CLUSTAL format seed alignment for MF_03152

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRM5_HUMAN        --------------------MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQ
TRM5_MACMU        --------------------MVLWILWRPFGFSRRLLKLERHSITESKSLIPLAWTSLTQ
TRM5_BOVIN        ----------------------MRSLLKQFAFSRRLLKVESCRITESASLILLPWASLIQ
TRM5_MOUSE        ----------------------MRIVWKLFGFSRRLLQVEWCHPSES-----ILLFTLVP
TRM5_XENTR        -----------------------MRIRRILYFYGNLPNTYTANVLRRLAFSCWHTHQLPP
TRM5_DANRE        ----------------------MAAVWRRSARLFILLQRHHSCTFTSQNLNHFMRSQ---
TRM5_CIOIN        ---------------------------MVIAYIRNLIRKVIQR-----------------
TRM5_ANODA        ------------------------------------------------------------
TRM5_ANOGA        ------------------------------------------------------MIITTK
TRM5_AEDAE        ------------------------------------------------------------
TRM5_DROME        ------------------------------------------------------------
TRM5_DROPS        ------------------------------------------------------------
TRM5_PEDHC        ------------------------------------------------------------
TRM5_EMENI        ------------------------------------------------------------
TRM5_ASPFU        ------------------------------------------------------------
TRM5_PHANO        ------------------------------------------------------------
I1RCE4_GIBZE      ------------------------------------------------------------
TRM5_NECH7        ------------------------------------------------------------
TRM5_NEUCR        ------------------------------------------------------------
TRM5_TUBMM        ------------------------------------------------------------
TRM5_AJECG        ------------------------------------------------------MEEAAT
TRM5_CANAL        ------------------------------------------------------------
TRM5_CANAW        ------------------------------------------------------------
TRM5_YEAST        ------------------------------------------------------------
TRM5_YARLI        ------------------------------------------------------------
TRM5_SCHPO        ------------------------------------------------------------
TRM5_COPC7        ------------------------------------------------------------
TRM5_CRYNJ        -----------------------------------MLKSLCFVIRPAIVSRPQFRLPTIA
TRM5_PUCGT        ------------------MEEELICRGFDSVEVLFVDVFEKSRLSVGGDGERMLQTPQTG
TRM5_LEIIN        ----------------------------MPAKQSRSTAESR-----TAPHSYRERVNSTV
TRM5_LEIMA        ----------------------------MSAKQDGSTAESR-----KAPHSYRERVNSTV
TRM5_LEIBR        ----------------------------MSARPTDASMEPR-----AVPHSYRKRVHSTV
TRM51_TRYCC       ----------------------------MSGEERHQGKGEKGPMDHDEPPSYRTRVEASV
TRM52_TRYCC       ----------------------------MSGEERHQGGGEKGPMDHDEPPSYRTRVEASV
TRM5_DICDI        ------------------------------------------------------------
TRM5_POLPP        ------------------------------------------------------------
TRM5_BATDJ        ------------------------------------------------------------
TRM5_PHYIT        ------------------------------------------------------------
TRM52_ARATH       ------------------------------------------------------------
TRM51_VITVI       ------------------------------------------------------------
TRM5_ENTHI        ------------------------------------------------------------
TRM51_ARATH       ------------------------------------------------------------
TRM52_VITVI       ------------------------------------------------------------
TRM5_SORBI        ------------------------------------------------------------
TRM5_PHYPA        ------------------------------------------------------------
TRM5_TRIVA        ------------------------------------------------------------
TRM51_PHATC       ------------------------------------------------------------
TRM5_THAPS        ------------------------------------------------------------
TRM5_PLAKH        ---MFYGFLLLYPLLSLCLEHVISLSKKGKPTLGFVIMRNAVDIKTLSDVKDRVKNEKRT
TRM5_PLAVS        -------------------------------------MRNAVDIKTLADVKEKVKHEKRT
TRM5_PLAF7        MFFKALFLSLYLFFFISYAEIIFCIRIKRNNLYNFQNMTNSLNIKNLDDVKEKVKYEKHT
TRM5_THEAN        ----------------------------------------------MNKNFDKLNYNIIN
TRM5_THEPA        -----------------------------------MLNFFYVKYKSLFKIIAILTFNILC
TRM5_PARTE        ------------------------------------------------------------
TRM5_CAEEL        ------------------------------------------------------------
TRM5_ENCCU        ------------------------------------------------------------
B7XK87_ENTBH      ------------------------------------------------------------
I3EPE9_NEMP1      ------------------------------------------------------------
TRM5_USTMA        -------------------------------------------------------MSISS
TRM5_GIAIC        ------------------------------------------------------------
TRM52_PHATC       --------------------------MTTRVTGNERRGRQLLLRFSGFLSAALTVMALIT
                                                                              

TRM5_HUMAN        MLLEAPGIFLLGQRKRFSTMPETETHERETELFSPPSDVRG-------------------
TRM5_MACMU        TLSESPGIFLLGQRKRFSTMPEIETHERDSELFSPPSDVRG-------------------
TRM5_BOVIN        KLNRVPVIFLLDQRKRFSTMPEIETNHRDSELFSPPSEVRG-------------------
TRM5_MOUSE        RLRKAPSVFLLGQRQGLSTMPEIEASVRDSELFSPPSDVRG-------------------
TRM5_XENTR        TISAT--------RSCFSAMAEMQDSHNEMELYSPNPEVRG-------------------
TRM5_DANRE        -------------------KVMTDQSQTDLGLFKPPSTVRG-------------------
TRM5_CIOIN        ------------------------GMDHEHSALYPPAAVRG-------------------
TRM5_ANODA        ----------------------------MCADLLPPATVRG-------------------
TRM5_ANOGA        ALTVLPHSGLRTTHRSLLARLRHYFKNMLCPDLHPPATVRG-------------------
TRM5_AEDAE        MLFRRFLNLTTKTPHLQTFRARHYFRNMSCPELIPPPTVRG-------------------
TRM5_DROME        ----MFIVSRLKDLTIITNRLRHYFRNMDVKELQPPSSVRG-------------------
TRM5_DROPS        ---------------------------MNCSELLPPASVRG-------------------
TRM5_PEDHC        ------------------------------------------------------------
TRM5_EMENI        -------------MAQSTEDNTRRPRPSDLPEMFRPPVNRA-------------------
TRM5_ASPFU        --------------MDSMTDSSNSLRSSDLPEMFRPPVNRA-------------------
TRM5_PHANO        --------------------------------MFAPPAARA-------------------
I1RCE4_GIBZE      ---------------MDKNSQ------LRDMNLFRAPAARA-------------------
TRM5_NECH7        ---------------MDKNSQ------LRDMNLFRAPAARA-------------------
TRM5_NEUCR        ------------MSQSEKENQGSGEGKTQDMAIFSPPVVRSG------------------
TRM5_TUBMM        -----------------------------MSRLFLPPINRA-------------------
TRM5_AJECG        LQSLSISSSSPFPNNSSPVVTAANTISTSESDMFRAPVNRM-------------------
TRM5_CANAL        -----------------------------MSKF--SPPINRN------------------
TRM5_CANAW        -----------------------------MSKF--SPPINRN------------------
TRM5_YEAST        ---------MKIALPVFQKFNRLISSCKMSGVFPYNPPVNRQ------------------
TRM5_YARLI        -----MKFNFWKGLWKPKSLTPTLSHRLYRRMYTPQPPLNRE------------------
TRM5_SCHPO        -----------------MHLQIRTVHNMAELLHPNKVEMKPF------------------
TRM5_COPC7        ---------------------MTTRHLYLDTSPPAYTGSR--------------------
TRM5_CRYNJ        RLSLRQFQNQPQSVGFFTMAPLETRALALSPSATICPPSRIG------------------
TRM5_PUCGT        SLMLSSLLTTRRTISSMAALQQPSRHRFPPPNNIQRLPLRPDGQQEP-------------
TRM5_LEIIN        ELAALVYRPLTASGALLSILRGKLYRRRSVRNVLDVVAVHSISGGQGHSAESKVRVEYLA
TRM5_LEIMA        ELAALVYRPLTASGALLSILRGKLYRRRSVRNVLDVVAVRSISGGQGHSAESKVRVEYLT
TRM5_LEIBR        ELAALVYQPLEASGALLSILRGKLYHQRNVRSVLDVVAVPTDTGDQGHSAASKVRVEYLA
TRM51_TRYCC       ELMALRVKPVHLLGEVLKALRGCLYDMRGVRNVMDAPQPTSDPGEA--------------
TRM52_TRYCC       ELMALRVKPVHLLGEVLKALRGCLYDMRGVRNVMDAPQPTSDPGEE--------------
TRM5_DICDI        ------------------------------------------------------------
TRM5_POLPP        ------------------------------------------------------------
