGAT-NGLSK------
LIS12_NEUCR      EGRCVQTLTGVYEGFVSCIRWAPPVVKDADATAGNGR------SEGS-SLADPVVAARRR
LIS12_SORMK      EGKCVQTLTGVYEGFVSCIRWAPPVVKDADAMAANTK------SGGTGPLADTVVAARRR
LIS12_PODAN      DGKCVQTLSGMFDGFVSCVRWAPGITKD--GLAGGDA------GDGT-----------PK
LIS12_PENRW      QGRCVKSISNAHDGFITCLKWVPGIAKDTRNGTMTISYQR----KGSAELPRSK------
LIS1_ASPTN       EGRLVKTISNAHGHFISCIRWAPPPRNAAAEASETTNGVSK-------------------
LIS12_TALMQ      EGKLVKTIDNAHSHFVTCMRWGP----SATTDVETTNGVTN-------------------
LIS1_EMENI       EGRLVKTISGAHEHFVSCIRWAPSP--NTDNPDPAGEKAGK-------------------
LIS1_ASPNC       GGRLVKTI-NAHGHFVSCIRWGPVPVSDVPVETSESTKSSK-------------------
LIS11_UNCRE      EGKLVKTLEGAHEHFVSCIQWAPDPANLVQSSVAERPEGNKG------------------
LIS1_TUBMM       DGRCVKTVDEAHSHFATCLRWAPAPAKEQTNGEAKTNGIPK-------------------
LIS1_PANTR       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_PIG         K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_RAT         K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_FELCA       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_MOUSE       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_PONAB       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_BOVIN       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_MACFA       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_HUMAN       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_CHICK       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_XENLA       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1_XENTR       K-RCMKTL-NAHEHFVTSLDFHK-------------------------------------
LIS1B_SALSA      K-RCMKTL-CAHEHFVTSLDMHQ-------------------------------------
LIS1_TETNG       K-RCMKTL-CAHEHFVTSLDFHK-------------------------------------
LIS1B_DANRE      K-RCMKTL-SAHEHFVTSLDFHK-------------------------------------
LIS1A_SALSA      K-RCMKTL-GAHEHFVTSLDFHK-------------------------------------
LIS1A_DANRE      K-RCTKTL-SAHEHFVTSLDFHK-------------------------------------
LIS1_BRAFL       K-RCQKTL-EAHQHFCTSIDFHR-------------------------------------
LIS1_NEMVE       K-RCAKTL-VAHEHFVTTLDFHK-------------------------------------
LIS1_IXOSC       Q-RCCKTL-DAHSHFCTSLDFHR-------------------------------------
LIS1_DROGR       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROWI       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROVI       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROAN       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROPE       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROPS       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROMO       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROER       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROYA       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROME       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROSE       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_DROSI       K-RCMKTL-YAHQHFCTSIDFHK-------------------------------------
LIS1_GLOMM       K-RFMKTL-YAHQHFCTSVDFHK-------------------------------------
LIS1_AEDAE       K-RCMKTL-YAHSHFCTSLDMHK-------------------------------------
