CLUSTAL format seed alignment for MF_03143

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D0NXA2_PHYIT      ------MSGSPQVVPCGS---------------------YDIVLGSSLLQSRFVAEDLLQ
H3GHV1_PHYRM      -------MSAPQVVSCGS---------------------YDIVLGSSLLQSRFVAEDLLQ
A9V1N3_MONBE      -------MEKATVVPCTG---------------------YNVVVGYEFW--RQLPLDLIK
ARO1_EMENI        -------MSNPTKISILG---------------------RESIIADFGLWRNYVAKDLIS
ARO1_ASPFU        -------MTGPTKISILG---------------------QESIVADFGLWRNYVAKDLIS
ARO1_AJECG        -------MGVPTKISILG---------------------RESIVADFGIWRNYVAKDLLS
ARO1_PHANO        -MATNGVKAEPTKVNILG---------------------KDSIVVDYGLWQSYIAEDLLQ
ARO1_NECH7        --MAEAKKPGPERISILG---------------------EANIIVDHGLWLNFVVDDLLQ
I1RK93_GIBZE      --MAQASGQDPTRISILG---------------------EPNIIVNHGLWLNFVVDDLLQ
ARO1_NEUCR        --MAEPI-SNPTRINILG---------------------KDNIIIDHGIWLNFVAQDLLQ
ARO1_SCLS1        --MGSTTFENPTRIEILG---------------------KEDIIVDFDIWRNFVAEDLLS
D5G8D9_TUBMM      --MSGDNGSTVTTVQILR---------------------KDTIKVGYDL-TDTITVDLLQ
ARO1_SCHPO        ----MSNESNIITVPILG---------------------KDTVRVGFGI-HQYICTEILE
ARO1_PNECA        -------MKEIIKLSILG---------------------KDSIHIGLHL-WPHITNELFT
ARO1_CANAL        --------MSIEKVPILG---------------------KETIHVGYGI-ADHIVREVIA
ARO1_YEAST        -------MVQLAKVPILG---------------------NDIIHVGYNI-HDHLVETIIK
ARO1_YARLI        ----MFAEGQIQKVPILG---------------------KESIHIGYKM-QDHIVSEIVA
ARO1_COPC7        MAVADDTKADLLKVSILG---------------------KESIHCGFHL-TPYIVQTVLT
ARO1_CRYNJ        ---MSSSSADVLKISILG---------------------NESIHVGFHL-LPYIFKTITT
ARO1_USTMA        MTSTASAQQPVLRTKTPSYHAPPSTDPLSGATIHTLRCLDTPIHLGYHL-IPHIAKTLLS
E3KTD2_PUCGT      ---MAHSVCDVQTVSILG---------------------KPSIRLGYHL-APYIAHTVLT
F4PAP8_BATDJ      ----------MHKVSILG---------------------TESIVVGKGI-VGHIAADVVS
I1CAL1_RHIO9      ---MATVNPDVVKVSILG---------------------SESIIAGFHL-TEYLLRDVLT
I7MKQ2_TETTS      ------MKQEALQVESIS---------------------NGDYHLVFPKELNMIPTLIRQ
                                                                       :   :  

D0NXA2_PHYIT      RLPTTSTFVILTDANVGPL------YAEPLRAQLAELLQIQGNAARRVLLHAVPAGEASK
H3GHV1_PHYRM      RLPSTATFVILTDANVGPL------YAEPLRVQLAALLHAQGNTTRRVLLHAIPSGEASK
A9V1N3_MONBE      YVPA-SKYIIITDLNVQQH------YGDELLRALNEALP----DGIEALLYAVAPGEASK
ARO1_EMENI        DCSS-TTYVLVTDTNIGSI------YTPSFEEAFRKAAAEITPS-PRLLIYNAPPGEVSK
ARO1_ASPFU        GCPS-TTYVLITDTNIGSI------YTPGFQKSFEEAAASVSPS-PRLLIYNAPPGEVSK
ARO1_AJECG        SCSS-STYILISDTNLTPL------YLEGFQRSFEDAATNVSPK-PRLLTYEIPPGESSK
ARO1_PHANO        NIPS-STYVLITDTNIGPT------YTPTFERSFSAAAASIASS-PRLLTYTIPPGETSK
ARO1_NECH7        NTPT-STYVLITDTNLFDT------YVPAFQAQFEAAAEG--KA-TRLLTYTIPPGEASK
I1RK93_GIBZE      NIAT-STYVLITDTNLFNS------YVPAFQSRFEHASQG--KD-TRLLTYTIPPGEASK
ARO1_NEUCR        NIKS-STYILITDTNLYKT------YVPPFQSVFEKAAP---QD-VRLLTYAIPPGEYSK
ARO1_SCLS1        DLPS-STYVLITDTNLSPL------YVPAFQQSFEALAAKSSST-PRLLTYEIPPGENSK
D5G8D9_TUBMM      NLIS-STYVLITDTNLAPL------YLPAFESSFNKNALKYSPE-ARLLSYIIPPGEYSK
ARO1_SCHPO        NFKS-STYVVITDSNIAPL------YLEKIESTFNKSIKDAKAE-ARLLTYVIPPGESSK
ARO1_PNECA        CIFS-PTYVIITDSNIETL------YIPSFKTYFISMAKQRSIN-SRLLFFTIPPGEKSK
ARO1_CANAL        NLAS-STYVIVTDTNMARTP-----QYSKLTDDFKTNLSEKRPE-SRLLTYCVSPGENNK
ARO1_YEAST        HCPS-STYVICNDTNLSKVP-----YYQQLVLEFKASLPE---G-SRLLTYVVKPGETSK
ARO1_YARLI        NIKS-STYILVTDTNIEDLG-----YVESLKTKFEAAFAKDGIK-SRLLTYTVAPGETSK
ARO1_COPC7        TLPS-STYVLITDDNIAKLH--LNKFEEAFAKGIEKSAANPKP---RFLSHVIPPGETSK
ARO1_CRYNJ        TLPS-STYVLITDTNLSAIY--LNDFKASFEEA--ASEADNKA---RFLVYEVAPGEGAK
ARO1_USTMA        TLPS-STYVLITDQNLEARCSVTTAFRREFEKAAVHLSSSHSW---RLLTKVIPPGEASK
E3KTD2_PUCGT      ELHS-STYVLITDSNVSPRH--VPALKAAFENQ-----LPKSA---RLLTYILPPGEQSK
F4PAP8_BATDJ      CIPA-STYAIITDENLAKLH--LDELLAAFQREIANQTAATASK-SRILSVVIPAGEVHK
I1CAL1_RHIO9      NIPA-SNYVLITDSHLASIY--LEKYAGAFQSVSEELYKSKGIKEPRFFTRVLPPGEMTK
I7MKQ2_TETTS      KFSKLSKLMLVMDSNINRIYG------SNMISFFQKSQD------VEVYTFVIQQGETQK
                       ..  :  * ::             :                .        **  *

D0NXA2_PHYIT      CREMKAKIEDEVLF-PKRCHRDTCVVAVGGGVVGDLAGYVASTYMRGVPFVQVPTSLLAC
H3GHV1_PHYRM      CREMKAKIEDEVLF-PNRCHRDTCIVAVGGGVVGDLSGYVASTYMRGVPFVQVPTSLLAC
A9V1N3_MONBE      SRETKRALEDWML--ARGFDRKSCIVALGGGVVGDLAGFVAATFMRGINFVQVPTTLLAM
ARO1_EMENI        SRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAM
ARO1_ASPFU        SRQTKADIEDWMLSQSPPCGRDTVVIALGGGVIGDLTGFVAATYMRGVRFVQVPTTLLAM
ARO1_AJECG        SRETKADIEDWMLARQPPCGRDTVIIALGGGVIGDLIGFVAATYMRGVRFVQVPTTLLAM
ARO1_PHANO        SRSTKAAVEDWLLSQG--CTRDTVIIALGGGVIGDMIGYVAATYMRGIKFVNVPTTLLAM
ARO1_NECH7        SRETKAEIEDWMLSQQ--CTRDTVIIALGGGVMGDMIGYVAATFMRGVRFVQVPTTLLAM
I1RK93_GIBZE      SRDTKAEIEDWMLSQQ--CTRDTVIIALGGGVMGDMIGYVAATFMRGVRFVQVPTTLLAM
ARO1_NEUCR        GRDTKAEIEDWMLSHQ--CTRDTVIIALGGGVIGDMIGYVAATFMRGVRFVQCPTTLLAM
ARO1_SCLS1        SRETKAEIEDWMLSHQ--CTRDSVIIALGGGVIGDMIGYVAATFMRGVRFVQVPTTLLAM
D5G8D9_TUBMM      SRSTKAEVEDWMLSEK--CTRDTVVIALGGGVIGDMIGYVAATFMRGVRFIQVPTTLLAM
ARO1_SCHPO        CRAMKAEIEDWLLTQS--CTRDTILIAMGGGVIGDLVGYVAASFMRGIRFIQMPTTLLAM
ARO1_PNECA        SRKTKALIEDWLLSEK--CTRDTVIIAIGGGVIGDLVGYVSATFMRGVRFIQIPTTLLAM
ARO1_CANAL        NRATKAAVEDFLLQQG--CTRDTVILAVGGGVIGDMIGFVAATFMRGVRVVQVPTTLLAM
ARO1_YEAST        SRETKAQLEDYLLVEG--CTRDTVMVAIGGGVIGDMIGFVASTFMRGVRVVQVPTSLLAM
ARO1_YARLI        SRATKAAIEDWMLSKG--CTRDTVILAVGGGVIGDMIGYVAATFMRGVRFVQIPTTLLAM
ARO1_COPC7        SREGKARIEDFLLFHK--CTRDSVILALGGGVIGDLVGFVAATFMRGVRFCQIPTTLLAM
ARO1_CRYNJ        SRKVKGEIEDWMLDNK--CTRDTVILAFGGGVIGDLTGFVAATFMRGVKFVQIPTTLLAM
ARO1_USTMA        SRDGKNAIEDWMFEHR--VTRDAVVLAVGGGVIGDLVGFVAATFMRGLKFVQIPTTLLAM
E3KTD2_PUCGT      SREMKAVLEDWLLDHR--CTRDTVVLALGGGVIGDLIGFVSATFMRGIRFCQIPTTLLAM
F4PAP8_BATDJ      TRDTKASIEDWLLSQA--CTRDSCLIALGGGVLGDLVGFVAATFMRGVPVVQIPTTLLAM
I1CAL1_RHIO9      SRKVKADIEDWLLSNA--VTRDTCFLAMGGGVIGDLVGYVAATFMRGVPFVQIPTTLLAM
I7MKQ2_TETTS      NMENISSLMDSLFKHK--FNRTDVLVGFGGGLITDFAGFAASIYKRGMKYVSIPTTVLAM
                         : * ::       *   .:..***:: *: *:.:: : **:   . **::** 

D0NXA2_PHYIT      VDSSIGGKTGIDVEAGKNLLGAFHMPQRVYIDLNVLHTLPKRELINGMGEVIKSGAIFDA
H3GHV1_PHYRM      VDSSIGGKTGIDVEAGKNLLGAFHMPQRVYIDLSVLHTLPKRELINGMGEVVKSGAIFNA
A9V1N3_MONBE      VDSSIGGKTGIDTPAGKNLVGAFHRPKRVYADLAFLSTLPEREFNNGMAEVIKAGAIYDA
ARO1_EMENI        VDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSE
ARO1_ASPFU        VDSSIGGKTAIDTPLGKNLIGAIWQPSRIYIDLEFLETLPVREFINGMAEVIKTAAISSE
ARO1_AJECG        VDSSIGGKTAIDTPNGKNLIGAIWQPQRIYLDMEFLNTLPEREFINGMAEVIKTAAISSD
ARO1_PHANO        VDSSIGGKTAIDVPAGKNLVGAFWQPERIYIDLQFLETLPKREVINGMAEVVKTAAIWNE
ARO1_NECH7        VDSSIGGKTAIDTPMGKNLVGAFWQPKRIYIDLAFLETLPVREFINGMAEVVKTAAIWNE
I1RK93_GIBZE      VDSSIGGKTAIDTPMGKNLVGAFWQPKRIYIDLTFLETLPVREFINGMAEVIKTAAIWNE
ARO1_NEUCR        VDSSIGGKTAIDVPMGKNLIGAFWQPERIYIDLTFLNTLPVREFINGMAEVIKTAAIWDE
ARO1_SCLS1        VDSSIGGKTAIDTPLGKNLVGAFWQPQRIYIDLRFLETLPVREFINGMAEVVKTAAIWDE
D5G8D9_TUBMM      VDSSIGGKMAIDSPHGKNLIGAFWQPERIFIDMKFLETLPEREFVNGMAEVVKTAAIWDE
ARO1_SCHPO        VDSSIGGKTGIDTPLGKNLVGAFWQPLRVYVDMVFLHTLPPRQVINGLSEIIKTAAMWNE
ARO1_PNECA        VDSSIGGKNSINTSYGKNAIGTIWQPERIFIDFTFLETLTEKEFINGIAELIKTIIIWDE
ARO1_CANAL        VDSSVGGKTAIDTPLGKNFIGAFHQPEYVFCDVSFLETLPARQFINGMAEVVKTAAIWNE
ARO1_YEAST        VDSSIGGKTAIDTPLGKNFIGAFWQPKFVLVDIKWLETLAKREFINGMAEVIKTACIWNA
ARO1_YARLI        VDSSIGGKTAIDTPLGKNLVGAFWQPVNIFIDTSFLETLPVREFINGMAEVIKTAAFYDA
ARO1_COPC7        VDSSVGGKTAIDTPHGKNLIGAFWQPEYIFIDAAYLETLPTREFSNGMAEVVKTAAIWDE
ARO1_CRYNJ        VDSSVGGKTAIDTPHGKNLIGAFWQPSYIFVDLAFLTTLPTREVSNGMAEVIKTAAIWKD
ARO1_USTMA        VDSAVGGKTAIDHPLGKNLIGSFHQPNYVFIDAAWLKTLPVREFSNGMAEVVKTAAIWDP
E3KTD2_PUCGT      VDSSVGGKTAIDTPLGKNLVGAFWQPSFIFIDASYLETLPEREFVNGMAEMIKTAAIWDE
F4PAP8_BATDJ      VDSSVGGKTAVDTPNGKNLIGAFHQPRRIFIDIQYLTTLNKREFVNGLAEVIKTAAIWDE
I1CAL1_RHIO9      VDSSIGGKTAIDVPAGKNLIGAFWQPKRIFIDVNFLTTLPEREFSNGMAELIKTAAISNE
I7MKQ2_TETTS      SDAAIGSKTGVNNQYGKNMVGSFYDPELIIVCEKFLESLDDRNMSNGIAEIIKIAAMIDL
                   *:::*.* .::   *** :*::  *  :      * :*  ::. **:.*::*   : . 