TRM5_BATDJ        ------------------------------------------------------------
TRM5_PHYIT        ------------------------------------------------------------
TRM52_ARATH       ------------MVSKLSLFRANSLPFPVISSYSARFILKPYPKPKTLIFCVFSSNLSST
TRM51_VITVI       ------------MVTKL-FLRPHSLSFTLLSGIH---LFPKTSLSKPITLCLLSTTATTP
TRM5_ENTHI        ------------------------------------------------------------
TRM51_ARATH       ------------------------------------------------------------
TRM52_VITVI       ------------------------------------------------------------
TRM5_SORBI        ------------------------------------------------------------
TRM5_PHYPA        ------------------------------------------------------------
TRM5_TRIVA        ------------------------------------------------------------
TRM51_PHATC       ------------------------------------------------------------
TRM5_THAPS        ------------------------------------------------------------
TRM5_PLAKH        HCLVVNKYKVNDVLKNKEAKFYFLNVFRFPSVLKLREYEGNLMETGQYN--GEVLRFIHS
TRM5_PLAVS        HCLVLNKYRVNELLKNKDAKIWFLNIFRFPSVLKFREYQGCLVETGPYD--GEVLRFIHS
TRM5_PLAF7        YCLLLDKYKVNKILKNKRAKFWLLDIYKFPSVLKYKEYKNCFLQNDHNDKNNHMLNFIYN
TRM5_THEAN        V--IVYSISKNDYPTSNNLKVYQYSFVNFKPSLEMSQIIKKKKLDSSSS-----------
TRM5_THEPA        YCRTVHSISKNDYTISNNLKLYPYSFVNFRPSPEMSQILKKKKLDSSSS-----------
TRM5_PARTE        ------------------------------------------------------------
TRM5_CAEEL        -------------------MIILKRLFSNMSILQPPEVVRG-------------------
TRM5_ENCCU        ------------------------------------------------------------
B7XK87_ENTBH      ------------------------------------------------------------
I3EPE9_NEMP1      ------------------------MTEEAATEYLQSEEEKR-------------------
TRM5_USTMA        CSAQDGCASTAMTRTAMRQNKFATSAPASVPRLTGTEPQLGSMQGAQ-------------
TRM5_GIAIC        ---------------MSHQRPEIFDNFAGAQVMTVDGEPQRD------------------
TRM52_PHATC       ATRALAPVVAYIAPQRVRSHFMRRAFASGNCRSRRFSVLRSTVGTETRNENNITTPYHSP
                                                                              

TRM5_HUMAN        --------------------------------------------MTKLDRTAFKKTVNIP
TRM5_MACMU        --------------------------------------------MTKLDRTAFKKTVNIP
TRM5_BOVIN        --------------------------------------------MTELDRTAFKKTVTIP
TRM5_MOUSE        --------------------------------------------MRELDRTAFKKTVSIP
TRM5_XENTR        --------------------------------------------MTCLNRDAFDKTIHVP
TRM5_DANRE        --------------------------------------------MTELDRSAFNQTVSVP
TRM5_CIOIN        --------------------------------------------MKVLDRSAFEQEVTLP
TRM5_ANODA        --------------------------------------------MEQLDRDAFAKTVRVP
TRM5_ANOGA        --------------------------------------------MKLLDRSAFSKTIKVP
TRM5_AEDAE        --------------------------------------------MTVLDKGAFDKRISAP
TRM5_DROME        --------------------------------------------MQELQREQFRKIVQVP
TRM5_DROPS        --------------------------------------------MRELQRAEFQKRVQVP
TRM5_PEDHC        --------------------------------------------MKVLDRSAFKKTINVY
TRM5_EMENI        --------------------------------------------MRVLDRSFFKKTVPLS
TRM5_ASPFU        --------------------------------------------MRVLDRSFFRKTVPLS
TRM5_PHANO        --------------------------------------------MKVLDRSFFKKTIPTS
I1RCE4_GIBZE      --------------------------------------------AKTLDRSLFAKTLNSA
TRM5_NECH7        --------------------------------------------AKTLDRSVFAKTLNAA
TRM5_NEUCR        --------------------------------------------AGALNRALFTKTVNLA
TRM5_TUBMM        --------------------------------------------MRTLDPSFFQKTIPLT
TRM5_AJECG        --------------------------------------------MRTLDRSFFKKTVPLS
TRM5_CANAL        --------------------------------------------MVELDRSFFHKEVPLL
TRM5_CANAW        --------------------------------------------MVELDRSFFYKEVPLL
TRM5_YEAST        --------------------------------------------MRELDRSFFITKIPMC
TRM5_YARLI        --------------------------------------------MTVLDRSKFTVSLNLA
TRM5_SCHPO        --------------------------------------------LKNLDKNLFKKTYNLV
TRM5_COPC7        ---------------------------------------------TELDKSAFHKTLPVL
TRM5_CRYNJ        --------------------------------------------TTELDRSAFDLDVQIL
TRM5_PUCGT        ------------------------------------------IKLTEAIKQQFKQSIPLL
TRM5_LEIIN        PAEGNANGNSISNIGAAPCADIQGSSDIAATGNSLSTPAQPALLEGRCKMCLLDPTVLKA
TRM5_LEIMA        PAEGNANGNSISNISAAPCADIRGSSDTAATSSSPSTPAQPTLLEGRCKMCLLDPTVLKA
TRM5_LEIBR        PPSNKANRNSSSNISCALRDDIQRGSRAAATCNSSSPPTPPAFLEGCCKMCLLDPTVLEA
TRM51_TRYCC       -----------------------------------------------HKLLLLDPQVIPP
TRM52_TRYCC       -----------------------------------------------HKLLLLNPQVIPP
TRM5_DICDI        --------------------------------------------MNVLNKEVFNQTKKVL
TRM5_POLPP        ------------------------------------------MSSLLLNKEIFSKSISIV
TRM5_BATDJ        --------------------------------MKYIFAPPANKGLQQLNHALFESSHTLP
TRM5_PHYIT        ------------------------------------------MSKPLLDKTLFKKTLDVV
TRM52_ARATH       TFPYGPSLLKGKKPVLDDIRLASIGRDRDAHRGKIGEFDESIEKDVLLNEDEFTRVFEIS
TRM51_VITVI       ILTLTQTLD----PNLSYGPSLHKGTKPLNHQNHQLIAATPGEEECVFDKEAFTRVFNLT
TRM5_ENTHI        ------------------------------------MEKEQLPELKYINVNDFNINEKVI
TRM51_ARATH       ----------------------------------------------MFDESKFDVNLKLW
TRM52_VITVI       ---------------------------------------------MLLDESKFDLQLKLW
TRM5_SORBI        --------------------------------------------MEKLDESKFEQRLQLW
TRM5_PHYPA        -------------------------------------MAAPGCSPVGIDKSAFVVRLPRV
TRM5_TRIVA        ---------------------------------------------MDIDPKDITISKEFQ
TRM51_PHATC       -----------------------MLDPVEASSVPVVDDSTIRSLSDFPDRNVFRREDRYP
TRM5_THAPS        --------------------MTHHLAPLDSLPTSIYPPSAYPPPSFFESSSLI-----YP
TRM5_PLAKH        YVERLGGGGTHVGGKADSKADGKVNHDVSDQVVAQQTDQQMDQQMDQQTDQQMDQQMDQK
TRM5_PLAVS        YVESLGGG------------------EVSGQVSGQVNDQLSCQMTSHANDSQAGTPLA--
TRM5_PLAF7        NYLKKRNHQNVK------------NESENGNYNNDHNDHQTCNNMNIFFSNEYLKSLS--
TRM5_THEAN        ------------------------------------EDFIPTKRITTLEELENYERLE--
TRM5_THEPA        ------------------------------------EDFIPTKRITTLEELKNYERLE--
TRM5_PARTE        --------------------------------------------MKLTQEIKFSLQKTQK
TRM5_CAEEL        --------------------------------------------MTKLEKEAFRMPVDFP
TRM5_ENCCU        --------------------------------------------MDVMDDVKSVLCLKAL
B7XK87_ENTBH      ----------------------------------------MNCDSLLKQALNYTKPINCM
I3EPE9_NEMP1      -------------------------------------------VYNSIKNGEYSERIPCK
TRM5_USTMA        ------------------------------------------ELLEQLKASFTSSHLIQA
TRM5_GIAIC        --------------------------------------------LNQARRIVLEMKEPLC
TRM52_PHATC       LPTSRYVYQSSRTLSSRNPALPLESTLMHSNANELTDVELKNLVAHWRDHPVLNPMVTFR
                                                                              

TRM5_HUMAN        VLKVRKEIVSKLMRSLKRAALQRPGIRRVIEDPEDK------------------------
TRM5_MACMU        VLKVRKEIVSRLMRSLRRAALQRPGIKRVIEDPEDK------------------------
TRM5_BOVIN        VLKVRKEVVNKLMRSLKRAALQRPGIKRVIEDPEDG------------------------
TRM5_MOUSE        VLKARKEVVNRLMRALRRVALQRPGIKRVIEDPKDE------------------------
TRM5_XENTR        VIKIKKEIINRLMKSLKHRLIQRPSLKRVIEDPKDD------------------------
TRM5_DANRE        AIRLPTNILNKAVKSLKKVALQRPGLKRVVEEHSEDGNADCG------------------
TRM5_CIOIN        ALLVPVQSLRNCRKMMKSKLVNLSINKKVVDPPAHLVGEEL-------------------
TRM5_ANODA        HLIIPEATNLNSAARALKQYLLKMEHYKPIRSEE--------------------------
TRM5_ANOGA        HLLVPKDKNLNDICRASKKYLLKMERYKPVITEQ--------------------------
TRM5_AEDAE        RLIVPRQLNFQQICSSVKKLLLKMECFKPVVSGE--------------------------
TRM5_DROME        RLRVPES-QVQRVMPLVKKFLLKMEHLHPVRAVDQS------------------------
TRM5_DROPS        QLRVPEQ-QVQRVIPLVKKFLLKMEHMHPVRAVDKS------------------------