LIS1_TRIAD       K-RCSKSL-EAHNHFVTTIDFHR-------------------------------------
LIS1_CAEBR       Q-RCMKAI-EAHEHFVSTVAFHQ-------------------------------------
LIS1_CAEEL       Q-RCMKAI-EAHEHFVSTVAFHQ-------------------------------------
LIS1_SCHMA       R-RCHKTL-NAHSHFVTSLDVNR-------------------------------------
LIS1_DICDI       G-RCIKTINEAHTHFISCLDFCL-------------------------------------
LIS1_POLPP       G-RCIKTINEAHSHFISCLDFCS-------------------------------------
LIS1_MONBE       K-RVSKTI-PAHNHFVSCIAVHA-------------------------------------
LIS11_PARTE      Q-KQKKKIENAHDKFILKCEINK-------------------------------------
LIS12_PARTE      Q-KQKKKIENAHDKFILKCEINK-------------------------------------
LIS1_PHATC       E-RCLRTLENAHNHFVSSLDMHA-------------------------------------
LIS11_POSPM      G-RCMKVV-EAHSHFITCLAWGPPVQAGGDIKAASGSGNLRG------------------
LIS12_POSPM      G-RCMXVV-EAHSHFITCLAWGPPVSAVARVELPR-TPFCGD------------------
LIS1_COPC7       G-RCLRIV-EAHSHFVAALAWGR--QAAGKSGSEKKVNGVDS------------------
LIS1_CRYNJ       G-RCTKTI-EAHSHFVTSMTWGRAVGASGGIEKVN--GDASS------------------
LIS1_USTMA       G-RCTRTI-EAHQHFATGIAWGKAKIEAPIPPAQD--GEEAG------------------
LIS1_YARLI       GGRCIRVV-DAHGHFVTCVAWAPNDVN---------------------------------
LIS1_CANAW       GYVNVVKTIIGHDGFINDIDFARLK--EASD----------------------------V
LIS1_CANAL       GYVNVVKTIIGHDGFINDIDFARLK--EASD----------------------------V
LIS1_CANDC       GSVNVVKTIIGHDGFINDIDFARLK--EASDS-------------------------TPT
LIS1_CANTT       GSVTAIKTISGHEGFINDIDFARLTDSESNTD-------------------------KEL
LIS1_DEBHA       GRVKCVKNLIGHEGFVNDIEFASFEITNNIHASKTADDGKT--------------KTEED
LIS1_PICST       GSVKCVRTLSGHDGFINDLDFAAFNRDSGKEDKIKED------------------ATEEE
LIS1_PICGU       GRVTEVKKLMKHEGFVNDINAAPLS------------------------------EPKDT
LIS1_ASHGO       TGQCLKVWPEASHGFINCLSVD--------------------------------------
LIS1_KLULA       TTTCKKSWDLSNKGFQNCLTLD--------------------------------------
LIS1_LACTC       TCEVVRSINNLHSGFINCIDID--------------------------------------
LIS1_YEAST       TGQCLHVWEKLHTGFVNCLDLD--------------------------------------
LIS1_YEAS7       TGQCLHVWEKLHTGFVNCLDLD--------------------------------------
LIS1_YEAS8       TGQCLHVWEKLHTGFVNCLDLD--------------------------------------
LIS1_YEAS1       TGQCLHVWEKLHTGFVNCLDLD--------------------------------------
LIS1_YEAS2       TGQCLHVWEKLHTGFVNSLDLD--------------------------------------
LIS1_CANGA       TGNCVKTWSSIHNNFINCIDIDREA-----------------------------------
LIS1_ZYGRC       NGQCLKKWNRIHQGFVTCIDLD--------------------------------------
LIS1_KOMPG       SNLLQPFRSISTQGFPSTLCMAKPVIKDQESDD---------------------------
                               *                                             

LIS1_AJECG       --------PDVQIRCVIATGSVDR---KLQIFAA--------
LIS1_AJECH       --------PDVQIRCVIATGSVDR---KLQIFAA--------
LIS12_ASPCL      --TFEESFSDVQIRCVVATGSVDK---KLQIFAG--------
LIS11_TALMQ      ----KDNQPQVQIRCVVASGGVDQ---KLNIFAN--------
LIS1_TALSN       ----KDNPPNVQIRCVVASAGVDC---KLNIYAN--------
LIS1_ASPFN       -------PANIQMRCVVATGGWDQ---KLKIFAG--------
LIS1_ASPOR       -------PANIQMRCVVATGGWDQ---KLKIFAG--------