D0NXA2_PHYIT      ELFELLENSAETILSLS--------------------------DMDIVQRVVALTVQVKA
H3GHV1_PHYRM      ELFELLETSAESILALS--------------------------DMDLVQRVVALTVQVKA
A9V1N3_MONBE      ALFQLLELQSEQIRAL---------------------------DPDLLTQMVLAAVRVKV
ARO1_EMENI        EEFTALEENAETILKAVRREVRPGE-------------HRFEGIEEILKARILASARHKA
ARO1_ASPFU        EEFTALEDNAETILSAVRREVKPGQ-------------RRFEGIEEILKARILASARHKA
ARO1_AJECG        EKFAALERDAETILAAVKSKNTPER-------------PRFSGIEETLKRTILSSAEFKA
ARO1_PHANO        EEFTALEGNADAILAAMDQKTTDGR-------------RNFDSIAGILKRIVLGSVRVKA
ARO1_NECH7        TEFTVLEESAAHILECVRSKGE----------------GRLTPIKDVLKRIVIGSAGVKA
I1RK93_GIBZE      TEFSVLEESAAHILECVRSKGE----------------GRLTPIKDVLKRIVIGSAGVKA
ARO1_NEUCR        NEFTALEENAKAILEAVRSKNKS-A-------------DRLAPIRDILKRIVLGSARVKA
ARO1_SCLS1        AEFSALEDNANLIMTTIRAKNTDCS-------------TRLGPIRDILKRIVLGSAKTKA
D5G8D9_TUBMM      AEFARLEQSSGLILETVRAKSSG-----------------------------NKAQIGNA
ARO1_SCHPO        NDFQLLENNSAVLLDALNKPSVPGE-------------YKFDSIKPLLQKIILSSIRTKC
ARO1_PNECA        SEFASLENISEKIAKTVRSMSLTSNK-----------HSKFNEIIKDLKRYIISSIKIKA
ARO1_CANAL        EEFTRLENFSKKFLSVVTSKK-----------------PDLQSIKAELVKTVLESVRVKA
ARO1_YEAST        DEFTRLESNASLFLNVVNGAKNVKVTNQLTNEIDEISNTDIEAMLDHTYKLVLESIKVKA
ARO1_YARLI        EEFTRLESASEIFLSTIKKRD-----------AKDPRRVDLSPITDTIGRIVLGSARIKA
ARO1_COPC7        KEFTSLESRSAELFAAIQTP--STNY-------AGRTLETRSEAQKLLLSTIAASIGVKA
ARO1_CRYNJ        DDFALLESRSAEISLAASSR--PTGVP-----TAGRFVSDRSHAQSLLLQVVSGSIYVKA
ARO1_USTMA        IDFAKLESSAPAIRSAVLGPFAKDAPL-----DQGRTLETRTESQSLLLDVIRGSVGVKA
E3KTD2_PUCGT      SQFENWNP-------------------------------TRSQAQKLLLQVIADSVGVKS
F4PAP8_BATDJ      KDFQMLENHSDRILGLVGSD-------------SNQGECIAVILMDLVTRLILGSIKVKA
I1CAL1_RHIO9      EDFNKLENGVEAIRHAVLGNDSKDPNQ-------GATLETRTASQSLLLDVILASARFKA
I7MKQ2_TETTS      DLFVLLELNDVKSLRDN---------------------------PSILRQIIRRSMELKI
                    *   :                                               :   : 

D0NXA2_PHYIT      TVVTQDTKEMGLRAILNFGHSIGHGIEALLQPEYLHGECVSMGCIKEAEIARGMGICTSA
H3GHV1_PHYRM      TVVTQDTKEMGLRAILNFGHSIGHGIEALVQPEYLHGECVSMGCIKEAEIARGMGVCSSA
A9V1N3_MONBE      TVVLQDEKEAGLRAILNFGHSIGHGIEALLTGHWLHGECVAVGMIKETEVARARGILSPD
ARO1_EMENI        YVVSADEREGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGV
ARO1_ASPFU        FVVSADEREGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGV
ARO1_AJECG        QVVSADEREGGLRNLLNFGHSIGHAIEAILAPQVLHGECVSIGMVKEAELARHLGILNNV
ARO1_PHANO        EVVSADEREGGLRNLLNFGHSIGHAYEAILTPQILHGECVAIGMVKEAELARYLGVLDPS
ARO1_NECH7        EVVSSDEREGGLRNLLNFGHSIGHAIEAILTPQLLHGEAVAIGMVKEAELARYLGVLRPG
I1RK93_GIBZE      EVVSSDEREGGLRNLLNFGHSIGHAFEAILTPQLLHGEAVAIGMVKEAELARFLGVLRPG
ARO1_NEUCR        EVVSSDEREGGLRNLLNFGHSIGHAYEAILTPQVLHGEAVAIGMVKEAELARFLGVLRPS
ARO1_SCLS1        DVVSADEREGGLRNILNFGHSIGHAFEAILTPQVLHGEAVAIGMVKEAELARHLGVLKPG
D5G8D9_TUBMM      HVVSADEREGGLRNLLNFGHSIGHAIEAILFPQMLHGECVAIGMVKEAELARHLGVCKPG
ARO1_SCHPO        EVVTLDEHEGGLRNLLNFGHSIGHAYEAILYPQILHGECVAIGMVKEAELARYLGILKPN
ARO1_PNECA        HIVSIDEKEKDLRTLLNFGHSIGHAIETVLAPYILHGESISIGMVKEAELSRHLGILNPN
ARO1_CANAL        GVVSSDEKEAGLRNLLNFGHTIGHAIEAVLTPEALHGECVSIGMIKEAELSRYLGILPPV
ARO1_YEAST        EVVSSDERESSLRNLLNFGHSIGHAYEAILTPQALHGECVSIGMVKEAELSRYFGILSPT
ARO1_YARLI        AVVSADEREGGLRNLLNFGHSIGHAYEAILTPYILHGECVAIGMVKEAELSRYLGILSPV
ARO1_COPC7        HIVTIDERETGLRNLVNFGHSIGHAIEAVLTPTILHGECVSIGMILEAELSRQLGILTQV
ARO1_CRYNJ        HIVTIDERETGLRNLVNFGHTIGHAIEAVLTPAMLHGECVSVGIVLEAEVARQLGILSQV
ARO1_USTMA        HIVTIDEKETGLRNLVNFGHTIGHAIEAVLTPEMLHGECISIGMILEAEVARYMHGLSQV
E3KTD2_PUCGT      EVVTKDEKETGLRNLVNFGHTIGHAIEAVLTPAILHGECVSIGMILEAEVARARGCLSSS
F4PAP8_BATDJ      HVVTVDEKETGLRGLLNFGHTIGHAIEAIAFPHLLHGECVAIGMVKEAEVSRFLGHLNNV
I1CAL1_RHIO9      YVVTNDEREGGLRGLLNFGHSIGHGIEAIVSPMMLHGECVSIGCMKEAELARNLGHLNQV
I7MKQ2_TETTS      SIVSQDKFESDKRMILNYGHTIGHGIETASKEALLHGECVSIGIILENEIALHRYQTSFK
                   :*  *  * . * ::*:**:***. *:      ****.:::* : * *::         

D0NXA2_PHYIT      TVGRLRRCLAAYGLPVRVPD------------HVATRDVLVKMEVDKKN-SQGVKKIVLL
H3GHV1_PHYRM      TVGRLRRCLASYGLPVRVPE------------HVATRDVLVKMEVDKKN-SQGVKKIVLL
A9V1N3_MONBE      ALNRLLSCCQAYHLPTTIPT------------GVSHNDVLHKMAVDKKN-ERGRKHIVFL
ARO1_EMENI        AVSRIVKCLAAYGLPTSLKDARIRKLTAGK--HCSVDQLMFNMALDKKN-DGPKKKIVLL
ARO1_ASPFU        AVARIVKCIAAYGLPTSLKDSRIRKLTAGK--HCSVDQILFNMALDKKN-DGPKKKIVLL
ARO1_AJECG        SVSRISKCLASYGLPTSLKDQRIKKLTAGK--HCSVEQLIAYMGVDKKN-DGPKKKVVLL
ARO1_PHANO        AVARLTKCIASYGLPTSLADKTVRRRSANK--HCPVDELIKIMAVDKKN-AGAVKKIVLL
ARO1_NECH7        AVARLVKCIASYDLPTSIHDKRVVKLTAGK--KCPVDVLLQKMGVDKKN-DGQKKKIVLL
I1RK93_GIBZE      AVARLVKCIASYDLPTSLQDKRVTKLTAGK--KCPVDVLLEKMGVDKKN-DGKKKKIVLL
ARO1_NEUCR        AVARLSKCIASYDLPTSLQDKRIVKLTAGK--ECPVDVLLQKMAVDKKN-EGRKKKIVLL
ARO1_SCLS1        AVARLVKCIASYGLPTSLADKRIQKLTAGK--LCPVDVLLEKMGVDKKN-DGRKKKIVLL
D5G8D9_TUBMM      AVARLSKCLTSYGLPTSLEDKRVKKLTAGK--HCGVERMLSIMGVDKKN-DGRKKKVVLL
ARO1_SCHPO        AVGRLTKCLVSYNLPISVNDPKVKKYASFK--HCPVEKLIEYMAVDKKN-QGSKKRIVIL
ARO1_PNECA        VVSRLIKCLNTWGLPTSFKDRRFKEVILGK--KHLIEDILEIMSIDKKN-DSNNKKIVLL
ARO1_CANAL        AVARLSKCLVAYGLPVSIDDKEFLKKVGPKRHYVEIDILLKKMAIDKKN-DGSKIRCVLL
ARO1_YEAST        QVARLSKILVAYGLPVSPDEKWFKELTLHK--KTPLDILLKKMSIDKKN-EGSKKKVVIL
ARO1_YARLI        AVARLAKCIKAYELPVSLDDATVKARSHGK--KCPVDDLLRIMGVDKKN-DGSTKKIVIL
ARO1_COPC7        GVGRLTRCLKAYNLPTSLSAPLIASLPQAS--LLTVPRLLDIMRIDKKN-SGTNKKIVLL
ARO1_CRYNJ        AVGRLTRCLQAYGLPVSLSDRRITALPASS--QLSVDRLLDIMKIDKKN-SGPAKKIVLL
ARO1_USTMA        AIGRLTRCLKEYDLPVSLSDSRVTRLAKSL--DVTVDRLLDIMKVDKKN-SGTNKKIVLL
E3KTD2_PUCGT      AIARLSKCLKAHGLPVSLTDPRILSSPNAP--NLNLDRLLDLMSVDKKN-EGKIKKIVLL
F4PAP8_BATDJ      SVGRLVRCLRAYGLPVSLNDPLVSTRCPNK--TFPTHRLLDIMRVDKKN-QGDKKRIVLL
I1CAL1_RHIO9      AVGRLARCFSSYGLPISLDEKKVKDRIGNL--YCHVDDIMEIMKVDKKN-QGDKKRIVML
I7MKQ2_TETTS      FTKRVEKLLLQYNLPVEVPK------------FIKNEDVLFYMGNDKKNSNSHTFQIVFV
                     *:        **                       ::  *  ****      : *::

D0NXA2_PHYIT      EEIGKVLANPYARAVKDNQIELVLEKQVRMLPGAKANGT--------IRVPGSKSISNRV
H3GHV1_PHYRM      EKIGKVLADPYARAVKDHQIELVLEKQVRMVPGAKANGT--------IRVPGSKSISNRV
A9V1N3_MONBE      RAIGD--AGQGAEPVEDDLLLRIMAPAVEVVPHGPIAGT--------IRVPGSKSISNRV
ARO1_EMENI        SAIGTP-YETRASVVANEDIRVVLAPSIEVHPGVAQSSN------VICAPPGSKSISNRA
ARO1_ASPFU        SAIGRT-YEPRASVVPNEDIGVVLAPSIEVHPGVSTTSE------VVCAPPGSKSISNRA
ARO1_AJECG        SAIGRT-HEPRASTVSNEEIQIVLAPSIEVSPGVPKGLD------VTCTPPGSKSISNRA
ARO1_PHANO        SGIGRT-YEKKASSVVDRDIKIALSPSISVHPGIPSDLN------VTCTPPGSKSVSNRV
ARO1_NECH7        SAIGKC-HEPRASVVDDKTIRTILSPSIQVTPGVPSNLD------VTVTPPGSKSISNRA
I1RK93_GIBZE      SAIGKC-HEPRASVVDDKTIRTILSSSVQVTPGVPKDLA------VTVAPPGSKSISNRA
ARO1_NEUCR        SAIGKT-YEPKASVVEDRAIRIVLSPCIRVFAGVPKDLN------VSVTPPGSKSISNRA
ARO1_SCLS1        SAIGKT-YEPKASVVEDRSIRVVLSDSVEVRPSVPETLN------VEVTPPGSKSISNRA
D5G8D9_TUBMM      AAIGRT-YEKKASVVDDDSIRVILSPSVIVHSQRSGVPE------LEVTPPGSKSISNRA
ARO1_SCHPO        KAIGET-YEKHATVVSDDDIRFILSRDVKVDEFTKSSWD------VVVTPPGSKSISNRA
ARO1_PNECA        SAIGKT-YEKKASSVSDDDIRTILSQNILLYGIPLNAFQKH----TTITLPGSKSISNRA
ARO1_CANAL        EKIGKC-YQLKAHQVSKQDLSFVLTDEVLVHPFTNPPKE------NIIVPPGSKSISNRA
ARO1_YEAST        ESIGKC-YGDSAQFVSDEDLRFILTDETLVYPFKDIPADQQ----KVVIPPGSKSISNRA
ARO1_YARLI        SAIGKT-HEQKASSVADKDIRFVLSEEVIVGEAPVGDKKS-----YTVTPPGSKSISNRA
ARO1_COPC7        KRIGET-YEQKASIVEDKAIEKTLAEAVTVVPSIPTGNVKGSPGEVRMSTPGSKSISNRA
ARO1_CRYNJ        SRIGKT-YEEKASVVADDVISKVLCEAVTVKAATPTKSP------ITMATPGSKSISNRA
ARO1_USTMA        SSIGDT-VQNMASTVSDHIIRRVLSLAATVTPIHEQPNKP----KVTLSTPGSKSISNRA
E3KTD2_PUCGT      SRIGKT-FEERATGVEDSLIRRVLAPAVRVHPGPPPANIK----EVTLRTPGSKSISNRA
F4PAP8_BATDJ      SALGAT-VEPRASFVADDVIQKIISPAVLVTPSNTKLNVS-------LAIPGSKSISNRA
I1CAL1_RHIO9      SSIGKT-LEPRASVIADADIHKVLAPEQLVLPVTESATGPKK--EVSLTTPGSKSISNRA
I7MKQ2_TETTS      EDVGKV--IYKTAAVSGQEVLNVLSPSVKIGASDFSKISDN----IVIQLAGSKSITNRV
                    :*       :  :    :   :     :                    .****::**.