TRM5_PEDHC        SIEIKPNQINNLNKCLKNYYFKNRRCKITEEKISDN------------------------
TRM5_EMENI        AATIFKNSDISRVRRALEQSKDILALPRLNTIQDIK------------------------
TRM5_ASPFU        AAAVFQNSDISKVRAELHKSRDLLAVPRLNCIRDVAD-----------------------
TRM5_PHANO        AARIFNAKDISRCRKELTASRDTLPNNRVDPIRPDVD-----------------------
I1RCE4_GIBZE      AASIKENKLLSKYRKELEKTNEILFMERFNAILPDPD-----------------------
TRM5_NECH7        AASISENRLLSKYRKELEKTQEVLFMERFNPILPDPD-----------------------
TRM5_NEUCR        AAAVNDNRLISKYRKELEHSKELLRQDRLSPIVNHPD-----------------------
TRM5_TUBMM        AAHVLDGRNIPRVTKEC--ARDLLRVPRLRSVITQKD-----------------------
TRM5_AJECG        AATIFDKQSIGSIKSELLQSQDLLLANRIIPVRAAREGPLENVT----------------
TRM5_CANAL        AAYFPNPKFLGQFVKSCQNDILYVQTVKHIISMDDSK-----------------------
TRM5_CANAW        AAYFPNPKFLGQFVKSCQNDILYVQTVKHIISMDDSK-----------------------
TRM5_YEAST        AVKFPEPKNISVFSKNFKNCILRVPRIPHVVKLNSSKPKDELTSVQN-------------
TRM5_YARLI        LAKFPDPKYIAQFAKECKADILQLRSINHVQKTDDNG-----------------------
TRM5_SCHPO        AAKVS-PKKVGLLNKVCKKDLLDWPRVKHVYQQNNEK-----------------------
TRM5_COPC7        AVRVR-PEKVGKFLKGDAMKRALLDIPKVRTVVSDP------------------------
TRM5_CRYNJ        SAVVE-PGMIGKLRSHPSLKDLVLDLPKTKPIVECPAGL---------------------
TRM5_PUCGT        AARVP-SPSITKFKTNPEIRKALLNSKNLRSVEPDPD-----------------------
TRM5_LEIIN        TELWPDPASAAQHRVPVFSLGAAIAGSHVTQQLEAALQAGQLSRKAA-------------
TRM5_LEIMA        TELCPDPASAAQHCTPVFLLGAAVVGSHVTRQLEAAVQAGQLSRKAA-------------
TRM5_LEIBR        AELWPDPTSVTQNSTPVFLLGAGIPGARVTQQLEAALQTGQLPRKAA-------------
TRM51_TRYCC       ----PSPAAKNASTAPTQPLWVEANHASVPPVVRERLQSFLLGKR---------------
TRM52_TRYCC       ----PSSAAKNDSMAPTQPLWVEANHASVPPVVRERLQSFLLGKR---------------
TRM5_DICDI        GLIVSNKLVNGFSKQF-KSYMFQSPKFKPIVS-TDNDD----------------------
TRM5_POLPP        GLKVNKTLLKTLAQEF-KGYLLIRDRVKHIVDDSDSKD----------------------
TRM5_BATDJ        ALKIPAHASGIAMETL-RSHILVAPRLRTIVDDPTD------------------------
TRM5_PHYIT        GVRVEAKKIGRVVKKL-HGHLLNLPRLRNVVPDPTNPDPYK-------------------
TRM52_ARATH       AIRVPAKDCFALENRL-RGHLLNWPRIRNIARVPGDEIEEDVVKLLGRETDEEEEDE-DS
TRM51_VITVI       AIRVPSKDCFALENRL-RGHLLNWPRIRNVARVPGDEVEDGLVKLLGEKRNSSDGSESEG
TRM5_ENTHI        GIPVQTNEVAKYMKMF-KGLCYNRIKTKCVIPYN--------------------------
TRM51_ARATH       ALRIPRELCKSASRIL-NGYMLNMPRIKPITEDPTCE-----------------------
TRM52_VITVI       ALRIPSQLCKVASRIL-NGYLLDKPRVKPITEDPTCE-----------------------
TRM5_SORBI        ALRIPRELSSAVTRLLRSGYLLDKPRVKTVVEDPEGD-----------------------
TRM5_PHYPA        ALRIPKQKSHRVASLL-SKYLLDMPRVKHIVEDPQDP-----------------------
TRM5_TRIVA        SIVVPKQLTGPVKAIL-QEKKLSATETKNVVDDPNGK-----------------------
TRM51_PHATC       ALNIPVRRTAELRKTL-KHVLWRRPKTKNVYDDET-------------------------
TRM5_THAPS        ALLIPAKRTGEVQKTL-KDVIFTEPKRKSVYPLEEGVDYSSI------------------
TRM5_PLAKH        RDAALEDCRLIPLNARFNKALQELMQREGKEIMEGLDMHLE-------------------
TRM5_PLAVS        -DAPLADCRLIPLNARFNRALHELMQREGKGVLEGVDMRPE-------------------
TRM5_PLAF7        -NFNEEDFRLIPLNDFFNKILLELFYKQREEIIHDDVIYSKNNIKSLSHVFNDNSPE---
TRM5_THEAN        ----ERTKVTITKEKIPLFAKNEMFRNIVRHSLNSPECRENQ------------------
TRM5_THEPA        ----ERTKVTITKDKIPLFAKNDMFRNTVRNPLNSIDYYKND------------------
TRM5_PARTE        VLSIQMQVHHINDFTKLFKKCIFPGSRWQLEQEN--------------------------
TRM5_CAEEL        VIEIEARDAGIVGRRVRLEPYLIGHKLKPLKNLVDSE-----------------------
TRM5_ENCCU        EASNERASDCIQRAGASIRKIPRIPSIIRVKKKY--------------------------
B7XK87_ENTBH      GIIIEDIENDMELLKNYIFKFPKIPYIINLNTKYHEFYIM--------------------
I3EPE9_NEMP1      ILKIAREEIKDALKTEKSILKMERVPRILDCSIFQETN----------------------
TRM5_USTMA        IGLSGRQLPLLTKDQEILPYLFNAAGVRYVQPHPNGD-----------------------
TRM5_GIAIC        RIPEDLRSLLSVTISVYCIETPSALVSTIIKNMPPEASIALV------------------
TRM52_PHATC       SWVVPIKGKMIQAILNSKSLQPYLASRHELLQEMHVRLKIVRDYTDS-------------
                                                                              

TRM5_HUMAN        ------------------------------------------------------------
TRM5_MACMU        ------------------------------------------------------------
TRM5_BOVIN        ------------------------------------------------------------
TRM5_MOUSE        ------------------------------------------------------------
TRM5_XENTR        ------------------------------------------------------------
TRM5_DANRE        ------------------------------------------------------------
TRM5_CIOIN        ------------------------------------------------------------
TRM5_ANODA        ------------------------------------------------------------
TRM5_ANOGA        ------------------------------------------------------------
TRM5_AEDAE        ------------------------------------------------------------
TRM5_DROME        ------------------------------------------------------------
TRM5_DROPS        ------------------------------------------------------------
TRM5_PEDHC        ------------------------------------------------------------
TRM5_EMENI        ------------------------------------------------------------
TRM5_ASPFU        ------------------------------------------------------------
TRM5_PHANO        ------------------------------------------------------------
I1RCE4_GIBZE      ------------------------------------------------------------
TRM5_NECH7        ------------------------------------------------------------
TRM5_NEUCR        ------------------------------------------------------------
TRM5_TUBMM        ------------------------------------------------------------
TRM5_AJECG        ------------------------------------------------------------
TRM5_CANAL        ------------------------------------------------------------
TRM5_CANAW        ------------------------------------------------------------
TRM5_YEAST        ------------------------------------------------------------
TRM5_YARLI        ------------------------------------------------------------
TRM5_SCHPO        ------------------------------------------------------------
TRM5_COPC7        ------------------------------------------------------------
TRM5_CRYNJ        ------------------------------------------------------------
TRM5_PUCGT        ------------------------------------------------------------
TRM5_LEIIN        ------------------------------------------------------------
TRM5_LEIMA        ------------------------------------------------------------
TRM5_LEIBR        ------------------------------------------------------------
TRM51_TRYCC       ------------------------------------------------------------
TRM52_TRYCC       ------------------------------------------------------------
TRM5_DICDI        ------------------------------------------------------------
TRM5_POLPP        ------------------------------------------------------------
TRM5_BATDJ        ------------------------------------------------------------
TRM5_PHYIT        ------------------------------------------------------------
TRM52_ARATH       VVDSVNRRIRGKAEGDGERLSSVLHRDKLARTFNSTGYLKFRNLAKISRPKRK--RKTER
TRM51_VITVI       DFDSLNRRIYGKAEGDGEILSPVLYRDTLAKTFDSQGFANFRNLAKLSRPKKKKRRKEEE
TRM5_ENTHI        ------------------------------------------------------------
TRM51_ARATH       ------------------------------------------------------------
TRM52_VITVI       ------------------------------------------------------------
TRM5_SORBI        ------------------------------------------------------------
TRM5_PHYPA        ------------------------------------------------------------
TRM5_TRIVA        ------------------------------------------------------------
TRM51_PHATC       ------------------------------------------------------------
TRM5_THAPS        ------------------------------------------------------------
TRM5_PLAKH        ------------------------------------------------------------