LIS12_CHAGB      ------APSEVQIRCLVATTSVDK---VVRIFAD--------
LIS1_ARTBC       IKKSDSP--EVQIRCVIATGGVDM---KLRIFAN--------
LIS1_TRIVH       IKKSDSP--EVQIRCVIATGGVDM---KLRIFAN--------
LIS1_ARTOC       SKKTEGP--DVQIRCVIATGGVDM---KLRIFAN--------
LIS1_MAGO7       KKTEAAP--AVRIRCVIATGSVDM---KLRIFAN--------
LIS12_UNCRE      GLKGDTP--DVQVRCVIATGGVDK---KLQVFAD--------
LIS1_GIBZE       KAATAPQ--DVQIRCVIATGSVDM---SLRIFSR--------
LIS1_NECH7       KAAAAPL--DVQIRCVIATGSVDT---SLRIFSR--------
LIS11_CHAGB      AAGAGAA--EAQIRCVLATGSVDL---NVRIFAN--------
LIS11_PODAN      AAGAAGAGGEAQIRCVIATGSVDL---NVRIFAN--------
LIS11_NEUCR      GGAAATP--EAQIRCVIATGSVDL---NVRIFAN--------
LIS11_SORMK      G-AAVTP--DSQIRCVIATGSVDL---NVRIFAN--------
LIS1_AJEDR       KKEDPGGGAKLGIRCVIATGSVDL---NVRVFAS--------
LIS1_BLAGS       KKEDPGGGAKLGIRCVIATGSVDL---NVRVFAS--------
LIS1_PARBP       KKEDPGGGPMMGIRCVIATGSVDL---KVRVFAS--------
LIS1_PARBD       KKEDPGGGPMMGIRCVIATGSVDL---KVRVFAS--------
LIS1_COCP7       KKEDTGGGGK--IRCVIATGSVDM---NVRVFAS--------
LIS1_ASPFU       VRPDPNVATKISIRCVIATGSVDQ---KVRIFAT--------
LIS1_NEOFI       VRPDPNAANKISIRCVIATGSVDR---KVRIFAT--------
LIS1_ASPFC       VRPDPNVATKISIRCVIATGSVDQ---KVRIFAT--------
LIS11_ASPCL      ARQDPNAANKISIRCVIATGSVDQ---KVRVFAT--------
LIS11_PENRW      AKED---ATKMSIRCVLATGSVDL---KVRVFAA--------
LIS1_SCLS1       KKEDAKGSDIDCTSLMPQIPSI--------------------
LIS1_PHANO       KKDEE--SAKAGIRCVIATGCVDL---NVRIFAS--------
LIS1_PYRTR       KKEEE--AAKAGIRCVIATGCVDL---NVRIFAS--------
LIS12_NEUCR      AATVGSVSASVQIRCVVATGSVDGAEGKVRIFAN--------
LIS12_SORMK      AATVGSVNASVQIRCVVATGSVDGTEGKVRIFAN--------
LIS12_PODAN      KKTGAEANGGVQMRCVVATGSVDGTEGKVRIFAN--------
LIS12_PENRW      --LDEVGQPGVQIRCVLATGGEDQ---KIRVFALQANDRSHK
LIS1_ASPTN       -----KAPTKPAFQCVIATGSADS---CVRVFK---------
LIS12_TALMQ      -----KGTTKSKFQCVIATGSADS---CVRVFS---------
LIS1_EMENI       -----KDAVKPSYRCVIATGCADN---SVRVFS---------
LIS1_ASPNC       -----SDSVKPGFQCVIATGSADS---SVRIFT---------
LIS11_UNCRE      -----TEHGTTGFRCVIATGSADS---CVRVFM---------
LIS1_TUBMM       -----AGEKVINVRCVIATGSADM---NVRVFAS--------
LIS1_PANTR       ------------TAPYVVTGFVDQ---TVKVWECR-------
LIS1_PIG         ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_RAT         ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_FELCA       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_MOUSE       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_PONAB       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_BOVIN       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_MACFA       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_HUMAN       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_CHICK       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_XENLA       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_XENTR       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1B_SALSA      ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_TETNG       ------------AAPYVVTGSVDQ---TVKVWECR-------
LIS1B_DANRE      ------------ASPYVVTGSVDQ---TVKVWECR-------
LIS1A_SALSA      ------------NAPYVVTGSVDQ---TVKVWECR-------