D0NXA2_PHYIT      LLMAALGEGSCRITGLLHSDDTQVMMNALQK-VGAKFSWEDNGAVLVVEGTAGKFATVAD
H3GHV1_PHYRM      LLMAALGKGACRITGLLHSDDTQVMMTALQK-VGAKFSWEDNGAVLVVEGTAGKFATVAD
A9V1N3_MONBE      LLMAALGRGVCRLRGLLHSDDTKVMIAALRK-LGVRIEFEDNGHVLLIQGCDGKLQAAGD
ARO1_EMENI        LVLAALGSGTCRIKNLLHSDDTEVMLNALERLGAATFSWEEEGEVLVVNGKGGN--LQAS
ARO1_ASPFU        LVLAALGSGTVRIKNLLHSDDTEVMLNALERLGAATFSWEEEGEVLVVNGKGGA--LQAH
ARO1_AJECG        LVLAALGSGTCRLKNLLHSDDTEVMLNALERLGAATFSWEDEGEVLVVSGKGGR--MEAS
ARO1_PHANO        LVLAALGTGSCRITNLLHSDDTQVMLDALAKMQGASFSWENDGKELVVTGNGGQ--LKAS
ARO1_NECH7        LVLAALGLGSCRIKNLLHSDDTEYMLSAIHQLGGASYSWQDAGEVLVVDGKGGN--LQAS
I1RK93_GIBZE      LVLAALGSGTCRIKNLLHSDDTQYMLSAIHQLGGASYSWQDAGEVLVVEGKGGN--LQAS
ARO1_NEUCR        LILAALGEGTTRIHNLLHSDDTQVMLNAVAQLQGASFSWEE-GDVLVVKGNGGK--LQAT
ARO1_SCLS1        LVLAALGTGPCRIKNLLHSDDVEFMLTSIGKLGGATYAWEDAGEVLCVQGKGGD--LHAS
D5G8D9_TUBMM      LVLAALGSGTCHVKNLLHSDDTEHMLTALHNLGGIQYSWEEDGDVLVVNGNGGK--LRAC
ARO1_SCHPO        LVLAAMGNGTCRLTNMLHSDDTQFMMSALESLGAATFSWEDGGETLVVKGNGGK--LAVP
ARO1_PNECA        LILASLSNGICYLKNFLHSDDTYYMLSALEKLNAAEFKWEQDGDVLVVKGKSGY--LENP
ARO1_CANAL        LILAALGNGTVRVKNLLHSDDTKHMLDAVASLKGAEISTEDNGETIVVKGNGGN--LVTS
ARO1_YEAST        LILAALGEGQCKIKNLLHSDDTKHMLTAVHELKGATISWEDNGETVVVEGHGGST-LSAC
ARO1_YARLI        FVLTALGKGPCKLRNLLHSDDTQHMLEAIELLGGASFEWEADGETLLVTGNGGK--LTAP
ARO1_COPC7        LVLAALAKGTCRLRNLLHSDDT----------QGAVFTWEDGGETLVVEGGEGTLTVPTP
ARO1_CRYNJ        LVLAALGKGTCRVRNLLHSDDTAVMMNALVELKGAVFSWEDGGDTIVVEGGGGILSTPAK
ARO1_USTMA        LVLAALATNTCRLRNMLHSDDTQVMMAGLHDLQAARFEFEDGGETIVVHGNAGALARPAN
E3KTD2_PUCGT      LILAALGHGTCRLKNLLHSDDTQVMINALEEMKGASFSWEDNGATLVVSGGAGKLSSPAN
F4PAP8_BATDJ      LVMAALGKGVCRLHGLLHSDDVQVMLDALQKLVGISYTWENKGETLVVNGGGGKLRSPQS
I1CAL1_RHIO9      LLIAALGSGTVRIKNLLHSDDTQFMLAALKSLNAADFEWEDNGETLVVHGGNGR--LVVP
I7MKQ2_TETTS      LILSALLDKEIQLQNVLFAEDTEVMMKSLQTLGACSIQQLDANTVKVKGNGGAFN--FQD
                  ::::::      : ..*.::*.           .        .      .  .       

D0NXA2_PHYIT      GEEIYLSNAGTAARFLTSAMTLVPSEN------DGTVVVTGNYRMKERPIASLVDALRGN
H3GHV1_PHYRM      GEEIYLSNAGTAARFLTSAMTLVPSEN------DGTVVVTGNYRMKERPIAPLVEALRGN
A9V1N3_MONBE      -NALFLANAGTASRFLTSACCLASS---------GHSLVTGVKRMHERPIGDLVEALRAV
ARO1_EMENI        SSPLYLGNAGTASRFLTTVATLANSST------VDSSVLTGNNRMKQRPIGDLVDALTAN
ARO1_ASPFU        PSPLYLGNAGTASRFLTTVATLATASS------VDSSVLTGNNRMKQRPIGDLVDALTAN
ARO1_AJECG        PSELYLGNAGTASRFLTTVATLARKSS------VDSSVLTGNARMKQRPIGDLVDALAAN
ARO1_PHANO        SNELYLGNAGTAARFLTSVTALCQAQE-----GVTSTVVTGNARMKERPIGPLVKSLRTM
ARO1_NECH7        KEALYLGNAGTASRFLTTVVALCSPSE-----SASSTILTGNARMKVRPIGPLVDALRSN
I1RK93_GIBZE      KEPLYLGNAGTASRFLTTVVALASPGQ-----DATTNVLTGNARMKVRPIGALVDALRSN
ARO1_NEUCR        STPLYLGNAGTASRFLTSVAALCNPS------DVNSTVLTGNARMKQRPIGALVDALRAN
ARO1_SCLS1        PTELYIGNAGTASRFLTTVVSLCKPSA-----STKSTILTGNARMKVRPIGPLVDSLRAN
D5G8D9_TUBMM      GDELYLGNAGTAARFLTSVATLVSPSG-----EHDSIVLTGNARMKQRPIGSLVDALRSN
ARO1_SCHPO        KEELYLGNAGTAARFLTGIAALVSSKD-----G-AKVVLTGNHRMKVRPIGPLVDALRAN
ARO1_PNECA        QMELYLGNSGTTARFLTSICTLVQPNS-----RENHLILTGSNRMKQRPIGPLVDALKNN
ARO1_CANAL        GEELYLGNAGTASRFLTTVASLVGKSQ-----ASDDVILTGNARMQERPIGPLVDALGSN
ARO1_YEAST        ADPLYLGNAGTASRFLTSLAALVNSTS-----SQKYIVLTGNARMQQRPIAPLVDSLRAN
ARO1_YARLI        AQELYLGNAGTASRFLTTAATLVQKGD------KDHVILTGNKRMQERPIGPLVDALRSN
ARO1_COPC7        GKELYLGNAGTAARFLTTVCALAQPAPASVQPPSTNTVITGNARMKQRPIGPLVDALRAN
ARO1_CRYNJ        GKELYLGNAGTASRFLTTVCAMVSGSASSER----STVITGNARMKQRPIGPLVDALTAN
ARO1_USTMA        DKQIYLQNAGTAARFMATVVSLVHNDGNQHP-----VVITGNKRMKERPIAALVDALRSN
E3KTD2_PUCGT      GKHVYLGNAGTAARFLTTVCSLVKSQVSNQS----STVITGNARMQERPIGPLVDALRTN
F4PAP8_BATDJ      --ELYLGNAGTASRFLTTVCTLIKSSAINVE----SAVLTGNARMKQRPIGPLVDALVDN
I1CAL1_RHIO9      DKELYVGNAGTASRFLTTVLTLIPTNEGA---KNSAAILTGNARMKQRPIAPLLEALKAN
I7MKQ2_TETTS      EKEIYVNNSGTSARFICSMLLLLKPNQ--------SVVIRCCERMKERPIKDLIEALSDF
                     ::: *:**::**:     :               ::    **: ***  *:.:*   

D0NXA2_PHYIT      GCDISYLENEGCPPLAIRGS--GLRG----GAVRLAAKVSSQYVSSVLISAPYA--KEPL
H3GHV1_PHYRM      GCDISYLETEGCPPLAIRGT--GLRG----GTVRLAAKVSSQYVSSVLISAPYA--KEPL
A9V1N3_MONBE      DCAIDYLDQEGYPPLRVHGT--GLPG----GTIQLAATVSSQYVSSILLAAPYA--QAPV
ARO1_EMENI        GASIEYVERTGSLPLKIAAS-GGFAG----GNINLAAKVSSQYVSSLLMCAPYA--KEPV
ARO1_ASPFU        GAQIEYVENKGSLPLKIAAS-GGFTG----GQINLAAKVSSQYVSSLLMCAPYA--KEPV
ARO1_AJECG        GASIEYLENLGCLPLKIASS-GGFAG----GEINLAAKVSSQYVSSLLMCAPYA--KTPV
ARO1_PHANO        GIDVDYQEKEGSLPLRISAC-GGFGSEAFSGEIELTANVSSQYVSSILLSAPYS--KKPV
ARO1_NECH7        GVEIEYQGKENSLPLRVDAA-GGLKG----GVIELAATVSSQYVSSILMAAPYA--KNPV
I1RK93_GIBZE      GLEIEYLGKENSLPLRIDAA-GGFKG----GDIELAATISSQYVSSILMAAPYA--KNPV
ARO1_NEUCR        GVGVKYLEKEHSLPVQVDAA-GGLAG----GVMELAATISSQYVSSLLMAAPYA--REPV
ARO1_SCLS1        GVDIEYLEKEHSLPLNVAAS-GGFTG----GDINLAATVSSQYVSSLLMCAPYA--KNPV
D5G8D9_TUBMM      GSSVEYLESQGSLPVRVPST-SGLMG----GRIELEAKVSSQYVSSVLICAPYA--REPV
ARO1_SCHPO        GCEINYLEKQGSLPLDLSSK-NGLKG----GIIELAATVSSQYVSSILMCAPYA--SQPV
ARO1_PNECA        GCCIEYLELENCLPLLIKPKEIGLYG----GNINLSATVSSQYVSSILMCSPYA--KTQV
ARO1_CANAL        GSEIEYLNKQGSLPLKISAG-NGLKG----GRIELAATISSQYVSSILMCAPYA--KEPV
ARO1_YEAST        GTKIEYLNNEGSLPIKVYTD-SVFKG----GRIELAATVSSQYVSSILMCAPYA--EEPV
ARO1_YARLI        GADIAFQNAEGSLPLKIEAG-VGLKG----GLIEVAATVSSQYVSSLLMCAPYA--QTPV
ARO1_COPC7        GCSIGYRESEGCLPLSIP--PNSFKG----GKIQLAASVSSQYVSSILLCAPYAQDANGV
ARO1_CRYNJ        GAKVKYLESTGCLPLDID--TDGFRG----GHIQLAASVSSQYVSSILLCAPYA--AEQV
ARO1_USTMA        GTSIDYLEGHGCLPLAVKGTTHGFKG----GKIQLSATISSQYVSSILLCAPYA--AEQV
E3KTD2_PUCGT      GVQIDYLRNEGCLPLRIS-PEDGFPG----GMIELAASVSSQYVSSVLLSAPFA--QAPV
F4PAP8_BATDJ      HCDIQYLGTKGCLPISIKSSPTGLSG----GTIHLSASVSSQYVSSILISAPYA--SSPV
I1CAL1_RHIO9      NAQIVSTEKEGFLPIAVTPN-GGFKG----GRIELAASISSQYVSSILLCAPYA--IEPV
I7MKQ2_TETTS      LN-FEYLEKEFYLPFRVTKK-YEFKG----GDIHINSKISSQYVTGILMAAPYA-LEPVR
                     .         *. :      : .    * :.: :.:*****:.:*:.:*::      

D0NXA2_PHYIT      VLELEEKEPTSLPYILMTTQLMKQFGIPVETLAP-------NRYRVPCGVYQNPKE-VSV
H3GHV1_PHYRM      VLELDEEQPTSLPYILMTTQLMQQFGIPVETLAP-------NRYRVPCGVYENPKE-VSV
A9V1N3_MONBE      TLEL-VGEVVSQPYIDMTVALMKQFGVDVEAHSG-------SRYVIPNTGYQLPDT-FDV
ARO1_EMENI        TLRLVGGKPISQPYIDMTTAMMRSFGIDVQKSTT-----EEHTYHIPQGRYVNPAE-YVI
ARO1_ASPFU        TLKLVGGKPISQPYIDMTTAMMRSFGIDVKKSTT-----EEHTYHIPQGRYINPAE-YVV
ARO1_AJECG        TLRLVGGKPISQPYIDMTTAMMRSFGVEVKKSET-----EEHTYHIPLGFYTNPVE-YIV
ARO1_PHANO        TLRLVGGKVISQPYIDMTIAMMASFGVQVKRDQS-----DPNTYRIPNKPYTNPAE-YVV
ARO1_NECH7        TLRLVGGKPISQPYIDMTISMMASFGVHVTASSD-----EPNTYHIPQGQYQNPSE-YII
I1RK93_GIBZE      TLRLVGGKPISQLYIDMTIAMMASFGIDVEVSSK-----EPNTYHIPKGAYKNPPE-YTI
ARO1_NEUCR        TLRLVGGKPISQPYIDMTIAMMASFGVQVQRSAE-----DPNTYYIPQGTYKNPET-YVV
ARO1_SCLS1        TLRLVGGKPISQLYIDMTTAMMAAFGIHVVRSQT-----EEHTYHIPQGVYKNPEE-YVV
D5G8D9_TUBMM      TLSLVGGKPISQLYIDMTIAMMSSFGIDVTKSTA-----EEYTYHIPQGSYKNPAV-YVV
ARO1_SCHPO        TLKLVGGKPISQLYIDMTIAMMASFGVNVTKSTT-----EENTYNIPCGKYQNPPH-YEI
ARO1_PNECA        TLSLIGGKPISQPYIDMTISMMSSFGIKVTRSHS-----KENTYYIPKGCYTCPSE-YII
ARO1_CANAL        TLALVGGKPISQLYIDMTCAMMKSFGIEVTKSTT-----EEYTYHIPKGTYKNPSE-YVI
ARO1_YEAST        TLALVGGKPISKLYVDMTIKMMEKFGINVETSTT-----EPYTYYIPKGHYINPSE-YVI
ARO1_YARLI        TLSLVGGKPISQFYIDMTIAMMADFGVVVTKDET-----KEHTYHIPQGVYTNPEE-YVV
ARO1_COPC7        TLELVGGEVISQPYIDMTIAMMKTFGVEVTRRTD-ASGKLLDIYDIPRGTYVNPPV-YNI
ARO1_CRYNJ        TLELTGGQVISQPYIDMTIAMMKQFGATVERQKD-EQGNLLDIYVIPKCTYVNPPE-YSV
ARO1_USTMA        VLELVGGQVISQLYIDMTIAMMATFGIKVERLLDPTTGRPSNTYRIPKGHYVSPDV-YDI
E3KTD2_PUCGT      TLSLVGGTVISQPYIDITISMMSTFGIQVERLNNPATGLPSNTYRIPNGTYKNPPV-YEI
F4PAP8_BATDJ      TLDLDGDAVVSQPYIDMTIAMMKSFGIHVTRIPG------TNKYNIPQGIYTNPTE-YMV
I1CAL1_RHIO9      ELVLTGGQVISQPYIDMTIAMMESFGAEVERLPE-------NTYRIKQTTYKNPEH-YLV
I7MKQ2_TETTS      VILSQTEQITSEPFIQMTFDMMKQFGSNIYREKQ-------NIFNISNTKYLYPKESYYI
                   :        *  :: :*  :*  **  :              : :    *  *     :