TRM5_PLAVS        ------------------------------------------------------------
TRM5_PLAF7        ------------------------------------------------------------
TRM5_THEAN        ------------------------------------------------------------
TRM5_THEPA        ------------------------------------------------------------
TRM5_PARTE        ------------------------------------------------------------
TRM5_CAEEL        ------------------------------------------------------------
TRM5_ENCCU        ------------------------------------------------------------
B7XK87_ENTBH      ------------------------------------------------------------
I3EPE9_NEMP1      ------------------------------------------------------------
TRM5_USTMA        ------------------------------------------------------------
TRM5_GIAIC        ------------------------------------------------------------
TRM52_PHATC       ------------------------------------------------------------
                                                                              

TRM5_HUMAN        -----------------------------------------------ESRLIMLDPYKIF
TRM5_MACMU        -----------------------------------------------ESRLILLDPYKIF
TRM5_BOVIN        -----------------------------------------------EGRLIMLDPYKMF
TRM5_MOUSE        -----------------------------------------------DSRLIMLDPYRML
TRM5_XENTR        -----------------------------------------------VNKLVLLDPYKVK
TRM5_DANRE        ---------------------------------------------NIEHRLLLLDPNSIT
TRM5_CIOIN        ---------------------------------------------TAGHKLFLLKPG--T
TRM5_ANODA        -------------------------------------------------RKITLHPIPVK
TRM5_ANOGA        -------------------------------------------------YKITLHPLAVQ
TRM5_AEDAE        -------------------------------------------------YKITLHPSAVK
TRM5_DROME        -------------------------------------------------REILLHPTPVK
TRM5_DROPS        -------------------------------------------------REILLHPMPIK
TRM5_PEDHC        -------------------------------------------------VKLFLNPALIK
TRM5_EMENI        -----------------------------------------QDDVVK--KCLLLKETIRH
TRM5_ASPFU        -----------------------------------------QEGQIK--KALLLRETVKH
TRM5_PHANO        -----------------------------------------SERAQKGGKCLVLRPEVVH
I1RCE4_GIBZE      -----------------------------------------PLLASEGKKCIVLAPQIKH
TRM5_NECH7        -----------------------------------------PSLASQGRKCIVLSPQIKP
TRM5_NEUCR        -----------------------------------------KALADQGKKCLLLSPNVKA
TRM5_TUBMM        -----------------------------------------DAGMER--KLLLLRPEVKH
TRM5_AJECG        -----------------------------------DHWYGRKDGKQDGRKCLLLREGIKA
TRM5_CANAL        --------------------------------------------------AILLRDDVKS
TRM5_CANAW        --------------------------------------------------AILLRDDVKS
TRM5_YEAST        -----------------------------------KKLKTADGNNTPVTKGVLLHESIHS
TRM5_YARLI        -------------------------------------------------RAVLLRHDLDL
TRM5_SCHPO        --------------------------------------------------LVLLNRDASL
TRM5_COPC7        ----------------------------------------------KEEGNRLVLLRMPN
TRM5_CRYNJ        ----------------------------------------APVAARDVKGLKLLRFHLSK
TRM5_PUCGT        ---------------------------------------------STDNAFKLLLLNTPH
TRM5_LEIIN        -----------------------------------DLLQQLHERLSRGPSSVSLTEDRDG
TRM5_LEIMA        -----------------------------------DLLQQLHERLAGGPSSVSLTEDTDG
TRM5_LEIBR        -----------------------------------DLLQQLHERLAASPPSVSLTENQDG
TRM51_TRYCC       ------------------------------------------------------------
TRM52_TRYCC       ------------------------------------------------------------
TRM5_DICDI        ------------------------------------------------KKMIYLCDTLKK
TRM5_POLPP        ------------------------------------------------KKLVLLSESIEN
TRM5_BATDJ        ----------------------------------------------KKWRLLLLDPSMEA
TRM5_PHYIT        ---------------------------------------------NSSSKLILLNSKVKD
TRM52_ARATH       TREGKEKEIASRRNEMAVVEVVETRGGEEDFEGLLGEGYGSRGRWRGSTRLLLLDEKYSG
TRM51_VITVI       RSEGKKR---TGKNEFAMVEVVEDGEEGEDLRGLLGEEFK-RKRWRGSTRLLLLDERYAD
TRM5_ENTHI        -----------------------------------------------SERMILLETPLKE
TRM51_ARATH       -----------------------------------------------KTRLVILSESVKN
TRM52_VITVI       -----------------------------------------------TNRYIILSERIKN
TRM5_SORBI        -----------------------------------------------KNRLVILSEKIQK
TRM5_PHYPA        -----------------------------------------------SMRLLLFSEAIAQ
TRM5_TRIVA        -----------------------------------------------RIILIPEVTELPK
TRM51_PHATC       ---------------------------------------------DPQR-RILVLANIDE
TRM5_THAPS        -------------------------------------EVSAEGGYDPMKERKVVLIRLGD
TRM5_PLAKH        ---------------------------------------------EGDAGNVTVEGVAME
TRM5_PLAVS        ---------------------------------------------EGDERDVAAEGGGVE
TRM5_PLAF7        --------------------------------------QYRQKEKQQQVGNIIMCNSNSP
TRM5_THEAN        ---------------------------------------------ESDQKTYILKRWDLL
TRM5_THEPA        ---------------------------------------------ESDIRTYILKRWDLL
TRM5_PARTE        --------------------------------------------------IKSIATTFEE
TRM5_CAEEL        ---------------------------------------------KDGKKYLVFHPDKVQ
TRM5_ENCCU        ------------------------------------------------STFRVLTDTSHD
B7XK87_ENTBH      --------------------------------------------ISPELNIIINNHKLKT
I3EPE9_NEMP1      -----------------------------------------------KKRGIHIETDAMY
TRM5_USTMA        ----------------------------------------------ASQRILLLNVPASS
TRM5_GIAIC        ----------------------------------------------TGCRFLAVRDGPRG
TRM52_PHATC       --------------------------------------------TDGTEKLILLHPDTPP
                                                                              

TRM5_HUMAN        THDSFEKA----------------------------------------------------
TRM5_MACMU        THDSFEKA----------------------------------------------------
TRM5_BOVIN        TVDSFEKE----------------------------------------------------
TRM5_MOUSE        TADSFDKA----------------------------------------------------
TRM5_XENTR        SIDSFDES----------------------------------------------------
TRM5_DANRE        SSDSFGSD----------------------------------------------------
TRM5_CIOIN        TMETYSSD----------------------------------------------------
TRM5_ANODA        QWEDLPV-----------------------------------------------------
TRM5_ANOGA        KWEDLAD-----------------------------------------------------
TRM5_AEDAE        TWEDLKE-----------------------------------------------------
TRM5_DROME        NWDSLPT-----------------------------------------------------
TRM5_DROPS        AWESLPT-----------------------------------------------------
TRM5_PEDHC        NFDDFSENT---------------------------------------------------
TRM5_EMENI        DDTA--------------------------------------------------------
TRM5_ASPFU        DDKE--------------------------------------------------------
TRM5_PHANO        NDRT--------------------------------------------------------
I1RCE4_GIBZE      ASPE--------------------------------------------------------
TRM5_NECH7        ASPE--------------------------------------------------------
TRM5_NEUCR        PEPE--------------------------------------------------------
TRM5_TUBMM        DDLS--------------------------------------------------------
TRM5_AJECG        DDVT--------------------------------------------------------
TRM5_CANAL        ISD---------------------------------------------------------
TRM5_CANAW        ISD---------------------------------------------------------
TRM5_YEAST        VEDA----------YG--------------------------------------------
TRM5_YARLI        EGGED----VASKVMS--------------------------------------------