LIS1A_DANRE      ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_BRAFL       ------------SAPYVITGSVDQ---TVKVWECR-------
LIS1_NEMVE       ------------SAPFVATGSVDL---TLKVWECR-------
LIS1_IXOSC       ------------TAPYVVTGSVDQ---TVKVWECR-------
LIS1_DROGR       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROWI       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROVI       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROAN       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROPE       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROPS       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROMO       ------------AHPYVISGSVDQ---SVKVWECR-------
LIS1_DROER       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROYA       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROME       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROSE       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_DROSI       ------------AHPYVISGSVDQ---TVKVWECR-------
LIS1_GLOMM       ------------KLPYVISGSVDN---TVKVWECR-------
LIS1_AEDAE       ------------SHPYVISGSVDT---TVKVWECR-------
LIS1_TRIAD       ------------SSPFVITGSVDL---TIKVWECR-------
LIS1_CAEBR       ------------TNPYVITGSVDM---SCKVWECR-------
LIS1_CAEEL       ------------TSPFVITGSVDM---SCKVWECR-------
LIS1_SCHMA       ------------LAPYAITGSVDQ---TIHIWDCR-------
LIS1_DICDI       ------------HNPHIATGGVDD---VIKVWKLQ-------
LIS1_POLPP       ------------HNPHIATGGVDD---IIKIWKLG-------
LIS1_MONBE       ------------KNTHVVTGSVDL---KVKVWECN-------
LIS11_PARTE      ------------F--IFATCSVDQ---TIKLWLLS-------
LIS12_PARTE      ------------F--IFATCSVDQ---TIKLWLLS-------
LIS1_PHATC       ------------TLPILVSGSVDQ---TIRCWPLD-------
LIS11_POSPM      -----TGADTERRMNVLATGSVDQ---TVCVWLP--------
LIS12_POSPM      -----PKPIASRIMEEFNPRP---------------------
LIS1_COPC7       -----VDAEPEKVVNVVATGSVDE---TIKIWLP--------
LIS1_CRYNJ       -----K---EPRRINVLATGSVDQ---TIKVWTP--------
LIS1_USTMA       -----RKQPEARTVNVVATSSVDL---TIKIWTP--------
LIS1_YARLI       ----------GRVRCLVATGGVDG---QVKVWQ---------
LIS1_CANAW       SEEDLLKQVEKRMRCLFISGSADN---SIKLWN---------
LIS1_CANAL       SEEDLLKQVEKRMRCLFISGSADN---SIKLWN---------
LIS1_CANDC       SQEDLLKEVEKRMRCLFISGSADN---SIKLWN---------
LIS1_CANTT       TSEEYLKDVEKRMRCLFISGSADN---SIKLWS---------
LIS1_DEBHA       RRNELMKSIESKIRCLFISGGVDN---CIRLWS---------
LIS1_PICST       SHQQLMKFIEGRMRCLFISGAADN---SIKLWS---------
LIS1_PICGU       TNEDILQDIESRMRCVFVSGGTDN---TVRLWS---------
LIS1_ASHGO       ----SDVSNDKLLRELFLSGSIDG---KCNVFMR--------
LIS1_KLULA       ----NIAFTGLPSRKLLFSGSSEG---TLTSFMR--------
LIS1_LACTC       ----CGGLN----RQLLVSGGADG---KLVILMK--------
LIS1_YEAST       ----VDFDSNVTPRQMMVTGGLDC---KSNVFMR--------
LIS1_YEAS7       ----VDFDSNVTPRQMMVTGGLDC---KSNVFMR--------
LIS1_YEAS8       ----VDFDSNVTPRQMMVTGGLDC---KSNVFMR--------
LIS1_YEAS1       ----VDFDSNVTPRQMMVTGGLDC---KSNVFMR--------
LIS1_YEAS2       ----VDFDSNVTPRQMMVTGGLDC---KSNVFMR--------
LIS1_CANGA       ---TIEQFSPSLQREILVSGDMDN---KVKIIR---------
LIS1_ZYGRC       ------DSNHPLKRKIMVTGGIDC---KCHIFMQ--------
LIS1_KOMPG       -----LILLNEAMRCYLAVGHSDG---TVTLWKKNIQKEYIL