D0NXA2_PHYIT      EVDASSATYPLAFAAITGGQVTVEALGNTSLQGDAAFH-TLLRSMGCTTTQDATSTTVTG
H3GHV1_PHYRM      EVDASSATYPLAFAAITGGQVTVEALGNTSLQGDAAFH-TLLRSMGCTTTQDATSTTVIG
A9V1N3_MONBE      ESDASSASYPLAMAAISGGRVTVAAMGSGSLQGDAAFC-RVLERMGCEVEQTSDATTVVG
ARO1_EMENI        ESDASSATYPLAVAAVTGTTCTVPNIGSASLQGDARFAVEVLRPMGCTVEQTETSTTVTG
ARO1_ASPFU        ESDASSATYPLAIAAVTGTTCTIPNIGSKSLQGDARFAVDVLRPMGCTVEQTDTSTTVTG
ARO1_AJECG        ESDASSATYPLAAAAITGTSCTVPNIGSKSLQGDARFAVDVLRPMGCAVDQSDFSTRVTG
ARO1_PHANO        ESDASSATYPLAIAAITGTTCTVPNIGSGSLQGDARFAIEVLKPMGCKVEQTKTSTTVTG
ARO1_NECH7        ESDASSATYPLAIAAITGTTCTIPNIGSKSLQGDARFAVDVLQPMGCTVNQSDYSTTVTG
I1RK93_GIBZE      ESDASSATYPLAVAAITGTKCTIPNIGSKSLQGDARFAVDVLRPMGCSVEQSDYSTTVTG
ARO1_NEUCR        ESDASSATYPLAIAAITGTTCTVPNIGSKSLQGDARFAIEVLRPMGCTVEQTDVSTTVTG
ARO1_SCLS1        ESDASSATYPLAVAAISGTTCTIPNIGCKSIQGDARFAIDVLKPMGCKVVQTDYSTTVTG
D5G8D9_TUBMM      ESDASSATYPLAIAAITGNTVTVPNIGRKSLQGDARFAVDVLRPMGCTVEQSDYSTTVRG
ARO1_SCHPO        ESDASSATYPLAIAAITGTKCTVPNIGSASLQGDARFACDVLRPMGCTVEQTATSTTVQG
ARO1_PNECA        EGDATSATYPLAIAAITGGSCTISNVGSASLQGDSKFSEYILKPMGCEVVQSPTTTYIKG
ARO1_CANAL        ESDASSATYPLAFAAMTGTSCTIPNIGSSSLQGDAKFAVDVLKPMGCKVEQTTTSTTVTG
ARO1_YEAST        ESDASSATYPLAFAAMTGTTVTVPNIGFESLQGDARFARDVLKPMGCKITQTATSTTVSG
ARO1_YARLI        ESDASSATYPLAYAAMTGHTVTVPNIGSKSLQGDARFAIDVLKAMGCTVEQTATSTTVTG
ARO1_COPC7        ESDASSATYPLAVAAITGTKCTIENIGSSSLQGDAKFAVEVLQKMGCEVHQTADETTVQG
ARO1_CRYNJ        ESDASSATYPLAIAAITGTTCTISNIGSSSLQGDARFAKEILEPMGCIVEQTLTSTKVTG
ARO1_USTMA        ESDASSATYPLAIAAITGTECTVPNIGSASLQGDARFAKEVLEPMGCTVVQTATSTTVIG
E3KTD2_PUCGT      ESDASSATYPLAMAALNGLSITLETIGSGSLQGDAQFAKKVLEPMGCQVIQTERETKVIG
F4PAP8_BATDJ      EADASSATYPLAFAAITGSTVTVTNIGSNSLQGDAMFAIRVLKEMGCSVHQTETTTTVQG
I1CAL1_RHIO9      ESDASSATYPLAIAAITGTTCTVTSIGSSSLQGDAGFAVNVLKPMGCTVVQTETSTTVTG
I7MKQ2_TETTS      EPDAATASYDMAWAVLNQKKIIIKGFQIHSLQGDLKFTEKLVGLGYCVEYNDVGVIIRGD
                  * **::*:* :* *.:.     :  .   *:***  *   ::    *   :        .

D0NXA2_PHYIT      PQ-DGTPLKAVEIDMETMTDAFMTAVALAAVA--------------DGTTKITGIANQRV
H3GHV1_PHYRM      PQ-DGTPLKAVDIDMETMTDAFMTAVALAAVA--------------DGTTKITGIANQRV
A9V1N3_MONBE      CV-PGT-LQPVDVDMGDITDTFMTAAVLMATCPK------------GSRSTITNIANQRV
ARO1_EMENI        PSD-GILRPLPNVDMEPMTDAFLGASVLAAIARGK-------ES--NHTTRIYGIANQRV
ARO1_ASPFU        PAD-GVLRPLPNVDMEPMTDAFLGASVLAAIARGK-------DS--NHTTRIYGIANQRV
ARO1_AJECG        PPG-GILSPLPNIDMEPMTDAFLTASVLAAVARGK-------GS--NHTTRIFGIANQRV
ARO1_PHANO        PPR-GELKAVKEIDMEPMTDAFLTASVLAAVCSSN-------GT--STTTRIYGIANQRV
ARO1_NECH7        PAP-GELKGLPHVDMEPMTDAFLTASVLAAVASG--------------KTQITGIANQRV
I1RK93_GIBZE      PAP-GQLKALAHVDMEPMTDAFLTASVLAAVASG--------------TTQITGIANQRV
ARO1_NEUCR        PPI-GTLKAIPHVDMEPMTDAFLTASVLAAVASG--------------TTQITGIANQRV
ARO1_SCLS1        PPI-GSLQAIEEVDMEPMTDAFLTASVLGAVAKG--------------TTKIRGIANQRV
D5G8D9_TUBMM      PPK-GQLRPLPHVDMEPMTDAFLTASVLAAVAKGV-------E-----RSSITGIANQRV
ARO1_SCHPO        PPK-GTLKPLESIDMETMTDAFLTASVVAAVACNV-------SEG-DPVTRITGIANQRV
ARO1_PNECA        PPK-GKLKSLGSINMESMTDTFLTAAVLASVAYEE-------SK--PYVTKITGISNQRI
ARO1_CANAL        PPR-GHLKPLPHVDMEPMTDAFLTASVVAAVAK------------GGSSTSITGIANQRV
ARO1_YEAST        PPV-GTLKPLKHVDMEPMTDAFLTACVVAAISHDS-------DPNSANTTTIEGIANQRV
ARO1_YARLI        VP---NLKAIA-VDMEPMTDAFLTACVVAAVSE--------------GTTVITGIANQRV
ARO1_COPC7        PP-LGQLKAIEEVDMEVMTDAFLTASVLAAVAN----------GGENKAMKITGIANQRV
ARO1_CRYNJ        PP-VGTLRALGNVDMEPMTDAFLTASVLAAVAVKPCLPERKVEGLPETASRIYGIANQRV
ARO1_USTMA        PK-LGQLRQIGLVDMEPMTDAFLTASVLLAVAAHS--PANGSTSNARPSTRITGIANQRV
E3KTD2_PUCGT      PSTVSELRQLGEIDMEEMTDAFLTACVVLGVAVQP------SEKEQKMSTRIIGIANQRV
F4PAP8_BATDJ      PE---QLVPLPCIDMETMTDAFMTATVLAAVAQSN-------GNVDDNTTRITGIANQRV
I1CAL1_RHIO9      PPI-------------------------------------------ENITRIHGIANQRV
I7MKQ2_TETTS      LPQ--KECTQTTFDFNDCTDTFITFGIILAALENN----------NNQSYKIVNIANQRV
                                                                     * .*:***:

D0NXA2_PHYIT      KECNRIEVMVTELSKIGVECGELPDGIWI--KGTAGKTEHLK----KVSIACHNDHRIAM
H3GHV1_PHYRM      KECNRIEVMVTELHKIGVECGELPDGIWI--KGTAGKTDHLK----QASIACHNDHRIAM
A9V1N3_MONBE      KECNRITAMLTELGKCGVHCEELETGLAIFGQGADSPASLKR----GVPVECYRDHRIAM
ARO1_EMENI        KECNRIKAMKDELAKFGVICREHDDGLEIDGIDRSN-LRQPV-----GGVFCYDDHRVAF
ARO1_ASPFU        KECNRIKAMHDELAKFGVVCREHDDGLEIDGIDRST-LRQPA-----GGVFCYDDHRVAF
ARO1_AJECG        KECNRIKAMKDELAEFGVVCREHDDGLEIDGIDRAT-LHHPS-----DGVYCYDDHRVAM
ARO1_PHANO        KECNRIQAMEDELAKFGITCRQFDDGIEVDGRG-YQ-LDAPK-----VGIHCYDDHRVAM
ARO1_NECH7        KECNRIAAMKDQLAKFGVQCNELDDGIEVLGKGQDGGISAPT-----VGIHCYDDHRVAM
I1RK93_GIBZE      KECNRIAAMKDQLAKFGVQCNELEDGIEVIGKGQDGGVSTPE-----ASIHCYDDHRVAM
ARO1_NEUCR        KECNRILAMKDQLAKFGVHCNELEDGIEVIGIPYTE-LKNPT-----EGIYCYDDHRVAM
ARO1_SCLS1        KECNRIKAMKDELAKFGVTCRELEDGIEVDGVPIKD-LKHPA-----EGIHCYDDHRVAM
D5G8D9_TUBMM      KECNRIAAMVHELGKFGVTAGELEDGIWIQGIDYNL-LKTP------EGVHCYDDHRVAM
ARO1_SCHPO        KECNRIAAMVHELAKFGVRTGELEDGIYIFGKNYKE-LKKPE-----EGIYTYDDHRIAM
ARO1_PNECA        KECNRINAMVCELKKFGIEAGELPDGIYVKALNTSN-LPYSV-----EGINCYNDHRIAM
ARO1_CANAL        KECNRIEAMVTELAKFGVPANELPDGIEIHGID-IEDLKTPEISKR--GVSSYDDHRVAM
ARO1_YEAST        KECNRILAMATELAKFGVKTTELPDGIQVHGLNSIKDLKVPSDSSGPVGVCTYDDHRVAM
ARO1_YARLI        KECNRIEAMRVQLAKYGVVCRELEDGIEVDGIS-RSDLKTPV------SVHSYDDHRVAM
ARO1_COPC7        KECNRIRAMMDELAKFGVHTTEQELGLTIYAVPISQLKK-------NVSVHCYDDHRVAM
ARO1_CRYNJ        KECNRIQAMRDQLAKFGIETDEFDDGIIIFGKPEASLFR-------GASIHCYDDHRVAM
ARO1_USTMA        KECNRIRAMMDELAKFGVNTKEHDDGLEIFGIDYRQLHA-------NVRVHCYDDHRVAM
E3KTD2_PUCGT      KECNRIAAMVAELGKMGIHAQELEDGIEVFGTPVDALAKRGD----QVRINCYDDHRIAM
F4PAP8_BATDJ      KECDRIAAMIQQLDLFGVCASELPDGIQIHGMDRSKLCHTKP----LSGVHCFDDHRIAM
I1CAL1_RHIO9      KECNRIAAMVHELTKFGVQASELPDGIQIHGKPIKDLKAPKE------GVHTYDDHRIAM
I7MKQ2_TETTS      KECDRIHALSLNLKKFGIKTIEYDDGIEIFPNKKQLLEQCDS--KQSIIIECFNDHRLGM
                  ***:** .:  :*   *:   :   *: :                    :  . ***:.:

D0NXA2_PHYIT      SFAVLGSVVD-----------NIIITDKECTDKTYPEFWDHVQMHLGLQVAPVVEEKINN
H3GHV1_PHYRM      SFAVLGSVVG-----------NVVITDKECTDKTYPEFWDHVQMHLGLQVAPVVEETTDS
A9V1N3_MONBE      SFGVLGCLWP-----------NVQITDKDCTDKTYPSFWDDVCNLQGHRNAVLHASIEEQ
ARO1_EMENI        SFSVLSLVTP----------QPTLILEKECVGKTWPGWWDTLRQLFKVKLEGKELEE--E
ARO1_ASPFU        SFSVLSLIAP----------KPTLILEKECVGKTWPGWWDTLRQKFAVKLEGKELKEA-E
ARO1_AJECG        SFSVLSLVTP----------EPTLILEKECVGKTWPGWWDSLAQTFKVKLDGKEVGKRTE
ARO1_PHANO        SFGVLGLVAP----------EPVLILEKDCTGKTWPGYWDILNQQFKAELTGVEPPQQSH
ARO1_NECH7        SFSVLAVASP----------SPVIVTERECVGKTWPGWWDILSQAFKVDMIGHE-PDANA
I1RK93_GIBZE      SFSVLAVASP----------GPVIVTERECVGKTWPGWWDILFQVFKVDMVGHE-SHADT
ARO1_NEUCR        SFSVLSTISP----------HPVLILERECTGKTWPGWWDTMSNYFKVHLEGEEEPHSSH
ARO1_SCLS1        SFSVLSVAAS----------QPVLIEERECVGKTWPGWWDILSKSFQVELAGKEVKATHS
D5G8D9_TUBMM      SFSVISLIAP----------NPVILQERKCVEKTWPGWWDVLSTSFNVHLGGVELLE--N
ARO1_SCHPO        SFSVLSLICP----------SRTLIIDKACVEKTWPYWWDVLHQSFGVKLTGATSVASDP
ARO1_PNECA        SFSVLACISS----------KPTTILDKACVNKTWPYWWDILNSTFKVQMKGIEFDLNPT
ARO1_CANAL        SFSLLAGLCK----------EPVLILERSTTGKTWPGWWDILHSKFKIELDGYEPPFNTD
ARO1_YEAST        SFSLLAGMVNSQN-ERDEVANPVRILERHCTGKTWPGWWDVLHSELGAKLDGAEPLECTS
ARO1_YARLI        SFSLLSSIMA----------APVAIEERRCVEKTWPGWWDVLSGVFNVPLEGVTLAKTVS
ARO1_COPC7        AFSVLSTVV-----------EGAIIEEKRCVEKTWPGWWDDLENKIGIKVEGVDLAGLRA
ARO1_CRYNJ        AFAVLSCII-----------DETIIEEKRCVEKTWPNFWDDLQNKIGVAVEGVELETHNQ
ARO1_USTMA        AFSVLASLA-----------PGAILEEKRCVEKTWPNWWDDLERKLGIRVHGVDPECSPS
E3KTD2_PUCGT      AFSVLGTVPGG---------KGLILNEKRCVEKTWPSWWDDLSTKLGIQLDGVPAHEKLT
F4PAP8_BATDJ      SFSILACAVDSKH------NTGVVITERECVEKTWPSWWDTLENTLGTKITGVDLPKHMH
I1CAL1_RHIO9      SFSVFSTVVP----------HGTIITDKKCVEKTWPTWWDDLEGKLGVRLNGIDLGNRLT
I7MKQ2_TETTS      AFSQLGNFIKNKNG---QNSLDIILDEGDCVKKTFPSFYNHLQYSYSARCEKVHFSKSKH
                  :*. :.                  : :   . **:* ::: :                  