TRM5_SCHPO        DGTR--------------------------------------------------------
TRM5_COPC7        EGD---------------------------------------------------------
TRM5_CRYNJ        ESE---------------------------------------------------------
TRM5_PUCGT        KDQI--------------------------------------------------------
TRM5_LEIIN        SEQPQGSPRAAAAPPP--------------------------------------------
TRM5_LEIMA        SEQPQGLPRAAAAPPP--------------------------------------------
TRM5_LEIBR        DPQAQDSLRAVAAPPS--------------------------------------------
TRM51_TRYCC       ------------------------------------------------------------
TRM52_TRYCC       ------------------------------------------------------------
TRM5_DICDI        --------ETDIP-----------------------------------------------
TRM5_POLPP        GNVGAYGVNKQLP-----------------------------------------------
TRM5_BATDJ        SE------INDLP-----------------------------------------------
TRM5_PHYIT        MET-----LQPLN-----------------------------------------------
TRM52_ARATH       EEVQDLPEAIKVLF----------------------------------------------
TRM51_VITVI       KGVEELPEAIKAVL----------------------------------------------
TRM5_ENTHI        ------------------------------------------------------------
TRM51_ARATH       ADLSEIPEE---------------------------------------------------
TRM52_VITVI       PDLSDIPED---------------------------------------------------
TRM5_SORBI        PDLSDMPQQ---------------------------------------------------
TRM5_PHYPA        PDLEGVSEE---------------------------------------------------
TRM5_TRIVA        EVLEKVPEA---------------------------------------------------
TRM51_PHATC       DAFRDETVQ----R----------------------------------------------
TRM5_THAPS        IAGKNEEEQ----I----------------------------------------------
TRM5_PLAKH        DDSTAHDSVQ----------------------------------------RNEGKTPKGP
TRM5_PLAVS        DVAQQGAAHQ----------------------------------------DAP-------
TRM5_PLAF7        EQYRQKEKQQQVDNIIMCDENLCETLIKDDEINENDDNKNPLENLCEDFKKDKDDIENIY
TRM5_THEAN        PL----------------------------------------------------------
TRM5_THEPA        PS----------------------------------------------------------
TRM5_PARTE        PLPE--------------------------------------------------------
TRM5_CAEEL        EDETRFKILE--------------------------------------------------
TRM5_ENCCU        LLVL--------------------------------------------------------
B7XK87_ENTBH      KSDNIKLML---------------------------------------------------
I3EPE9_NEMP1      KKTD--------------------------------------------------------
TRM5_USTMA        PTPD--------------------------------------------------------
TRM5_GIAIC        KTVTVLSTAF--------------------------------------------------
TRM52_PHATC       LSELPAD-----------------------------------------------------
                                                                              

TRM5_HUMAN        --------ELSVLEQLNVSPQISKYNLELTYEHFKSEEILRAVLP-----EGQDVTSGFS
TRM5_MACMU        --------ELSVLEQLNVSPQISKYNLELTYENFKSEEILRAVLP-----EGQDVTSGFS
TRM5_BOVIN        --------ELSILKQLNVNPQISKYNLDLTYENFKSEEILRAVLP-----EGQDVTSGFS
TRM5_MOUSE        --------ELGVLKELDVSPQLSQYNLELTYENFKSEEILKAVLP-----EGQDVTSGFS
TRM5_XENTR        --------DHVLFKQFDVNPQVSQYELQLTYENFKCEEILRAVLP-----KGQDVTSGFS
TRM5_DANRE        --------EAEALKAYSVPQEIQSYELKLTYENFKSEEILRAVLP-----EGQGVTSGFS
TRM5_CIOIN        --------EKQMLGKLGVKDKIYDYRITLGYENYKHWDVLRAILP-----DSEMAARGFS
TRM5_ANODA        ---------EPLKELGIEKDCLVWEEIKLSYENYKYDLILKAVLP-----ENQEGLSAFS
TRM5_ANOGA        ---------LNLEKLDIGSEALVWEEIQLKYENWKYDEIFKAVLP-----ADKEALSSFS
TRM5_AEDAE        ---------IGLEDKGLTEENLVWEQMKLGYDNWRYDEILKAVLP-----EDKEALSAFS
TRM5_DROME        ---------EDLQRQKVNAENFSFADLELRYENWSANEILKSVLP-----TEEEGLTSYS
TRM5_DROPS        ---------EDLQKQQVTQENFSFVELELNYENWSANEILKSVLP-----EEEEGMTSYS
TRM5_PEDHC        --------KIELKNLGITKDMFSNEIITLDYDYWKLNEVLKAILP-----KDEPPLTSYS
TRM5_EMENI        -----TWSPTINELVDNGVVGVGPFDLTLDYDYWLHSDIISAVLP---EELLEEVPQGFT
TRM5_ASPFU        -----TWSPKISELVEKGRIAMRPYDLTLDYDFWTYADIISSILP---EDELQEIPQGFT
TRM5_PHANO        -----TWSPKLRDLEQDGTLGVIPFQLDLDYDFFTYSEITSAIIPPPETKQDDEIPQGFA
I1RCE4_GIBZE      -----TWSPILQEAAKAGDIKVVPYDIEIGYEFWSYFDVIKSILP---EELHEEIPSGFN
TRM5_NECH7        -----TWSPTLQEASKLGELKVVPYDLEITYDFWNYFDVVKSILP---EELHGEIPSGFN
TRM5_NEUCR        -----TWGAALKEGVQKKELSVIPYELQLNYDYWTYHDIITSILP---EELHDDIPSGFN
TRM5_TUBMM        -----TAQPKTREFVEERIIKLEPYTLHMKYESWNYEEIMNAILP----EDLEEIPCAFT
TRM5_AJECG        -----TWSPTIQKLVEAKSVEVRPFNLLLDYDYFTY------------------------
TRM5_CANAL        ------LNPETQLKINEFGIILKPYTLKLDYSFWKSEEILKSILP---ENLIDDVPSGFS
TRM5_CANAW        ------LNPETQLKINEFGIILKPYTLKLDYSFWKSEEILKSILP---ENLIDDVPSGFS
TRM5_YEAST        -----KLPEDALAFLKENSAEIVPHEYVLDYDFWKAEEILRAVLP---EQFLEEVPTGFT
TRM5_YARLI        -----QLSPRGKELLTEAQADITKIVKDLDYDFWRADEIFYSVLP---VTEKDEIPSGFS
TRM5_SCHPO        -----GLSDATVSFIKENNIELVPFQLTLDYDYWRADDILDAILP---PGEKEDHPSGFT
TRM5_COPC7        ------IPPEALELIKTESNGLTEFNVNLDYNYWTADEILQSFLP---EELREGAPSGFA
TRM5_CRYNJ        ------LPEEAKEVLKG-AKALVKEVVRLGYDNWNASEILGACLP---TTKSEDIPSSFT
TRM5_PUCGT        -------PESTLKVFQEHDIQIKNTKLDLDWEYWMADEIIERLLP----DQLTDIPASFT
TRM5_LEIIN        -----PSSKRRASYTGAVEVTFTPRAVELNYQAYTMSELLSMVLPLR-EHADLVALSGFE
TRM5_LEIMA        -----PSNKRRASYTGAVEVTFTPRAVELNYQAYTMSELLSMVLPLR-EHADLVALSGFE
TRM5_LEIBR        -----PSSRKRGSYVGAVEVTFASRTVELSYRNYTMSELLSMVLPLR-EDADLVALSGFE
TRM51_TRYCC       ------------SVAQSLRVAVAQHIVRLSHRNFTMPELLQRILP-----PGTIPLSGFE
TRM52_TRYCC       ------------SVAQSLRVAVAQHTVRLSHRNFTMPELLQRILP-----PGTIPLSGFE
TRM5_DICDI        --------DQLKTFIKENDIKVIEKDISLNYNNFSYEQVLKTLLP-----KDVGIPFSFE
TRM5_POLPP        --------DNLQSFLKTHSIEVVKHQVQLNYNNFSYEEVMKELIP-----TGLPIPHAFE
TRM5_BATDJ        --------NPLKEFALKHEAKLVKHTIELKYDYWTSDQVLRSILP-----DEMETPGAFE
TRM5_PHYIT        --------EDLVAFLKEESLAFVSHAIELDYSYFAVDQVLSELLP-----KGMDIPSSFE
TRM52_ARATH       --------AEAKMADASLSFELVKCRLTLFYDYWPMIEILEAVLP-----KGMIVPSAFE
TRM51_VITVI       --------KEDTGQSMTSTFELVKCKLTLFYNYWQMNEILEALLP-----EGMIVPSAFE
TRM5_ENTHI        ---------QTQKLIQDNHLKTVETEVPLTIKNFNVNEIMKRYIN-----KNIQLPSSFE
TRM51_ARATH       ---------KLNQLKKLSELEVVPHSVTLGYSYWSADHLLKQILP-----DGLDIPSSFE
TRM52_VITVI       ---------KRDELKVLCKIEVVPYSLTLGYSYWSADHVLKQILP-----DGVEVPSSFE
TRM5_SORBI        ---------ELDSLKQLCNVDVVPYTLTLGYSYWSAGHV---------------------
TRM5_PHYPA        ---------KILAVKEIVPLDVVQHEVVLDYSYWPVEHILKEILP-----AGCEVPSSFE
TRM5_TRIVA        ---------KLE-----------PYPVTLTYKQLTYIELLRHYIP-----EPLVIPTSFE
TRM51_PHATC       --------LIQHED-----CRKASYTVTTAYENYTVEEILKQLLP-----NESEIPSAFE
TRM5_THAPS        --------TGIKEDPVFQDARVKSMLLSAKINIGAEPSTAPNAAT-----NVEEVPSSFE
TRM5_PLAKH        LDGQWPPLEELFRIIKKEGIQISIIQLQFGYDNMNTSEILRKIFP-----TESEVIHKYE
TRM5_PLAVS        -----PALEKLLRVIKAEGIQIRTIQLQFGYDNMNTSQVLRKVFP-----SESEVIHKYE
TRM5_PLAF7        NMHKLEYIEELFELIKEEDIKFQRVKLEFGYDNMNTSEILRKIFP-----CINEIIHKFE
TRM5_THEAN        ---------PLRDLITNESIDHSTVTHKVKYEDITPEEAFKLVVN-----DDIGVMVGFE
TRM5_THEPA        ---------PLRDLITNESIDHSTVTHKIKYEDITTEEAFKLVVN-----DDIGVMVGFE
TRM5_PARTE        ---------NLQEFIKENNCQILEKEVTVGYDNMTYNEVLQQLLP-----KNVQAPQGYE
TRM5_CAEEL        --------LLKRELGNEKLLDWTTLSKDLTFENWDAKSIFKAVLP------VGIDYSSYT
TRM5_ENCCU        ----------VNEGFSDGEYVPINVELELCYEYFTYSEVLRRILP-----EEVQTPSSFE
B7XK87_ENTBH      --------LVSDALKFSKRYYVFSLTIILNFNYFNYRDIFQHFLP------HKCIVSSYE
I3EPE9_NEMP1      ---------NLWIVLDESSEKGHSATLVLSYEYFTHNELLKKAGI-----CEKEYQSSYN
TRM5_USTMA        --------VVLSAILKHRLELIHEFELSLGYEHLSSDQILEALLPTS-IVDTDGVPTGFT
TRM5_GIAIC        --------LSGLDESVTQQLFIHADTLLLTPEARSRISLLQDIIE--------DPPTSFE
TRM52_PHATC       --------VQQLLRNCQIHENGPVMPTKFTYKDFTASYILSQLLP----IAVHPPPTAFE
                                                                              

TRM5_HUMAN        RIG----HIAHLNLRDHQLSFKHLIGQVMIDKN-PGITSAVNKINNIDNM--YRNFQMEV
TRM5_MACMU        RVG----HIAHLNLRDHQLPFKQLIGQVMIDKN-PGITSAVNKINNIDNM--YRNFHMEV
TRM5_BOVIN        RVG----HIAHLNLRDHQLPYKHLIGQVMIDKN-PGITSAVNKINNIDNT--YRNFEMEV
TRM5_MOUSE        RVG----HIAHLNLRDHQLPFKHLIGQVMVDKN-PGITSAVNKTSNIDNT--YRNFQMEV
TRM5_XENTR        RVG----HIAHMNLRDHQLPYKNVIGQVILDKN-PGITSVVNKTNTIDST--YRNFQMEV
TRM5_DANRE        RVG----HIAHMNLREHQLPYRKLIGQVIIDKN-PGITCVVNKTNTIDST--YRNFQMEV
TRM5_CIOIN        QVG----HILHVNLRDHQLPYKHIIGQVLLDKI-QTARTVVNKHQNIDNK--FRNFEMEV
TRM5_ANODA        KIG----HIIHLNLKNHLMPYRRLIGEVLMDKV-ADCRTVVNKSNSIQNT--YRNFEMEL
TRM5_ANOGA        KIG----HIIHLNLKDHLLPYKELIGQVICDKI-ADCRTVVNKSLSIDNT--YRNFQMEL
TRM5_AEDAE        KVG----HIVHLNLKEHLLPYKNLIGTVIKDKV-VGCRAVVNKLVTIDNT--YRNFQMEL
TRM5_DROME        RIG----HIAHLNLRDHLLPYKQLIGQVLRDKL-PNCRTVVNKASSIDNT--YRNFQLEL
TRM5_DROPS        RIG----HIVHLNLRDHLLPYKQLIGEVLRDKL-PNCRTVVNKASSIDNT--YRNFQLEL
TRM5_PEDHC        IIG----HIVHLNLKDHLIDYKYIIAEVLKDKV-SVAKTVVNKTNKIDNV--YRNFEMEV
TRM5_EMENI        QVG----HVAQLNLREQFIPWRHLIAQVLLDKN-PTLRTVIRKTEDVGSQSEFRTFPYEL
TRM5_ASPFU        QVG----HVLHLNLREQYLPYKYLIAEILKDKN-KVIRTVINKTEDVGSHSEFRTFPFEL
TRM5_PHANO        LAG----HVAHLNLRERYWPYKYLIADVLADKN-PMVKTVINKLDNVGTENAFRTFQYEV
I1RCE4_GIBZE      TVG----HVAHLNIRDEYLPYKNIIAEVLMDKN-SHIKTVINKIDNVGSENEFRTFAYEV
TRM5_NECH7        TVG----HVAHLNIRDQYLPYKNIIAQVLLDKN-PHIKTVINKIDNVGSENEFRTFAYEV
TRM5_NEUCR        TAG----HVAHMNLRERYIPYKKVIAEVILDKT-TNIRTVINKVDNVGAESEFRTFQYEV
TRM5_TUBMM        QAG----HLAHLNLREQYLPYKHLIATVLLDKN-PNVSTVVNKIEDVGTGSVYRTFPMEL
TRM5_AJECG        ---------THFNLREQYLPYKYLLGEILRDKH-PQARTVINKTDDVGSHSEFRTFSYEV
TRM5_CANAL        QAG----HLAHINLRDEYKPFGKLIGQVILDKN-PSVLTVVDKVNTIANK--FRTFPLEL
TRM5_CANAW        QAG----HLAHINLRDEYKPFGKLIGQVILDKN-PSVLTVVDKVNTIANK--FRTFPLEL
TRM5_YEAST        ITG----HIAHLNLRTEFKPFDSLIGQVILDKN-NKIECVVDKVSSIATQ--FRTFPMKV
TRM5_YARLI        MVG----HVAHLNLRSEWKDYDRLIGQVILDKN-PRVKTVVNKVDSIDTK--FRTFKMDV
TRM5_SCHPO        AVG----HIAHMNLREEWLPYKYIIGKVILDKN-PSIETVVNKTDTIDTK--FRTFQMEV
TRM5_COPC7        MVG----HIAHLNLNEEYLPYKYIIGQLILEKN-NRVRTVVNKINSIDTQ--FRFFKMEL
TRM5_CRYNJ        TTG----HIGHMNLREEWLPFRYLIGQVVLDKN-PGLRTIVNKLDTIHAQ--FRYFDMEV
TRM5_PUCGT        MIG----HIAHFNLRDEYLPYKYLIGQVILEKN-LAIKTVVNKIDNINSQ--FRFFEMEL
TRM5_LEIIN        QVG----HIAHVNLSAAHLPYADIIGQVILDCN-ETVSVVVNKVDAISSV--FREFKMDI
TRM5_LEIMA        QVG----HIAHVNLSAAHLPYADIIGQVILDCN-ETVSVVVNKVDAISSV--FREFKMDI
TRM5_LEIBR        QVG----HIAHVNLSAAHLPYADVIGQVILDCN-ETVSVVVNKVDAISSV--FREFKMNI
TRM51_TRYCC       QVG----HIAHVNLSAAHLPYRADIGAVILDCN-PTVRVVVNKVDNIASV--FREFKMEV
TRM52_TRYCC       QVG----HIAHVNLSAAHLPYRADIGAVILDCN-PTVRVVVNKVDNIASV--FREFKMEV
TRM5_DICDI        RIG----HIIHVNLKDEQLPFKYIIGQAILDKN-IQVKTVLNKVGEIDTV--FRTFKIEI
TRM5_POLPP        KIG----HIAHLNLKEELLPYKNMIGQVILDKKGPQIRTVLNKVGKIDTV--FRTFNFEL
TRM5_BATDJ        TVG----HIAHLNLRDRYQPFKHIIGQVILDKS-SHIKTVVNKLDNIDHT--FRFFQMEI
TRM5_PHYIT        TVG----HIAHLNLRDNQLPFKNVIGQVILDKN-AQIRTVVNKTDNIETK--FRTFPMEV
TRM52_ARATH       MVG----HIAHLNLRDEHLPYKRLIAKVVLDKNQPKIQTVVNKIDPIHND--FRTMQLEV
TRM51_VITVI       MVG----HIAHLNLRDEHLPYKKLIAKVVLDKNKPKIQTVVNKTDAIHND--YRTMQLEV
TRM5_ENTHI        TVG----TLAHMNLKEEQMEFKYIIGEAFLIKNYPRIQTVITKTAEISNE--FRTFPLEV
TRM51_ARATH       TIG----HIAHLNLHDELLPFKDVIAKVIYDKNYPRIKTIVNKVGTISNE--FRVPKFEV
TRM52_VITVI       TITFSLCHIAHLNITGELLPYKDVIAKVIYDKNYPRIKTVVNKVGTITNE--FRVPKFEI
TRM5_SORBI        ---------AHLNISDDLLPYKNVIAKVIYDKNYPRIQTVANKVGTITNE--FRVPKFEI
TRM5_PHYPA        TIG----HIAHLNLREDLLTYKKIIAEVILDKN-PKLKTVVNKVGTITNE--FRVPEFEI
TRM5_TRIVA        TIG----HIAHLNLPDELLPYKKVIGECIILKN-PCIKTVAIKQGPINNV--YRNMELEV
TRM51_PHATC       MVG----HLAHVNLRSSQLPFKYWIGKVMLDKNQPRIRTVVNKLGTIETE--YRTFGMEV
TRM5_THAPS        IAG----HVAHVNLRSESLPYKYLIGKAILDKN-PKLRVVVNKIGNIENE--FRTFPMEI
TRM5_PLAKH        MIG----HIAHLNFCERFENYKKVIAEIILDKN-KSIKTVINKMDTLKNL--HRTFNIEL
TRM5_PLAVS        MIG----HIAHLNFCERFENHKKVIAEIILDKN-KSIRTVINKKDSLKNV--HRTFTIEL
TRM5_PLAF7        IIG----HIAHLNFCDKLESCKKIIAEIILDKN-KSIKTVINKKDILNNT--HRTFNIEL
TRM5_THEAN        TVG----HIAHLNVPEERSSIKKLIAKIIIDVR-AFEVTAFRNTNILK-----LTMDIEL
TRM5_THEPA        TVG----HIAHLNVPEERSSIKKLIAKIIIDKH-KHIKTVINKRSEVQNQ--FRTMDIEL
TRM5_PARTE        IIG----KIAHFNLSLEQLPYKYLIGQVLLDKN-KHLQTVCNKLEKLHNV--YRTPQLEL
TRM5_CAEEL        QTG----HIIHCNFADEILPFRFIIAEVLLDKV-NNCKTVVQKGNIITNV--YRNLDLEL
TRM5_ENCCU        IVG----SIVHLNLDGEQMKHKNIIGRVVHDKT---GKTVITKIGQISNA--YRSFDLEV
B7XK87_ENTBH      TIG----NVIHLNLTPIQLPFKKFIGQILHIKT---DKTIINKIEAIDNI--YRNYKIEV
I3EPE9_NEMP1      RVG----SIIHLNLKEESLKHKEIIAKTLLNKI-KDCKTVIRKKSNIENV--FRNIEIDH
TRM5_USTMA        IVG----HIAHLNLLSVYKPFRFLVGHIILSKHIGTLRTVVNKLDSIDTQ--FRFFEMEL
TRM5_GIAIC        TVG----HIAHYNLREAHLPYRYFIGAVTCEKE-PAITTVITKIDTVQSQ--YRTYNFEL
TRM52_PHATC       TIG----HVAHLNLKERHWPYRFLIGQVLLETL-PLIESVINKVGEVSGP--YRTYDFGL
                            : *.          :.                :   :             

TRM5_HUMAN        LSGEQN---------------------------------------------------MMT
TRM5_MACMU        LSGEQN---------------------------------------------------MMT
TRM5_BOVIN        LSGEEN---------------------------------------------------MMT
TRM5_MOUSE        LCGEEN---------------------------------------------------MLT
TRM5_XENTR        LAGEEN---------------------------------------------------MIT
TRM5_DANRE        LAGESN---------------------------------------------------MVA
TRM5_CIOIN        IAGENN---------------------------------------------------FVT
TRM5_ANODA        ICGVPE---------------------------------------------------YEV
TRM5_ANOGA        LCGEPD---------------------------------------------------YRV
TRM5_AEDAE        LCGEED---------------------------------------------------YQV
TRM5_DROME        ICGDPD---------------------------------------------------YQV
TRM5_DROPS        ICGEAE---------------------------------------------------YQV
TRM5_PEDHC        LCGEPD---------------------------------------------------FIA
TRM5_EMENI        LAGDSD---------------------------------------------------MNV
TRM5_ASPFU        LAGDND---------------------------------------------------LNV
TRM5_PHANO        LHGPDD---------------------------------------------------MNV
I1RCE4_GIBZE      LGGPDD---------------------------------------------------LNV
TRM5_NECH7        LGGPDN---------------------------------------------------MNV
TRM5_NEUCR        LAGPDD---------------------------------------------------MQV
TRM5_TUBMM        LAGQDN---------------------------------------------------TNV
TRM5_AJECG        LAGEDD---------------------------------------------------MLV
TRM5_CANAL        LAGEPN---------------------------------------------------YIV
TRM5_CANAW        LAGEPN---------------------------------------------------YIV
TRM5_YEAST        IAGKSDS--------------------------------------------------LVV
TRM5_YARLI        LAGEDN---------------------------------------------------TEV
TRM5_SCHPO        LAGKDD---------------------------------------------------FIV
TRM5_COPC7        LAGEPD---------------------------------------------------YVV
TRM5_CRYNJ        IAGDND---------------------------------------------------YIA
TRM5_PUCGT        LAGEPD---------------------------------------------------YTV
TRM5_LEIIN        IGLRCRTDGVDGNAVAGADLDEFGEAGGSLTAAERQAIALEALSPTYSLAEARIHRLLTA
TRM5_LEIMA        IGLRRRTDSVDGNVVAGADLDDAGEAGGSLTAAERQAIALEALSPTYSLAEARVHRLLTA
TRM5_LEIBR        IGERRRADDLGGDVGVGANVSDSGEVGDSLTAEEKAVIALEA-SSLNSPAEARLNRMLTA
TRM51_TRYCC       IARRTTHSDMKGSPAE----ENSGD-------------------------EEKLHRLLLA
TRM52_TRYCC       IARRTTHSDMKGTPVK----ENSGD-------------------------EEELHGLLLA
TRM5_DICDI        LAG---------------------------------------------------EPDLVA
TRM5_POLPP        LAG---------------------------------------------------DNDLLA
TRM5_BATDJ        LAG---------------------------------------------------INDMNA
TRM5_PHYIT        LAG---------------------------------------------------DDDMEV