D0NXA2_PHYIT      TDAATSIPG----------------------------------VFVIGMRGAGKSSLAKA
H3GHV1_PHYRM      NDSDTSIPG----------------------------------VFMIGMRGAGKSSLAKA
A9V1N3_MONBE      TSAAAGSAGHAGARDRQ-------------------------SVCIIGMRGAGKSTLARA
ARO1_EMENI        PVAASGPDRANA------------------------------SIYIIGMRGAGKSTAGNW
ARO1_ASPFU        SPVLTRAEKASA------------------------------SVFIIGMRGAGKTTSGHW
ARO1_AJECG        TNPIVHVNKSAA------------------------------SIFIIGMRGAGKTTSGFW
ARO1_PHANO        GKKITS-KGQQK------------------------------SIFIIGMRGAGKTTAGGW
ARO1_NECH7        DEEDSKSSVMER------------------------------SVFIIGMRGAGKTTAGNW
I1RK93_GIBZE      HDEEISEKTLES------------------------------SVFIIGMRGAGKTTAGNW
ARO1_NEUCR        VSHEKPRKGNPK------------------------------SIFIIGMRGAGKSTAGKW
ARO1_SCLS1        KKIGIPALP-DK------------------------------SIFIIGMRGAGKTTAGAW
D5G8D9_TUBMM      PQVMEVKKGSNR------------------------------TIVIIGMRGAGKTTMGIR
ARO1_SCHPO        LKGSISKNAS---------------------------------IILIGMRGAGKTTIGKI
ARO1_PNECA        INSSILHHPSEC------------------------------TIFLIGMRGAGKTTLGQL
ARO1_CANAL        KHVDKSSDK---------------------------------SIIVIGMRGTGKSTLSEW
ARO1_YEAST        K---KNSKK---------------------------------SVVIIGMRAAGKTTISKW
ARO1_YARLI        KAESGLSKP---------------------------------SIFIVGMRGAGKTHLGAQ
ARO1_COPC7        ESSSAGVKESKPIDNSS--------------------------ILLIGMRGTGKTHIGQL
ARO1_CRYNJ        ASTSAKPVSPIDQSQSDR------------------------PIFLIGMRGAGKTYVGRM
ARO1_USTMA        LCISPSHFTKASAASTNGKPPTCLSQLTCGKALTPRKYSKHATIICIGMRASGKTFLGAI
E3KTD2_PUCGT      NTTSAVAWEAKKPETPS--------------------------ILLCGMRGSGKSFSGQV
F4PAP8_BATDJ      ASKLHTTTESAACFHSSQIS--------------------QSSILLVGMRGVGKTHMGRA
I1CAL1_RHIO9      QKTLGRTHVPNKPVKNVDRN---------------------KSLVIVGMRGTGKTTLGQY
I7MKQ2_TETTS      LKQEVEEIN---------------------------------TVFVIGMRCCGKSILSKK
                                                             :   ***  **:  .  

D0NXA2_PHYIT      ASAALKL-DLLDTDKVLEKEFG-ESIADFVARHNHTWEAFREKQKELLLRLIANP-----
H3GHV1_PHYRM      ASATLKL-NLLDTDKVLEKEFG-ESIADFVARHNHTWEAFREKQKELLLRLIANP-----
A9V1N3_MONBE      AAAHLGY-QFLDLDVVLEERCE-GGIKTFVEQQG--WPAFRDAEERVLADTLRAH-----
ARO1_EMENI        VSKALNR-PFVDLDTELETVE--GMTIPDIIKT-RGWQGFRNAELEILKRTLKER-----
ARO1_ASPFU        VASTLKR-PFIDLDDELERIE--GMTIPDIIKQ-RGWQGFRDAELNLLQRTMKER-----
ARO1_AJECG        VSKALQR-PFIDLDDELERTE--GMTIPEIIKQ-RGWGGFREAELSLLRRVMTEK-----
ARO1_PHANO        ASRALGW-PLIDLDTALEQHM--SMTIPEIIKT-SGWDGFRKAELELLQRTVKEK-----
ARO1_NECH7        MAKMLGW-KFIDLDQELERRA--GCTIPEMIRGSRGWEGFRADELSLLKDVMAKN-----
I1RK93_GIBZE      MAKILGW-KFIDLDQELERRA--GCTIPEMIRGDRGWDGFRADELALLRDVMERN-----
ARO1_NEUCR        MSEVLNR-PLIDLDHELERRE--GQTIPEIIRSERGWEGFRKAELELLEDVIKNN-----
ARO1_SCLS1        AAKILGR-PYKDLDVELERIS--GMSIPDMVRS-KGWDFFRAAELDLLKHCLTDQ-----
D5G8D9_TUBMM      AAKILNR-PVLDLDTVLEQEQ--KSALPEIIKK-HGWDGFRKLELELLQRHLKAH-----
ARO1_SCHPO        IAKQLNF-KFLDLDELLEDYL--EMPIAEVIFR-MGWDAFRLEEHKVLRKFITEH-----
ARO1_PNECA        AANFLGR-EFIDLDSIIEEDI--KTTILEFIQK-YSWDVFRRKELHFLKTLLTEK-----
ARO1_CANAL        LASFLGF-KMLDMDKYLEEKL--GT-GIKSLIKAKGWEYFRQEEAIVAKECFTKF-----
ARO1_YEAST        CASALGY-KLVDLDELFEQQH--NNQSVKQFVVENGWEKFREEETRIFKEVIQNYG----
ARO1_YARLI        AANHLGY-EFIDLDQLLEKDL--DT-TIPQLIADKGWDHFRAEELRLLKQCLNDK-----
ARO1_COPC7        AAASLPGWSFVDADHYFESKL--KTGVKDFVKN-EGWEKFREEELAVLAELIGLGVDGKA
ARO1_CRYNJ        AADILSG-QFTDADDVFAQES--HQTVSEFVAA-NGWDEFRKKETEILSKFV--------
ARO1_USTMA        GAAALSR-TFIDADVVFNEKLGAKDGLGDFVRE-HGWPAFRQKELEILQELI--------
E3KTD2_PUCGT      AASTLGW-PLIDTDLYFQEKC--GCSIREFIQK-NDWSHFREEECAVLKEIL--------
F4PAP8_BATDJ      AAKHFGR-TFIDMDVYLEQKL--LTTIPELIKA-QGWEGFRTQELQCLQDIL--------
I1CAL1_RHIO9      AAEVLGF-KFVDVDHYFENTL--NTTITEFINT-WGWEQFRVKETEMLKQILDSP-----
I7MKQ2_TETTS      VSNLLHMNNLSLDDELFNQFYSQKYKNLSEAINAEGWDTFRNNELQLLKQVIKENN----
                   :  :        *  :                   *  **  :       .        

D0NXA2_PHYIT      -------PPASIISCGGGVVETPEIVDALEKYPY----VVHVQRAMKDVLAYLDS-VEES
H3GHV1_PHYRM      -------PPATIISCGGGVVETPEIVAALEKYPY----VVHVHRDIRDVLAYLDT-VEES
A9V1N3_MONBE      -------PTGAVIACGGGIVEREANCAVLQATKLP---IIWLDRPLVDIERYL---AADG
ARO1_EMENI        -------SRGYVFACGGGVVEMPEARKLLTDYHKTKGNVLLLMRDIKKIMDFLSI---DK
ARO1_ASPFU        -------PTGHVFACGGGVVEIPEARKLLIDWHKTKGNVLLIMRDIKQVMAFLNI---DK
ARO1_AJECG        -------PTGYIFACGGGVVETPEARKLLTQYHKTTGNVILVMRDIKEIMDFLKI---DK
ARO1_PHANO        -------PTGHIFACGGGIVEIPEARKILVDYQKSGGIVLLVSRDINKVVEFLQI---DK
ARO1_NECH7        -------SHGHIFSCGGGLVETPEARQLLKDYGRNGGNVLLIHRDTEQVVEYLMR---DK
I1RK93_GIBZE      -------KTGHVFSCGGGLVETPEARELLNSYGANGGHVLLVHRDTDQVVEYLNR---DK
ARO1_NEUCR        -------PTGHIFSCGGGIVETEAARKMLLSYSQNGGIVLLVHRDTDQVVEYLMR---DK
ARO1_SCLS1        -------PEKHVFACGGGVVEMPEARELLINFHKSGGIVLLVHRDTEQVMDYLRI---DK
D5G8D9_TUBMM      -------PDSYIFACGGGIVETPVARNLLKQYCSSGGIVIHVHRNIERVMEFLSI---DK
ARO1_SCHPO        -------PEGYVAASGGGVIEMDESRNLLSNFVKEGGIVLHVHRNLEHIKSYLSE---DQ
ARO1_PNECA        -------KENYIISCGGGIIETEEARDLLISYIEANGIVIHIHRNIQDIIKYLNT---DK
ARO1_CANAL        -------SKGYVLSTGGGIVEGEDARQQLKSYADNGGIVLHLHRDLDETVTFLAA---DT
ARO1_YEAST        -------DDGYVFSTGGGIVESAESRKALKDFASSGGYVLHLHRDIEETIVFLQS---DP
ARO1_YARLI        -------SEGYVISCGGGVVETPAARDALQTFKGVGGIVLHVHRPVSRILEYLNK---DQ
ARO1_COPC7        VSSPSSYSKNHVISLGGGIVETPAARSLLKAYLAKGGRVVHITRPIDEIVRYLNV---ET
ARO1_CRYNJ        ----EEHRGNHVIALGGGIVETETARETLKAHVAKGGHVVHVTRALEDIEAYLDSIGNTA
ARO1_USTMA        ----ARHPSGALISLGGGVVETEACRQILAEYAQTKGPVIYIVRDTNAIVKFLAT----S
E3KTD2_PUCGT      ----KEFPSRHVISLGGGIVETEKGRKMLMDYANSKGPVVEIIRPVEEVIAYLNE---DG
F4PAP8_BATDJ      ----VTYPTGAVIASGGGIVETPDARSALENWS---GTVIHIRRDIDEVEAYLGV---DT
I1CAL1_RHIO9      ------YARDHVISCGGGIVETAENRELLKKHHSNGGKVLHLVRDLDQVVKYLNR---DK
I7MKQ2_TETTS      ---LQKKYKNTIIACGGGIITIPEARELLRKQK----YVIWLRRDFADIQKDFDK---RQ
                             : : ***::        *         :: : *        :       

D0NXA2_PHYIT      HRPSL--GDSHANVWARREPLYQRSSTFEFVV--------------------NAGDVDYP
H3GHV1_PHYRM      HRPSL--GDSHANVWARREPLYQRSATFEFVV--------------------TAGDVDYP
A9V1N3_MONBE      VRPAY--LEEVAEVYARRQPRFAACADWRFPV--------------------AEGATDLL
ARO1_EMENI        TRPAY--VEDMMGVWLRRKPWFQECSNIQYY-------------------SRDASPSGLA
ARO1_ASPFU        TRPAY--VEDMLGVWLRRKPWFQECSNIQYY-------------------SQHAS-AGLP
ARO1_AJECG        TRPAY--VEDMMSVWLRRKPWYEECSNVQYY-------------------SRLTGLDGMT
ARO1_PHANO        TRPAY--VEDMMGVWLRRKPWYVECSNYRFH-------------------SQAAGSKALA
ARO1_NECH7        TRPAY--TSEIREVYLRRKDFYQECSNLLYYS------------------PHSESSGSKS
I1RK93_GIBZE      TRPAY--TSEILQVYLRRKDFYNECSTHLYYS------------------PHSESSGRQS
ARO1_NEUCR        SRPAY--SENIREVYYRRKPFFEECSNFRYYS------------------PHPDGSKALT
ARO1_SCLS1        TRPAY--VEDMMGVYSRRKPWFNECSNFQYHS------------------KGS-GASALS
D5G8D9_TUBMM      TRPAY--VEDMVGVWNRRKPWYTECSNYQYY-------------------SPIVSESDLA
ARO1_SCHPO        TRPTYKDQESIDDVYKRRHVWYRECRSHYF------------------ISPVLSNQVIDE
ARO1_PNECA        TRAPY--QDNIMHVWERRKRWYNLCSSHQFHMTS--------------TDPTEFKKNIPL
ARO1_CANAL        TRPAY--SSEVQEVWLRREKWYHECSNYHFYS------------------SHCSTEDEFN
ARO1_YEAST        SRPAY--VEEIREVWNRREGWYKECSNFSFFA------------------PHCSAEAEFQ
ARO1_YARLI        SRPAF--VDDLEAVWQRRKELYRSVSSNVFFA------------------PHCDSAEATA
ARO1_COPC7        ARPAY--EEPILDVWKRREPWYKECSGWEFGNVVVEAPQGQAQAANVEAGPGKTKCVKTL
ARO1_CRYNJ        VRPNW--GETFADVFKRREPWYQACSSHEFYNVL-------------EAVGGQTHEEHTK
ARO1_USTMA        DRPAY--GEPVMDVYRRRNPWFSECSSAELVSYS-EGESLAIQPCAMNVPDPSFTIQKKF
E3KTD2_PUCGT      NRPSL--GESIEQIWARREPWYRLCSNSEYFNLV-------------HPTIDHALISEVQ
F4PAP8_BATDJ      TRPSF--GQDVRSVFARRAPLYTECSSAEFVIPT---------------SLNQANAAYWN
I1CAL1_RHIO9      TRPMF--GEDMLNVWRRRRAWYKEVCNYEFIAYA-----------ASLLENGYVSPTEWV
I7MKQ2_TETTS      NTPDY--QNTLKGDYEQRRPYYEQVSNFIFNFPG-----------YTFFSKSIGEKEYWK
                    .     .     : :*   :                                      