TRM52_ARATH       LAG---------------------------------------------------NHSLVT
TRM51_VITVI       LAG---------------------------------------------------NRSLVT
TRM5_ENTHI        IAG---------------------------------------------------IPNTEV
TRM51_ARATH       LAG---------------------------------------------------ENGMET
TRM52_VITVI       LVG---------------------------------------------------KDDMVT
TRM5_SORBI        LAG---------------------------------------------------KNDMVT
TRM5_PHYPA        LAG---------------------------------------------------EPSLVT
TRM5_TRIVA        IAG---------------------------------------------------KNDFIT
TRM51_PHATC       IAGYQG------------------------------------------------ENWSVV
TRM5_THAPS        LAG---------------------------------------------------EGLDLD
TRM5_PLAKH        LAGEKN---------------------------------------------------YLT
TRM5_PLAVS        LAGEEN---------------------------------------------------YLT
TRM5_PLAF7        LAGENN---------------------------------------------------YVT
TRM5_THEAN        LAGEEN---------------------------------------------------YVA
TRM5_THEPA        LAGEEN---------------------------------------------------YIA
TRM5_PARTE        LAGNNS---------------------------------------------------YDA
TRM5_CAEEL        LAGEDN---------------------------------------------------YVT
TRM5_ENCCU        IGGDPV---------------------------------------------------LET
B7XK87_ENTBH      LAGNQF--------------------------------------------------DLQT
I3EPE9_NEMP1      LQGVPS---------------------------------------------------YKT
TRM5_USTMA        LAGEAD---------------------------------------------------FVA
TRM5_GIAIC        IGGVPR---------------------------------------------------YDV
TRM52_PHATC       LAGRND---------------------------------------------------TRV
                  :                                                           

TRM5_HUMAN        KVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKP-------------------------
TRM5_MACMU        KVRENKYTYEFDFSKVYWNPRLSTEHSRITELLKA-------------------------
TRM5_BOVIN        KVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKP-------------------------
TRM5_MOUSE        KVRENNYTYEFDFSKVYWNPRLSTEHGRITELLNP-------------------------
TRM5_XENTR        KVKENYVTYEFDFSKVYWNPRLGTEHNRIIGFLKA-------------------------
TRM5_DANRE        KVRENGVLYEFDFSRVYWNPRLSTEHERIVSLLHR-------------------------
TRM5_CIOIN        RIIEHGRKFEFDFSKVFWNSRLSTEHQRITNFVSE-------------------------
TRM5_ANODA        SIKENGCTYKFNFSRVYWNPRLSTEHQKITDMLEE-------------------------
TRM5_ANOGA        SVKENACLFEFDFSKVYWNPRLSTEHEKIVKMLAK-------------------------
TRM5_AEDAE        SLKENGCIFEFDFSKVYWNSRLSTEHGRVVEMLKK-------------------------
TRM5_DROME        ETKENGVPFEFDFSKVYWNPRLSTEHERIVKMLKS-------------------------
TRM5_DROPS        ETKENGIPFEFDFSKVYWNPRLSTEHERIVKLLQP-------------------------
TRM5_PEDHC        SVIEYDTKFEFDFSKVYWNPRLSTEHNRIVNLVNH-------------------------
TRM5_EMENI        IQHEQDCEFRFDFSRVYWNSRLHTEHQRLVDLFK--------------------------
TRM5_ASPFU        VQHEQDCEFRFDYSRVYWNSRLETEHRRLVEKFN--------------------------
TRM5_PHANO        ELREQGCTFKFDFAKA--------------------------------------------
I1RCE4_GIBZE      EVSEAGCTFKFDYSKVYWNSKLDTEHKRIVGLFQ--------------------------
TRM5_NECH7        EVSEAGCIFRFDYSKVYWNSKLDTEHKRITSFFK--------------------------
TRM5_NEUCR        QVTENACSFEFDYSKVYWNSKLEAEHRRLINMFE--------------------------
TRM5_TUBMM        EVRESGCVFRFDFAKP--------------------------------------------
TRM5_AJECG        TVHEQDCEYSFDYSKVYWNTRLATEHERMVSRFK--------------------------
TRM5_CANAL        EQSESGCKFKFDFSKVYWNSRLSTEHERIIGKFN--------------------------
TRM5_CANAW        EQSESGCKFKFDFSKVYWNSRLSTEHERIIGKFN--------------------------
TRM5_YEAST        EQKESNCTFKFDFSKVYWNSRLHTEHERLVKQYFQ-------------------------
TRM5_YARLI        EQHESGCRFQFDFAKVYWNSRLHTEHDRLVSLFRGEASSRERKQQERAKRENHEKSTETA
TRM5_SCHPO        TQSESNCKFRFDFSKVYWNSRLSTEHDRLIQQFQ--------------------------
TRM5_COPC7        EHHESDCRFMFDFTKVYWNSRLHTEHDRLIQVFQ--------------------------
TRM5_CRYNJ        TVNESGCSFTFNFSNVYWNSRLHHEHERLISLFP--------------------------
TRM5_PUCGT        TLWQSGCRYRFDFSKVYYNPRLSTEHDLLSSMIE--------------------------
TRM5_LEIIN        TVRQHGCSFRVPYNRVYWNSRLSFEHTRLVDRMG--------------------------
TRM5_LEIMA        TVRQHGCSFRVPYNRVYWNSRLSFEHTRLVDRMR--------------------------
TRM5_LEIBR        AVRQHGCCFRVPYNRVYWNSRLSFEHARLVGQMR--------------------------
TRM51_TRYCC       TVRQHGCIFRVPYDRVYWNSRLSHEHARVVGMMQ--------------------------
TRM52_TRYCC       TVRQHGCIFRVPYDRVYWNSRLSHEHARVVGMMQ--------------------------
TRM5_DICDI        EIKENECIFRFNFEEVYWNSRLQYEHMELVNTFKK-------------------------
TRM5_POLPP        QV-------------VYWNSRLQFEHSNLIQTFKS-------------------------
TRM5_BATDJ        KLKEGGCFFHFDFSKVYWNSRLQGEHDRIIKLFGQ-------------------------
TRM5_PHYIT        EVHESKASFRFNYAEVYWNSRLQQEHLRIIRQIKP-------------------------
TRM52_ARATH       LVVENGLRFHVDLARVYWNSKLGTERQRLLLGFDQ-------------------------
TRM51_VITVI       TVIENGMRFQVDLATVYWNSRLATERQRLLNCFTR-------------------------
TRM5_ENTHI        TVICHGVKFVLDYAQCYWNTRLETEHIRIINQMKA-------------------------
TRM51_ARATH       EVKQYGARFKLDYGLVYWNSRLEHEHMRLSSLFKP-------------------------
TRM52_VITVI       EVKQYRATFKLDYSLVYWNSRLEHEHMRLVSQFRP-------------------------
TRM5_SORBI        EVKQYGATFKLDYGLVYWNSRLDHEHIRLVSLFKK-------------------------
TRM5_PHYPA        EIKQHGATFRLDYGMVYWNSRLEGEHKRLFAQFKP-------------------------
TRM5_TRIVA        EVKQSGFTFKMDFSKVYWNSRLQYEHDSVVATFKE-------------------------
TRM51_PHATC       TVKEERCTFRLDFTKVYWNSRLAGEHRRLVQQILKESQ----------------------
TRM5_THAPS        LLKEHGCRFKLDFAKVYWNSRLQGEHARLVQYITK-------------------------
TRM5_PLAKH        TLKENDIKVKLNYELIYWNSKLKKERDRIYDLVE--------------------------
TRM5_PLAVS        MLRENDIKVKLNYELMYWNSKLKKERDRIYSLVE--------------------------
TRM5_PLAF7        QLKENNIRVKLNYELIYWNSKLKKERDRIYNLVK--------------------------
TRM5_THEAN        NLVENGLKFEVDFANVYWNSRLVKERTRIRDLLD--------------------------
TRM5_THEPA        NLVIFVILMSFSFQM---------------------------------------------
TRM5_PARTE        IVPEGGVRLFLNFEKVYWCTRLYSERERVIKYIKELSN----------------------
TRM5_CAEEL        EVKETGLRFKMDFSKVYWNSRLSHEHERVSGMFNT-------------------------
TRM5_ENCCU        IHREGDILFCIDYRSVYWCSKLQSERAILAGKFKA-------------------------
B7XK87_ENTBH      IIIENNVKMFIDLEHVYWCSRLQEERRLLVNTIPK-------------------------
I3EPE9_NEMP1      VHRENGLKFSIDYDKVYWNSKLQKEREVLSKEIHK-------------------------
TRM5_USTMA        QVSESDCSFQFDFRSVYWNSRLHAEHMRLIKKCRP-------------------------
TRM5_GIAIC        KLVQDGITYSFNYTKVYWNSRLSHEHLSLAQHINQTIC----------------------
TRM52_PHATC       KLTESGVQLQFDLADVYWCSRLSEERQRLLRTFQP-------------------------
                                                                              

TRM5_HUMAN        -------GDVLFDVFAGVGPFAIPVAKK---------NCTVFANDLNPESHKWLLYNCKL
TRM5_MACMU        -------GDVLFDVFAGVGPFAIPVAKK---------NCTVFANDLNPESHKWLLHNCKL
TRM5_BOVIN        -------GDVLFDVFAGVGPFAIPAAKK---------KCTVFANDLNPESHKWLLHNCKL
TRM5_MOUSE        -------GDVLFDVFAGVGPFAIPAARK---------NCTVFANDLNPESHKWLLHNCKL
TRM5_XENTR        -------RDVLFDVFAGVGPFAVPAAKK---------NCTVYANDLNPESYKWLLHNCKL
TRM5_DANRE        -------GDTVVDVFAGVGPFAIPAARR---------GCAVLANDLNPESFRWLQHNAKL
TRM5_CIOIN        -------SDVVFDVFAGVGPFAIPIAKK---------GCVVYANDLNPESYRWLLHNVAL
TRM5_ANODA        -------GDLLYDLYAGVGPFTVPAAKR---------GCTVIANDLNPDSYSALVINCGL
TRM5_ANOGA        -------TDTLFDLYAGVGPFTVPAARR---------GCKVLANDLNPDSYEALVNNCAL
TRM5_AEDAE        -------GDVLLDVYAGVGPFSIPAAKK---------GYSVLANDLNPDSYKALVHNCAK
TRM5_DROME        -------DDVLYDVFAGVGPFSIPAAKK---------RCHVLANDLNPESFRWLQHNAKR
TRM5_DROPS        -------GDVLYDVFAGVGPFSVPAAKK---------RCHVLANDLNPVSFHWLQHNAKR