D0NXA2_PHYIT      RIDRDFVRFLSVVIPGLPTSF----DYRSSCRSDTFFLSLTFPDLNDA-------HSLID
H3GHV1_PHYRM      RLDRDFVRFLSVITPGLPTNF----DYRSSCRADTFFLSLTFPDMNDA-------RPIIS
A9V1N3_MONBE      CWKQHFGRLCA-----LATGL----SPRVPAWVYSKFVCLTQPDVRAVP------AAQLA
ARO1_EMENI        RASEDFNRFLQVATGQIDS------LSIIKEKEHSFFASLTLPDLREA-------GDILE
ARO1_ASPFU        RASEDFARFIKFVTGLDDS------LGTIKKKQHSFFVSLTLPDVRGA-------DQILE
ARO1_AJECG        QVSGGFNRFLKVITGEVDS------LAKMRRKENTFFVSLTLPDLSLA-------AHILK
ARO1_PHANO        HTQTEIGRFLNIITGRTST------LQDIKKKKQSFFVCLSAPNLEPC-------AKDLP
ARO1_NECH7        EIPCDFQQFVSSISGRSTH------LKDVMEKDHSFFVSLTVPDVSEA-------ASLIP
I1RK93_GIBZE      HIPHDFRQFVHSIAGKTTH------FKDVLDKDHSFFVSLTVPDVDQA-------VNLLP
ARO1_NEUCR        EPPFDFSQFLSVICGHSNH------LEEVKKKPHSFFVSLTVPNVSKA-------LDIIP
ARO1_SCLS1        VAEQDFARFLHHISGKSLH------FDEMRNKPQSFFVSLTMPDISGA-------AYILP
D5G8D9_TUBMM      IAQADFSRFLAIVTGNSDY------HERLLKKTRSFFVSLTFPNLEEV-------TGAIN
ARO1_SCHPO        KIQYSMSRFLDVVTGSSQV------LQKFKTKKRSTFLTLNYPRIEDA-------LPTLR
ARO1_PNECA        NLKSSFNNFLRTITGKNNI------FSLILKKKRSYFLSLAFSDLENI-------FSLLD
ARO1_CANAL        HLRRSFVNYIKLITGAERP------VVPAGR---SAAVVLTSPDLNEV-------VGDLE
ARO1_YEAST        ALRRSFSKYIATITGVREI------EIPSGR---SAFVCLTFDDLTEQ-------TENLT
ARO1_YARLI        KVQQMLGAFLDRVTGKSEF------VIPHKDQ-FTSFLSLTFPDVSIA-------ATMLP
ARO1_COPC7        AGRNEVKRFFGHLAGINPNFTHGGSVEGQ--QRRTYFLCLTYPDVRHA-------FPYID
ARO1_CRYNJ        AMRAECGRFFKFITGRESN----RPRLSV--GNPTSFLSLTFPDVTPA-------LIHLD
ARO1_USTMA        GLETEVARFFKFVVGQDTNQIRDLVVDSRKGGRRTYFLSLTFPDVVPK-------LELIR
E3KTD2_PUCGT      HAKRAMRQFFRFITGVDTN----HVLLDPPVPRNTHFLCLTFPSLSPCREEDKNILDRFE
F4PAP8_BATDJ      KVEQSFMQFLHFKLATTKP------NVNDKSLDTSYFVSLTFPNVVSA-------AALVE
I1CAL1_RHIO9      AIKKDLQRYLNFIWGRDTNQ---VNITPSRVGTPTTFVSLTSKDLSTC-------IEKLV
I7MKQ2_TETTS      RVEKSFKGYIKSIFNKQVRKG---GQDEYLYAEESHFLCLQFEDLQRLT------FADLV
                                                    :    *    :             . 

D0NXA2_PHYIT      DISKGADALELRVDLLKYAEDT-----------KFVAAQVALLRSLST-LPIIFTVRSKV
H3GHV1_PHYRM      DISKGADALELRVDLLKYPQDT-----------KFVAAQVALLRTLSS-LPIIFTVRSKG
A9V1N3_MONBE      EIVANAQAVELRVDLLASLTE------------DYIATQVAAIRSATK-SPIIFTVRTEP
ARO1_EMENI        EVCVGSDAVELRVDLLKDPASNN-----DIPSVDYVVEQLSFLRSRVT-LPIIFTIRTQS
ARO1_ASPFU        QACVGSDAVELRVDLLEDPDSSN-----GIPTVDFVADQISYLRSRIT-LPVIFTIRTKG
ARO1_AJECG        EVTLGSDAVELRVDLLKDPQSDN-----EIPSVDYVAEQISVLRSRTS-VPLVFTIRTKG
ARO1_PHANO        EIVVGADAVELRVDLLEDPEGSE-----GLPTPEFVIEQLTILRNVTT-IPVIFTLRTKA
ARO1_NECH7        EVVVGSDAVELRVDLLQDRS------------VDSVTRQVSILRALAK-KPIVFTLRTVS
I1RK93_GIBZE      EVVVGSDAVELRVDLLQDRS------------IDSVIRQVSTLRASAK-KPIVFTLRTES
ARO1_NEUCR        KVVVGSDAVELRVDLLEDYD------------PEFVAKQVALLRSAAR-IPIVYTVRTVS
ARO1_SCLS1        SVAVGSDAVEVRVDLLEDPSSTN-----GIPGTDFLSVQIAHLRSVVH-LPVIFTVRTVS
D5G8D9_TUBMM      SVTIGSDAVEVRIDLLIDPTDSN-----GVATPAFVSEQLAVLRGKTQ-LPVVFTIRTKS
ARO1_SCHPO        DVTVGCDAIEVRVDYLKDPKSSN-----GISSLDFVAEQISLLRCSTT-LPIIFTIRTIS
ARO1_PNECA        IITAGCDAIEIRIDLFQKPEEID-----KYPSLEYIAEKIFLLRQKTS-LPLIYTLRTTN
ARO1_CANAL        SITIGADAVELRVDLFKDT------------SAEFVAAQIAVIRKHAD-LPIIYTVRTVS
ARO1_YEAST        PICYGCEAVEVRVDHLANY------------SADFVSKQLSILRKATDSIPIIFTVRTMK
ARO1_YARLI        SLSEGCSALELRVDLLNENDEA-------IPSEEYVLSQLAILRQNVD-LPILYTVRTKA
ARO1_COPC7        ELTEGADALELRVDLLKDA--KAPE--APFPSVAYVKDQVTALRRVTG-LPIIYTVRTKA
ARO1_CRYNJ        ELTEGADAVEFRVDLLSTTGQAPTR--PALPPISFVAKQLASLRLATT-LPIVFSVRSKD
ARO1_USTMA        SMESGSDALEFRADLLNPSGQPVTT--PQIPPTEYVKNQLAALRHRTS-LPIVFTVRTHS
E3KTD2_PUCGT      ELTVGCDAVELRVDLLSTSGKAPTS--PSIPPTEFVVKQVAALRRLTT-LPIIYTVRTCS
F4PAP8_BATDJ      QVTEGANAIELRVDLLEST------------KPDFVGSQVAMLRHLSK-LPIVYTVRTQS
I1CAL1_RHIO9      EVCEGADAVELRVDLLKKPEEKE-----GISDIEYVGEQLALLRRTVS-IPVIFTVRSKS
I7MKQ2_TETTS      YIQKNFHALEVRADQFFENNFDNLSFNNNYALLEHFTLVLSRLALICNKLILIFTMRTQE
                      .  *:*.* * :                   .   :  :        :::::*:  

D0NXA2_PHYIT      QGGAFPDGEEHEKKMFELLQLGVRLGCEFVDMETCW-SRK-----AREQLLAHRHRSAII
H3GHV1_PHYRM      QGGAFPDGEENELKMFELLQLGVRLGCEFVDMETCW-SRK-----AREHLLAHRYRSAII
A9V1N3_MONBE      QGGRYAGSPA---KYAALLRVGIRLGCEIVDVEADLPSDE-----LRQLTRLVPASTTLL
ARO1_EMENI        QGGRFPDNAHD--AALELYRLAFRSGCEFVDLEIAFPEDM-----LRAVTEMKGFSKIIA
ARO1_ASPFU        QGGRFPDDAHA--EAMQLYRLAVRSGCEFVDLEIAFPDEM-----LRAVTEMKGYSKIIA
ARO1_AJECG        QGGRFPDDAYD--AALQLYRLAVRMGSEFVDLEISFPEQL-----LRTVTEMKGFSKIIT
ARO1_PHANO        QGGKFPDEAYA--EARSLYQSAIRLGCEFVDLEMTMPEEV-----LREVSETRGFTEIIA
ARO1_NECH7        QGGKFPDEAYE--EGLELYRLALRMGMEYVDVEMTLPENI-----IQTVTESRGHSRIIA
I1RK93_GIBZE      QGGKFPDSAYD--EGLELYRLAVRMGMEYIDVEMTLPDEM-----IKTVTESRGYSRIIA
ARO1_NEUCR        QGGKFPDDDYE--LALKLYRTGLQAGVEYLDLEMTMPDEV-----IEAVTNEKGYTHIIA
ARO1_SCLS1        QGGRFPDAAHE--EALKLYKLAVKMGIEYIDLEIAFPDEL-----LQEVTEAKGFSRIIA
D5G8D9_TUBMM      QGGKFPDEDHQ--RALELYLAGIRMGLEYIDLETTWPVAL-----LEKVTSGKGYSKIIA
ARO1_SCHPO        QGGLFPNDKEE--EAKELMLSAMRYGCDFVDVELGWSSET-----INILYQHKGYTKLIM
ARO1_PNECA        HGGSFLSSEKK--LAKEYILHGAKWGFEFLDIELDIASEL-----FKTINNSWPYTKIIA
ARO1_CANAL        QGGKFPDENVD--ELKSLLLLGIRLGVAYVDLQLTAPNEL-----IEEISSKKGFTRVIG
ARO1_YEAST        QGGNFPDEEFK--TLRELYDIALKNGVEFLDLELTLPTDI-----QYEVINKRGNTKIIG
ARO1_YARLI        QGGRFPDDKPV--ELANLVNLGLKTAVELLDVELTYPAEL-----VSSVGASRGYTKLLG
ARO1_COPC7        QGGAFPDGNAK--EYKELVEAGVRLGVEYLDVEVASIFSDKEVADLSKRTKKAGSTLVIA
ARO1_CRYNJ        QGGMVPSDNAE--AYGALVRLGLRCACEYVDLEVCWPEQL-----LDSIVQLKRETHIIA
ARO1_USTMA        QGGMFPDGKQH--EYFELISLALRHACEYIDLELGWDDDL-----LSAVVQAKGNSQIIA
E3KTD2_PUCGT      QGGMFPDGQPE--EWCKLAAMGFRTGCEYVDIELGLSPEQ-----QKALCSQKGHSKIIA
F4PAP8_BATDJ      QGGRFPDDKTR--DMISLLELGIRLGCEYIDVEFTAPFER-----FSSITKSKGNSLIIG
I1CAL1_RHIO9      QAGAFSDNDEE--GMFELLRWGQRWGCEYIDVEICWNAQT-----IEKLVAQKEESLIIS
I7MKQ2_TETTS      EGGLLQKTKNNYYQIINYIQRQNIFNYIDIEVDMIKRENS------INMKLIQQQNALIL
                  ..*                          ::::                         : 

D0NXA2_PHYIT      SSFHAVQKPTSEAEAKAIFRECYSQGRVQIVKVVVKAYS-PVDALMVDRVAKDFASAWQQ
H3GHV1_PHYRM      SSFHAVQKPTSEAETKLIFRECYSQGRVQIVKVVVKAYS-PQDALMVDRVAKDFANAWQQ
A9V1N3_MONBE      GSLHFLRPCGGAQELTAALHNCALGGRADLLKVIFTADT-PGDALALVEAYRVLRGTLSR
ARO1_EMENI        SHHDPKGELSWANMS-WIKFYNKALEYGDIIKLVGVARN-IDDNTALRKFKNWAAEAHDV
ARO1_ASPFU        SHHDPNGELSWANMS-WMKYYNRALEYGDVIKLVGVARN-LDDNTALRKFKNWAEEAHDV
ARO1_AJECG        SHHDPKGQLSWVNGS-WIQFYNKALQYGDVIKLVGVARS-IDDNISLKKFKTWAEEKHNV
ARO1_PHANO        SHHDPKGELSWTNGS-WMKYYNRALQYGTVIKLVGVAKS-LQDNFALAEFKSWAETAHPT
ARO1_NECH7        SHHDPQGTMSWKNAS-WIPFYNRALQFGDIIKLVGVARS-SEDNFDLAKFKSRMQEAQKT
I1RK93_GIBZE      SHHDPKGTMSWKNAS-WIQYYNRALQYGDIIKLVGIART-PEDNFDLARFKSRMQEAQKT
ARO1_NEUCR        SHHDPKATLSWKNGG-WIQYYNKALQHGDVVKLVGVARE-LADNFALARFKASLAAAHDK
ARO1_SCLS1        SHHDPQGTLSWKNGG-WFQHYNRALQYGDIIKLVGSAKS-IEDNFALAKFKKTMAAAHDT
D5G8D9_TUBMM      SHHDLGGDLCWRNAS-WISKFNMTLKYGDVIKLIGQAKS-IQDNYDLENFRKYAAT-HET
ARO1_SCHPO        SWHDLSGTWSWARPHEWMQKVELASSYADVIKLVGMANN-LNDNLELEEFRTRITNSMDI
ARO1_PNECA        SYHNIEKPIS-CDDFEWIQKYKEAQHYGHIIKLVGTSSS-IEDNFFLEEFKSKFINK-KV
ARO1_CANAL        TYQDINGELKWNNVEWKNKYNQGVSMNADIVRLVGKANS-IQDNLDLENFKKQNTLK---
ARO1_YEAST        SHHDFQGLYSWDDAEWENRFNQALTLDVDVVKFVGTAVN-FEDNLRLEHFRDTHKNK---
ARO1_YARLI        SHHDFPGALNWSSLEWENMYARAEAVPVDVVKLVGMAKS-FSDNFALENFREAHTSS---
ARO1_COPC7        SWHDWSGKMQWDGED-VKRKYDEARKFGDLVKIVGKAEK-LEDNFKLLSFVKSATSLPN-
ARO1_CRYNJ        SWHDWTGDMAWDGEE-MKAKHVLCEKYGDVAKIVGTAKS-GLDNAKLAIFVGEVQSHPG-
ARO1_USTMA        SWHDWSGRLDWESES-TAKIYEKACRFGDIAKIIGKATT-MEDNYSLERFRAKVSATA--
E3KTD2_PUCGT      SYHDFSGRLKWDSSE-MIQRYHELKAYGDMVKLVSRAADGLEDNLAMLEFRKKHATLQKD
F4PAP8_BATDJ      SYHDCRGVALWTDVC-MLDIYQDLYAHSDCIKLIGVAHN-IADSIAVSTFRNQFVPKLGL
I1CAL1_RHIO9      SWHDVQKVTPWDGKA-IETKYELAAKYGDIIKLVGVAET-IQDNFKLETFRASKQDGKN-
I7MKQ2_TETTS      SKHFINHQDQQENIQTTIQQMKENMREQDILKLVLCSFT---NYEELETIRRQLTSINPK
                                                 :.:  :     :   :             

D0NXA2_PHYIT      H-MPIISLCTTEAGKLTRVLNRTLTPVTHPLLP-AAAAPGQLSIEEIMTLRKQLGLLPAR
H3GHV1_PHYRM      Q-MPIISLCTTEAGKLTRVLNRTLTPVTHPLLP-AAAAPGQLSIEEIMILRKQLGLLPAR
A9V1N3_MONBE      ---PAIVMAMGQAGKLTRVLNDQLTPVTHRLLT-TAAAPGQLTAQQLDDMRAELGLFPKR
ARO1_EMENI        ---PLIAINMGDQGQLSRILNGFMTPVSHPSLP-FKAAPGQLSATEIRKGLSLMGEIKPK
ARO1_ASPFU        ---PLIAINMGGNGQLSRILNGFMTPVSHPALP-FRAAPGQLSATDIRKGLSLMGEIKKK
ARO1_AJECG        ---PIIAINMGDKGQLSRMLNGFMTPVSHPSLP-FKAAPGQLSAREIRKGLSLIGEIKAK
ARO1_PHANO        ---PLIAINMGEHGKLSRILNGFMAPVSHPLLP-SATAPGQLSAADIRRGLSLMGEIPTK
ARO1_NECH7        ---PMIAMNMGKAGKLSRVLNKFLTPVSHPALP-FKAAPGQMSAAEIRRGLALLGDLDPC
I1RK93_GIBZE      ---PMISMNMGKAGKLSRVLNRFLTPVSHPALP-FKAAPGQMSAAEIRQALALLGDLEPH
ARO1_NEUCR        ---PLIALNMGAAGKLSRVLNGFLTPVSHPALP-SKAAPGQLSAAEIRQALALIGELEPR
ARO1_SCLS1        ---PLIAINMGVTGKLSRVLNGFMTPVSHPSLP-FKAAPGQLSAAEIRSTLSTLGEIEPK
D5G8D9_TUBMM      ---RMIALNMGEKGKLSRILNTFLTPVTHPALP-FKAAPGQLSTVEIHQALSLMGMLETK
ARO1_SCHPO        ---PLILFNMGRFGQLSRILNKFMTPVTHPLLP-SKAAPGQLTVKQLNEARVLIGEILPE
ARO1_PNECA        ---PSIIINTGIKGQLSRIMNTFMTPVTHPSLP-SKIAPGQLSIKEINTALHIMGLLPEK
ARO1_CANAL        ---PLIAFNLGSQGKLSQVLNGTFTPISHKLLP-NDEE--FLTIGELNQTYFDIGGFTAK
ARO1_YEAST        ---PLIAVNMTSKGSISRVLNNVLTPVTSDLLP-NSAAPGQLTVAQINKMYTSMGGIEPK
ARO1_YARLI        ---PLLAINMGSHGQLSRVTNTLLTPVTHADLP-VAAAPGQLSVEEINQTRSTIGMFNKN
ARO1_COPC7        -SPPIIAINMSTLGQSSRILNTTFTPVSHPLLP-TKAAPGQLSFKQIQQALHLLGLLPSK
ARO1_CRYNJ        -AKPLLAINMGAAGQLSRILNPILTPVTHDALP-SRAAPGQLTAREILQARALTGSLPAK
ARO1_USTMA        -TKPLLAVNMGSVGQLSRIVNPVFTPITHEAMP-FKAAPGQLSFRQVQTALSLIGQADAR
E3KTD2_PUCGT      -RQSLITINMGRSGQMSRILSPVLSPTTHPLLPGPPAAPGQLSFRQIQTAQGLLGQIIPK
F4PAP8_BATDJ      APKPLIALAMGPLGQLSRVLNTYLTPVTHASMP-MLAAPGQLTISQIHSIRHLIGMLPKK
I1CAL1_RHIO9      ----LIAINMGAAGQLSRVLNECLTPVTHPALP-QKAAPGQLSLAEINKTRHLIGLLPAQ
I7MKQ2_TETTS      ----SIIIQLGKSGKLSRVQNKYLTPVYDAKFG-PPTGQGQLQKSEILQLIQELNLSSHE
                       : .     *. ::: .  ::*     :         :   ::       .     

D0NXA2_PHYIT      -EFFLFGSPIQKSPSPAMHNAGFESTSLASLFTYGLHDTTDVVEIVKRMQVP--NTNFGG
H3GHV1_PHYRM      -EFFLFGSPIQKSPSPAMHNAGFESTSLSSLFTYGLHDTTDVLEIVKRMQAP--DTCFGG
A9V1N3_MONBE      -NFFLFGEPIALSASPLMHNTVFADLKLP--YTYQRCSTSNALDAITCLQ----GTNCGG
ARO1_EMENI        -KFAIFGSPISQSRSPALHNTLFAQVGLP--HNYTRLETTNAQDVQEFIRS----PDFGG
ARO1_ASPFU        -RFALFGSPISESRSPALHNTLFAEMGLP--HEYTRLETANVEDVKDFIRA----PDFGG
ARO1_AJECG        -KFAVIGNPVSASRSPAMHNTLFRQMGLP--HTYGTLETDNPEVAKEFIRS----PGFGG
ARO1_PHANO        -KFCIFGSPISQSPSPRLHNRLFRETGLP--HTYGLHETTDASSIRDIIRA----PDFGG
ARO1_NECH7        -NFYLFGKPISASRSPALHNTLFGQTGLP--HQYHRLETDNIQDVREVLQA----PDFGG
I1RK93_GIBZE      -NFYLFGKPISASRSPALHNTLFKQTGLP--HQYHRLETDNIEDVRDVLKS----PDFGG
ARO1_NEUCR        -SFHLFGNPISASRSPALHNALFRDNGLP--HQYSLFETDNAADVKDLIRA----PGFGG
ARO1_SCLS1        -SFYLFGTPISQSRSPALHNTLFKQTGLP--HRYSRLETDRVADVQDVIRA----PDFGG
D5G8D9_TUBMM      -KFYIFGTPLSHSRSPALHNTLFQSLGLP--HTYHLFESADVSATKEIMNT----ENFGG
ARO1_SCHPO        -KFFLFGKPIKHSRSPILHSTAYELLGLP--HTYEAFETDTVDEVQKVLNL----PDFGG
ARO1_PNECA        -KYFLFGKPIKHSQSPNIHNLGFEILGLP--YKYQLFETDSISELKEILHL----EEFGG
ARO1_CANAL        -KFWVIGSPIEHSRSPNLHNAGYKALNLP--YQFGRFEATDVDVVYDNLIN---KPDFGG
ARO1_YEAST        -ELFVVGKPIGHSRSPILHNTGYEILGLP--HKFDKFETESAQLVKEKLLDG--NKNFGG
ARO1_YARLI        LSFFIVGTPIGHSKSPILHNTMFKKLGLP--YEYSRFKTDDAAAVNAKARALLAQGNLGG
ARO1_COPC7        -HFHLFGTPIAHSMSPTLHNTGFELLGLP--FKYGLLESKEVDC-KEVRDVISDKEGFGG
ARO1_CRYNJ        -KFVLFGSPIAHSVSPLLHNAGFATLGLP--HTYRLHESEKVD--QGVLEVIRSPD-FGG
ARO1_USTMA        -RFALFGSPIGHSLSPLLHNTGFAALGLP--HQYELLESTEIN--DAVAAFVRSPD-FGG
E3KTD2_PUCGT      -QFWLFGAPIGQSRSPLIHGTGFDTLGLEG-YRYQKCETSSVTD-STVLEKIHASD-FGG
F4PAP8_BATDJ      -EYYLFGKPISESMSPVLHNTGFKQLGLP--HHYSLLETDSIDRVREVVQQGKLDGTFGG
I1CAL1_RHIO9      -SFWLIGTPIQHSMSPTLHNTGFQTLGLP--HHYGLLECHMVEYAEDAILK---DPSFGG
I7MKQ2_TETTS      KKFYLFGTDIMNSPSPFIHNTCFQSLSLTT-YQYELAQISSIEDFQQYINR----QDFQG
                      :.*  :  * ** :*.  :    *   . :   .                     *

D0NXA2_PHYIT      GSVTIPFKVDIME--HLDELSPAARAIGAVNTVMRQD---------RNGSPYWKGDNTDW
H3GHV1_PHYRM      GSVTIPLKVDIMA--HLNELSPAARAIGAVNTIMRED---------RNGSPYWKGDNTDW
A9V1N3_MONBE      GSVTMPLKERLGH--VLVDVDVPGRVIGAVNTIVKDS---------QGQ---LHGFNTDY
ARO1_EMENI        ASVTIPLKLDIMP--LLDEVAAEAEIIGAVNTII------PVSTGKNTP-SRLVGRNTDW
ARO1_ASPFU        ASVTIPLKLDIMP--LLDEITAEAEIIGAVNTVV------PVSDGEGKP-QRLVGHNTDW
ARO1_AJECG        ASVTIPLKISIMP--LLDEIAPEAMSIGAVNTIVCAP---PAPDGKSQT-PRLIGHNTDW
ARO1_PHANO        ASVTIPLKQDVRP--LIDGVGPEVEAIGALNTIVPEV---SIDESTGKEITRLIGRNTDY
ARO1_NECH7        ASVTIPLKLDVMG--QVDELSEAARTIGAVNTVV------PIGKADASDRRRLLGDNTDW
I1RK93_GIBZE      ASVTIPLKLDIMG--KLDELSDAARTIGAVNTVV------PFGKPDDNGCRRLLGDNTDW
ARO1_NEUCR        ASVTIPLKLDIMP--LLDEVSDAAKVIGAVNTII------PVRNGDKVTLR---GDNTDW
ARO1_SCLS1        ASVTIPLKLDIIP--LLDSVTDAVKVIGAVNTII------PTPDNPP----RLVGENTDW
D5G8D9_TUBMM      ASVTIPHKISIIP--LLSSISAHAQAIGAVNTVI------PVTTEDGTR--RLTGDNFDW
ARO1_SCHPO        ANVTIPYKLSVMK--FMDELSDEARFFGAVNTII---------PIRIGDKLVLRGDNTDW
ARO1_PNECA        ASVTIPLKTNISI--LLDEISDHAALIGSVNTIT---------RTYNNGQYILKGENTDW
ARO1_CANAL        LAITMPLKLDIMK--FATKLSDAAETIGAVNTLIP------------IEGGYF-GDNTDW
ARO1_YEAST        AAVTIPLKLDIMQ--YMDELTDAAKVIGAVNTVIP------------LGNKKFKGDNTDW
ARO1_YARLI        ISVTIPLKQDIIP--FLDEVSPLAQQIGAVNTIIP------------GPNGTLKGDNTDI
ARO1_COPC7        ASVTIPFKVDVIE--LLDELTESAKEIGAVNTIIPVHRSSINAQGQEETTRVLVGDNTDW
ARO1_CRYNJ        ASVTIPLKLDIIP--HLDSVSEDAKIIGAVNTVIP--------RGGK-----LHGENTDW
ARO1_USTMA        ASVTIPHKLNIIK--LLDEVTDEAKTIGAVNTIIPI-------RDAQGVVTSLVGDNTDW
E3KTD2_PUCGT      ASVTIPLKVEIIK--YLDQLTPDAQAVGAVNTIVPVS--------QRNGKIKLLGANTDW
F4PAP8_BATDJ      ASVTIPLKIDVIQSGIATRICSAAKQIGAVNTLHMQA------------DGEIVGHNTDW
I1CAL1_RHIO9      ASVTIPHKVSVMK--YLDEVTENAKMIGAVNTVFVRE-----TVVNGEKKRQFIGENTDY
I7MKQ2_TETTS      ASITMPFKLEVSK--YVDHVIGDAQLIGIDSPVIN---------TIVKLNSKIYGFNTDW
                    :*:* *  :        :      .*  ..:                     * * * 

D0NXA2_PHYIT      LGILRPITKRLATLSVKK-----PAHELTALVVGAGGTSMAASYAMRQLGV-GKLFVFNR
H3GHV1_PHYRM      LGILRPISKRLATLSVRK-----PAHELTALVVGAGGTSMAASYAMRQLGV-GKLFIFNR
A9V1N3_MONBE      LGILAALRDAGA-----------PSAPRAALVLGAGGTARAAVYALQQLGC-HRIVVVNR
ARO1_EMENI        QGMILSLRKAGVYGPKRK------DQEQSALVVGGGGTARAAIYALHNMGY-SPIYIVGR
ARO1_ASPFU        QGMVQCLRNAGAYGA---------DGSASALVVGGGGTSRAAIYALHQMGF-SPIYIVGR
ARO1_AJECG        QGMVRCLSDAGAYAAATP------TTASAGLVIGGGGTARAAIFALQNMGY-SPIYVLGR
ARO1_PHANO        LGMILILRNTGAHGV------------GAGLVIGGGGTSRAAIYALKEMGY-GPIYLLGR
ARO1_NECH7        RGMVHALRDEGVEEQADS------ETKGAAMVVGSGGTTRAAIFALHSLGF-GPIYIAAR
I1RK93_GIBZE      RGMVHALRHAGIQGQ-DT------DNKGAAMVVGSGGTTRAAIFALHSLGF-GPIYIAAR
ARO1_NEUCR        MGMVYALRNAGVVKC-TK------ESPTAGMVVGAGGTTRAAVHALHDLGF-APIYVVAR
ARO1_SCLS1        LGMTHSLMSASHTPS-PV------DSPSPALVIGAGGTARAAIYALHSLGH-SPIYMVAR
D5G8D9_TUBMM      VGIQNSLRIGGATEP-EG------HSTATALVIGAGGTSRAAVYALHMMGY-GRIYVVNR
ARO1_SCHPO        RGIYDTFAN--ALD-GVS------LRDTNGLVIGAGGTSRAAIYSLHRLGV-SRIYLLNR
ARO1_PNECA        QGIIKAIKN--FNKFEKS------FENFSGFIIGAGGASRAAIYALLSLGI-SPIYLINR
ARO1_CANAL        VGISNSFIRAGVPP----------KSSSNGLVVGAGGTSRAAIYALHQMGC-AKIYLVNR
ARO1_YEAST        LGIRNALINNGVPEY---------VGHTAGLVIGAGGTSRAALYALHSLGC-KKIFIINR
ARO1_YARLI        LGLVNALTRFGANS----------LDKKTALIVGAGGTSLAAVHGLRSLGF-AKILIANR
ARO1_COPC7        VGIRVCITQRVSEGELRN-------ENTSGLVIGAGGTARAAIYALQDLGV-PVIYLFNR
ARO1_CRYNJ        QAIHQAAAQNLDADALSY-------GSSTALVIGAGGTCRAAIYAMHKLRF-KTIYLFNR
ARO1_USTMA        IAIETLARRSLRTVHLAD-------PNLTGLVIGAGGSARAALFALYRLGV-KRILLFNR
E3KTD2_PUCGT      EAIKTKIEANLPAQQALGLITPSQLVRAAGVVIGAGGTARAAVYALHSLGY-EQIYIHNR
F4PAP8_BATDJ      IGIKQCIQRHLGVSCSRK---------VVGIVLGAGGTARAACYALSQISYIQQVRVWNR
I1CAL1_RHIO9      LGMKHRIQALMMDPNNPP---------EEGLVIGAGGTARAALYTMQKMGI-QKIYLWNR
I7MKQ2_TETTS      YGILKPLKKQLSLNEHYMQ-----SKQKFALVIGAGATTLTMVYCLNMLGF--QTLIYNR
                   .:                          ..::*.*.:  :  . :  :       :  *

D0NXA2_PHYIT      TLNKAQAVAARFEAEALSELTPETLA-------------RVDVVVGTIPAQAGFQLP---
H3GHV1_PHYRM      TLEKAQAVAARFDAEALSELTPETLA-------------QVDVVVGTIPAQAGFQLP---
A9V1N3_MONBE      TAERALALAEQFRVEHAADLMASTAY-------------TYDIVVSTVAATANLTVP---
ARO1_EMENI        TPSKLENMVSTFPSSYNIRIVESPS----------SFESVPHVAIGTIPADQPIDPT---
ARO1_ASPFU        NPAKLESMVSTFPTSYNIQIVEGNE----------KLEHVPHVAIGTIPADRPIDPG---
ARO1_AJECG        SPDKLSSMTSTFHTDHDIRILEDVK----------ALESLPTVAIGTIPGDKPIEPH---
ARO1_PHANO        NAHKIEALKSDFPSSYNLQVITSPEQ-VS------SLDAMPTVAIGTVPADQPLDPT---
ARO1_NECH7        NQAKVDALAADFPAEYQLQGLSQPSD-AD------KVSSNLNVVISTIPADRPIDPS---
I1RK93_GIBZE      NQEKADAIAADFPKEYQLEGLSRASD-AE------KVSENLKVVISTIPADRPIDPT---
ARO1_NEUCR        NADRVKALAESFPAEYDIRSLSTPEEVAA------ESTAQPSVVISTIPADKPIDQS---
ARO1_SCLS1        TPSKLDTLINSFPSSFNIIPLPSTTS-AT------ELTTPPAVAISTIPADRPIESN---
D5G8D9_TUBMM      TPENLKSLVEAFPKEYNLMAINSLAE-AK------SVEVKPITAVCTVPADKPIDDA---
ARO1_SCHPO        TLANSYRVQDVFPPDYNIHIIDSDNIPSEE-----LSSVTLSAVVSTIPADIELPEK---
ARO1_PNECA        SKDKLNKLYHFFNTNHIIPITEYHELNN--------INFDIRIGISTIPTDNPIDPS---
ARO1_CANAL        TAAKLEELVKSFPKDYNLEIVETEQQADK-------ASK-VSLAVSCIPADKPLDGE---
ARO1_YEAST        TTSKLKPLIESLPSEFNIIGIESTKSIEE-------IKEHVGVAVSCVPADKPLDDE---
ARO1_YARLI        TLSK----AEAIADKFDNVEAVTLDSFVA-------NKYTPSVIVSCVPATTFSMLD---
ARO1_COPC7        TKEKAEDLAKAFVGGADKKWNGQLVVLDKLGGGWGDVGVAPRVIVSTVPASATALPSAST
ARO1_CRYNJ        TPENAAKVKASFPESYNIAVVTSLSSLPE----------APVVVVSTVPGNSLTL-----
ARO1_USTMA        TLANAEKLAREVPPEWNVSVLTSLDEVAQLSAD-----QSPSVVVSNIPAEGSTL-----
E3KTD2_PUCGT      TRSKAEEVAKAFPSYFGIRVIDSLGFLCSGEEG----VWQPSAIVSAVPAQATRLSD---
F4PAP8_BATDJ      TVHKAADMAKEFKYVAVEELKDLVPIAEPMEDE-----QPLYAIVGTIPSTAQDA-----
I1CAL1_RHIO9      TSSKAYDLQKAFKGFIEIEVIESLEN----------SKIGPGVIISTVPADSGIEIP---
I7MKQ2_TETTS      TYQKIEKFIGRNGVIKGFSSIDDLVLYLKQN-----LHVQLSVIASTVPGKAEIDFR---
                  .  .                                           :.           

D0NXA2_PHYIT      ----------------DHLVAARADG-------SKVVVLDAAYMPPVTPMLAHAHAAG--
H3GHV1_PHYRM      ----------------DHLVAPRADG-------SKVVVLDAAYMPPITPMLAHAHASG--
A9V1N3_MONBE      ----------------EVLLTA-----------SRPVVLDAAYIPYKTALILQAEAAG--
ARO1_EMENI        -------MRETLCHMFERAQEADAEAVKAIE-HAPRILLEMAYKPQVTALMRLASDS---
ARO1_ASPFU        -------MREILCHMFERAQEADADASRTIE-GSPRVLLEMAYKPRVTALMQLAVDA---
ARO1_AJECG        -------MREILCRLFDLCEKANSDTEQARGVSTKRILLEMAYKPSVTSLMQLASDS---
ARO1_PHANO        -------IRETLCAFFEKAKDVKTER------GEERILLEMAYKPPVTALIQLSQDA---
ARO1_NECH7        -------LQELVGALLSRPAVGTER----------RVLLEMAYKPSHTPIMQLADEAG--
I1RK93_GIBZE      -------LQELVGAVLSRPAPAGER----------RVLLEMAYKPSHTPIMQLADDAG--
ARO1_NEUCR        -------MREVIVASLRHPSVADGK----------HVLLEMAYTPRHTPLMQLAEDA---
ARO1_SCLS1        -------MRETLAVLLRHEKKDEGKQ---------RTLLEMAYKPSQTPLMRMAEDA---
D5G8D9_TUBMM      -------LKVILWELLAGGAC-------------AGVLTEMAYKPTVTEVMTLAEGA---
ARO1_SCHPO        -------VASVIKAL--LANKADGG-----------VFLDMAYKPLHTPLMAVASDL---
ARO1_PNECA        -------VLEIAKIFFNLKRKSSEG-----------IFLDMAYGSNTTDLTIIAKAC---
ARO1_CANAL        -------VLKKIERILSNGSEQSAGF--------KPTLLEASYKPRVTPIMKLTEEQY--
ARO1_YEAST        -------LLSKLERFLVKGAH--AAF--------VPTLLEAAYKPSVTPVMTISQDKY--
ARO1_YARLI        -------ESNKLVSAALAASP-------------KGLVLEAAYSAEATPLLKQVMDVE--
ARO1_COPC7        AAIAGQVDKSTNQIVLPADVFAYTSGS--------AVVVDMAYKPAETPLLKLAKELKEE
ARO1_CRYNJ        -------DTFSQGIYLPSEVLSRPKG----------VAIDLAYKPHMTALLHAAE--KKE
ARO1_USTMA        -------DASSRGLIHLPTCMLRNPAG--------GVVIDMSYKPHYTSLLQLAQQVNTN
E3KTD2_PUCGT      -------DPPSDRLEIPRGLFDRPGG---------GVVIEMSYSLGKDSPLLRAVQDLVG
F4PAP8_BATDJ      ---------------LDLDSLFKDGVG--------GVVVEMAYRPRQTKLIMAAQHANQK
I1CAL1_RHIO9      -------------AHLYGGIK--------------GIICDMAYKPRRTKLLLQADRKG--
I7MKQ2_TETTS      ------------------DIMFKYKP----------TIFEASYIPKETSLVQYAKNSG--
                                                         : :*                 

D0NXA2_PHYIT      ----------------GVLCIQGYEMLYEQGIEQ----------------FYRWHKATQV
H3GHV1_PHYRM      ----------------GALCIQGYEMLYEQGIEQ----------------FYRWHKATQV
A9V1N3_MONBE      ----------------CRVA-HGIDMLLHQGLAQ----------------AQLFCGGTTL
ARO1_EMENI        ----------------GWKTIPGLEVLVGQGWYQ----------------FKYWTG-ISP
ARO1_ASPFU        ----------------GWTTIPGLEALIGQGVHQVGLIDLLQMDITDGVQFQHWTG-IRP
ARO1_AJECG        ----------------GWTVLPGLEALVAQGVYQ----------------CEYWTN-ITP
ARO1_PHANO        ----------------GWKTVNGLEVLVGQGVHQ----------------FEYWTG-VKP
ARO1_NECH7        ----------------NWTTVPGLEVLASQGWYQ----------------FELWTG-ITP
I1RK93_GIBZE      ----------------NWTTIPGLEVLSSQGWYQ----------------FELWTG-ITP
ARO1_NEUCR        ----------------HWQTIPGLEVLAAQGWYQ----------------FQLWTG-ITP
ARO1_SCLS1        ----------------GWVAIPGLEVLSAQGWYQ----------------FQKWTS-IQP
D5G8D9_TUBMM      ----------------GWRVVPGLEGLVGQGVAQ----------------FEVFTGGIVP
ARO1_SCHPO        ----------------EWKCCNGLEALVRQGLAS----------------FHLWTGMTAP
ARO1_PNECA        ----------------NWKIIHGLEILLEQGSEQ----------------FLLWTETYIP
ARO1_CANAL        ----------------KWKVIPGVEMLVNQGDRQ----------------FKLHTGFTAP
ARO1_YEAST        ----------------QWHVVPGSQMLVHQGVAQ----------------FEKWTGFKGP
ARO1_YARLI        ----------------GWEFISGLYMLTEQGFEQ----------------FRLWTGIPAP
ARO1_COPC7        GN---------------WACVQGLEVLLEQGYIQ----------------FEKWTGRRCP
ARO1_CRYNJ        G----------------WKVVPGVEILCLQGFKQ----------------FEEWTGKRAP
ARO1_USTMA        HELAIGTNATKAPTRKLWAAVPGITILLEQGCHQ----------------FHRWTGREAP
E3KTD2_PUCGT      -----------------WKSVDGLELLVEQGARQ----------------FQLWTGKHLS
F4PAP8_BATDJ      HSST-------------FACVEGIDVLIEQGYEQ----------------FQLWTGCHPP
I1CAL1_RHIO9      -----------------WSCVEGIEVLISQGIAQ----------------FEIWTGKKAP
I7MKQ2_TETTS      ----------------CYTFVYGLDMLLYQAYLQN----------------LIFTGKKVF
                                        *   *  *.  .                          

D0NXA2_PHYIT      WTVNEE------------------------AIKEACRQHVPVDQRLSEA-----------
H3GHV1_PHYRM      WVVNEE------------------------AIKEACRQHVPIDQRLSQA-----------
A9V1N3_MONBE      SSELQK------------------------KVWARVHACYQAMLAMEPAERVMPNI----
ARO1_EMENI        LYESAR-----------------------ACSSPLI------------------------
ARO1_ASPFU        LYERAR-----------------------VCCDILLSGRTMLTCS---------------
ARO1_AJECG        VYEYAR-----------------------NAVMGVSPSEDIL------------------
ARO1_PHANO        LYSVARLQLLSHHRLPRYSHLNSNYSNHSAHCSTVPAKTSILPYHRPLYTLAFVIKLHGL
ARO1_NECH7        LYRDAR-----------------------SAVLGL-------------------------
I1RK93_GIBZE      LYKDAR-----------------------AAVLGE-------------------------
ARO1_NEUCR        IYTDAQ-----------------------AAVMGN-------------------------
ARO1_SCLS1        LYVDAR-----------------------AAVMGDSTA----------------------
D5G8D9_TUBMM      EYGAAR-----------------------AAVLGV-------------------------
ARO1_SCHPO        FDAVYQ------------------------KVIE--------------------------
ARO1_PNECA        YNQVKY------------------------AILGPNK-----------------------
ARO1_CANAL        YEIIHR------------------------AVVEE-------------------------
ARO1_YEAST        FKAIFD------------------------AVTKE-------------------------
ARO1_YARLI        KEVGEK------------------------AVLGN-------------------------
ARO1_COPC7        KEQVST------------------------RVWEKYGEV---------------------
ARO1_CRYNJ        QKKMRK------------------------AVLDKYFA----------------------
ARO1_USTMA        RAQIEA------------------------AAWDVYLQRC--------------------
E3KTD2_PUCGT      MKIVSQ------------------------AVYQEASSD---------------------
F4PAP8_BATDJ      HAVMSE------------------------AVYTNYR-----------------------
I1CAL1_RHIO9      NHRIEE------------------------EVLRRYEL----------------------
I7MKQ2_TETTS      RKQIQD------------------------STQNYYKKLHCTQD----------------
                                                                              

D0NXA2_PHYIT      --------------------------
H3GHV1_PHYRM      --------------------------
A9V1N3_MONBE      --------------------------
ARO1_EMENI        --------------------------
ARO1_ASPFU        --------------------------
ARO1_AJECG        --------------------------
ARO1_PHANO        VAHCRTLRDAFSFSVFLTYSWSLGDW
ARO1_NECH7        --------------------------
I1RK93_GIBZE      --------------------------
ARO1_NEUCR        --------------------------
ARO1_SCLS1        --------------------------
D5G8D9_TUBMM      --------------------------
ARO1_SCHPO        --------------------------
ARO1_PNECA        --------------------------
ARO1_CANAL        --------------------------
ARO1_YEAST        --------------------------
ARO1_YARLI        --------------------------
ARO1_COPC7        --------------------------
ARO1_CRYNJ        --------------------------
ARO1_USTMA        --------------------------
E3KTD2_PUCGT      --------------------------
F4PAP8_BATDJ      --------------------------
I1CAL1_RHIO9      --------------------------
I7MKQ2_TETTS      --------------------------