TRM5_PEDHC        -------GDVLFDVFAGVGPFSIRAAKK---------NCLVHANDLNPDSFKWLNHNINL
TRM5_EMENI        ------PGEMVCDVMAGVGPFAIPAG---------KKKIFVWANDLNPHGYEVMQDAVKR
TRM5_ASPFU        ------KGEMVCDVMAGVGPFAVPAG---------KKKIFVWANDLNPHGYEVMQDAIKR
TRM5_PHANO        --------RQYATIMAGVGPFAIPAG---------KKKCFVWANDLNPESYKSLEDNIRI
I1RCE4_GIBZE      ------PGEVVVDVMAGIGPFAVPAG---------KKGVHVWANDKNPESYRYLEDAVRR
TRM5_NECH7        ------PGEVVADVMAGIGPFAVPAG---------KKGVFVWANDKNPESHRYLEDAIQK
TRM5_NEUCR        ------PGEVVCDVMAGIGPFAVPAG---------KKGVFVWANDMNPESNKYMQVAINR
TRM5_TUBMM        -------GEAVADVMAGVGPFAIPAA---------KQRVFVYANDLNPESYKSLVGNIHV
TRM5_AJECG        ------KGEAVCDVMAGVGPFSIPAG---------KKQVFVWANDLNPYGYECLERGAAK
TRM5_CANAL        ------SGDVVGDVFGGVGPFAIPAS---------KKNVIVLANDLNPESYKYLQENIKI
TRM5_CANAW        ------PGDVVGDVFGGVGPFAIPAS---------KKNVIVLANDLNPESYKYLQENIKI
TRM5_YEAST        ------PGQVVCDVFAGVGPFAVPAG---------KKDVIVLANDLNPESYKYLKENIAL
TRM5_YARLI        VEPDNTPATAVCDVFAGVGPFAVPSG---------RTSLFVMANDLNPYSYEALEHNVKL
TRM5_SCHPO        ------PGDAVCDVMAGVGPFACPAG---------KKNVIVFANDLNPYSYESLVENIFL
TRM5_COPC7        ------PEEVVADVFAGVGPFAIPAG---------KKGCGVLANDLNPESYKYLAINAKN
TRM5_CRYNJ        ------PGCVIADVMAGVGPFAIPAA---------KKGCYVLGNDLNPESVKWMRENRLR
TRM5_PUCGT        ------KDEVVVDAFAGVGPFAMRAAA--------NRKAWVLASDLNPASVEALETNVRL
TRM5_LEIIN        ------PGDMLFDVMAGVGPFAVPAA---------KKGVQVFANDLNPVAAQYMKVNAEL
TRM5_LEIMA        ------PGDVLFDVMAGVGPFAVPAA---------KKGVQVFANDLNPVAAQYMKVNAEL
TRM5_LEIBR        ------PGDVLFDVMAGVGPFAVPAA---------KKGVKVFANDLNPVAAQYMKVNAEL
TRM51_TRYCC       ------SGDMLYDAMAGVGPFAIPAA---------VAGVKTYANDLNPVAAEYLRINAEL
TRM52_TRYCC       ------SGDMLYDAMAGVGPFAIPAA---------VAGVKTYANDLNPVAAEYLRINAEL
TRM5_DICDI        -------EDIICDMFAGVGPFALPAAKI--------KKCKVYANDLNPSSVKYMKENAKT
TRM5_POLPP        -------HDIVVDMFAGVGPFAVPASKL--------VKCKVYANDLNPNSVKYMRENATR
TRM5_BATDJ        -------NDLICDVFAGVGPFALPAAKH--------KRCVVFANDLNPQSFKYLMENIKL
TRM5_PHYIT        -------HDVVCDMMCGIGPFAVPVALN---------GSKVYANDLNPRSYHYLKENIAL
TRM52_ARATH       -------NDVVCDVFAGVGPIALAAARI---------VKRVYANDLNPHAVEFMEQNSVV
TRM51_VITVI       -------NDVVCDVFSGVGPIAISAAKK---------VKRVYANDLNPYAIEYLESNSVL
TRM5_ENTHI        -------GEILCDAFAGVGPFAIPAALK---------GVKVYANDLNPTAVKYMRINAVN
TRM51_ARATH       -------GETVCDMFAGIGPFAIPAAQK---------GCFVYANDLNPDSVRYLKINAKF
TRM52_VITVI       -------GQIICDMFSGVGPFAIPAAQK---------GCLVYANDLNPDSIRYLKINAKI
TRM5_SORBI        -------GDVICDMFAGIGPFAIPAAQK---------GCVVYANDLNPDSVHYLRTNAKI
TRM5_PHYPA        -------GQVIVDMFAGIGPFAIPAAQQ---------GCAVYANDLNPTSVKFLKLNSDI
TRM5_TRIVA        -------NSLVCDAMCGIGPFAVRAAKK---------GCRVRANDLNPDSYYWLKENCKI
TRM51_PHATC       -----TKPLVVADLMAGVGPFAVPLT---ASHGRRN-QVTVYANDLNPESYKYLLQNVQS
TRM5_THAPS        -----PKECIVADAMAGVGPFAVPLTSALAPHYYKT-TVVCHANDLNPISYKYLQTNAQL
TRM5_PLAKH        ------NNSIIVDLFAGVGIFSLHLSKK---------KCLCFSNDINSHAYNFMNVNIKL
TRM5_PLAVS        ------NNSIVVDVFAGVGIFSLHLSKK---------NCLCFSNDINLHAYNFMNVNIKL
TRM5_PLAF7        ------DNSIIIDVFGGVGIFSLSLSKK---------SCLCFSNDINEHAYKYMNINISM
TRM5_THEAN        ------SDDIVVDMFAGAGPFAIYASKK---------GCS----------ENYMKRNAKI
TRM5_THEPA        ------KQSLLVDMFAGAGPFAIYASKK---------GCSVLANDLNPIGATYMKRNIEI
TRM5_PARTE        -----GKNIKVLDLFCGIGPFSLRIAKD--------LNAQCLANDLNPECYYYLLKNIIE
TRM5_CAEEL        -------QSLVYDACCGIGPFVLPATLK-------RKPKRVVANDLNPESVKWLKVNVGL
TRM5_ENCCU        -------GEVLCDPFCGVGPVSLPALKK---------GCRVYSNDLNLRAIECLEKSIKI
B7XK87_ENTBH      -------NSIICDPFCGVGPHVLLLLNK---------NCKVFANDLNPYAINCLYKSLQL
I3EPE9_NEMP1      -------NQTVCDMFCGVGPFSILALYK---------GAEVWANDLNPASVANFKESIIL
TRM5_USTMA        -------NQVLADVMAGVGPFAVPAAKR---------GTWVLANDLNPSSYESLTKNAEI
TRM5_GIAIC        ------PNDLVLDGTCGIGPHALLLAKR-------FNFTNLICNDLNPDAYKSLKMNVRI
TRM52_PHATC       -------GQIIADPFCGVGALCLLAASLP------QRNCTIWANDWNPKAVEYLRENARR
                                  * *                                  :      

TRM5_HUMAN        NKV---------------DQKVKVFN-LDGKDFLQGPVKEELMQLLG-LSKE--------
TRM5_MACMU        NKV---------------DQKVKIFN-LDGKDFLQGPVKEELIQLLS-LSKE--------
TRM5_BOVIN        NKV---------------DQKVKVFN-LDGRDFLQGPVREELMQQLGPLSKE--------
TRM5_MOUSE        NKV---------------DQKVKVFN-MDGKDFIQGPVREELMLRLG-LSAE--------
TRM5_XENTR        NKV---------------EKRVQAFN-TDGRDFIKTTIKKELLKYADMPSAE--------
TRM5_DANRE        NKV---------------DQKITTSN-LDGRDFIRGPVRERLPALMK-------------
TRM5_CIOIN        NKT-----------------KAKCFN-SDGREFIQTELRNYLLTRSP-------------
TRM5_ANODA        NK----------------VMRNVKCYNMDAVDFIKVELRNDLLAK-LADDK---------
TRM5_ANOGA        NK----------------VSKHVTCHNKDAVDFIKHEVKQALLEK-CTDES---------
TRM5_AEDAE        NK----------------VQGRITCFNKNGIDFIKEEIKQFIISK-NQDDT---------
TRM5_DROME        NK----------------CLPNIKMSNKDGRQFIVEELREDLLKRLCTTDT---------
TRM5_DROPS        NK----------------CLSNIKMSNKDGREFILKELRADLLQRLRLTDT---------
TRM5_PEDHC        NKK---------------AKGWITTYNKDGSDFILNDFKSNMLKI-WSDSN---------
TRM5_EMENI        NK----------------VFKFVTPFNQDGRSFIRWSARALQKYDPVTVTIQPR------
TRM5_ASPFU        NK----------------VEGFVTPFNMDGREFIRWSAKELLETEPVTVTIHPK------
TRM5_PHANO        NK----------------VGDFVTPRNTDGADFIRQSAIDLLKSER-SIPIYPK------
I1RCE4_GIBZE      NK----------------VSEFVKPFNYDGHDFIQKSADLVLEASKRGDYAVIK------
TRM5_NECH7        NK----------------VWEFVKPFNHDGHDFIRTSADLVLEASKRGDCAVIK------
TRM5_NEUCR        NK----------------VSQYVRPICEDGRTFIHHAADSVLEAHKNGEHVLIA------
TRM5_TUBMM        NK----------------VSQFLTPHNLDGANFIRESIRTLLSRSRNPSTSKVS------
TRM5_AJECG        NK----------------VREFVKAHNMNGRDFIRFATERLYQGNPRTVVHRTK------
TRM5_CANAL        NK----------------VEPFIKPFNLDGREFIRKAPELLLQWHNSQNG-IIEKK----
TRM5_CANAW        NK----------------VEPFIKPFNLDGREFIRKAPELLLQWHNSQNG-IIEKI----
TRM5_YEAST        NK----------------VAKTVKSFNMDGADFIRQSPQLLQQWIQDEEGGKITIP----
TRM5_YARLI        NK----------------VSEYVKCFNLDGAEYVQQSMKLLDEHRRTQPT----------
TRM5_SCHPO        NK----------------VANFVKAFNQDGREFIRSSVQKLLGFSKDEKA----------
TRM5_COPC7        NR----------------VDDTVKAFCEDGREFIQKSVSRLWEEPLPAYTGPKQSR----
TRM5_CRYNJ        NK----------------VEPTLRVSEIDGFEFIRIAPLEVWTRPFDPAPPPKVSN----
TRM5_PUCGT        NK----------------LQGRVAVSGGDGREKIREAVRTLWLDKPFKTPNSSP------
TRM5_LEIIN        NHL---------------PANSLRVFNMDGRDFLNSVLFDSVTRAADA------------
TRM5_LEIMA        NHL---------------PANALHVFNMDGRDFLNSVLFTSVTRAADA------------
TRM5_LEIBR        NRL---------------PANSFHVFNMDGRHFLNSVLFDSITGAAASKIEATA------
TRM51_TRYCC       NHI---------------NKDTFHVFNMDGREFLNTVLYRDVVSGAAV------------
TRM52_TRYCC       NHI---------------NKDTFHVFNMDGREFLNTVLYRDVVSGAAV------------
TRM5_DICDI        NRL----------------ESKVEISNLDARDFVKSLVEKS-------------------
TRM5_POLPP        NK-----------------ASTIEISNLDARDFVRELVSRDPP-----------------
TRM5_BATDJ        NKL----------------ETRILPFNMDGRQFIKQSLEDLNNPA---------------
TRM5_PHYIT        NKV----------------EKLVTAYNLDGRDFLAKLLSE--------------------
TRM52_ARATH       NKL----------------EKRIEIFNMDGRRFIKAMFSS--------------------
TRM51_VITVI       NKL----------------ERKIKVFNMDGRRFINAMFTS--------------------
TRM5_ENTHI        NK------------------TTIECDNMDARDYLRKIVL---------------------
TRM51_ARATH       NKV----------------DDLICVHNMDARKFFSHLMAVSTCE----------------
TRM52_VITVI       NKV----------------DDNIWAYNMDARKFISQLMEVPVHEILPEPDVPVLKATEEC
TRM5_SORBI        NKV----------------DDYIFAYNMDARVFMQNLMTVPGLET---------------
TRM5_PHYPA        NKV----------------GESIKAFNLDAREFMRKLVTE--------------------
TRM5_TRIVA        NGV----------------SENVECFNMDAREFIRKQFDN--------------------
TRM51_PHATC       NKC-----------------TNIHCYNQCGRAMVHQLQAEN-------------------
TRM5_THAPS        NRC---------------FADRLITYNLDGREFIHKMNYER-------------------
TRM5_PLAKH        NK----------------RKS-ILTYNLDARAFVQMLLGLDIFSSDKTTLSMQLSEQNWK
TRM5_PLAVS        NK----------------RRS-ILTYNLDARAFVCMLLRLGIFSRDTSTLAMQLGEQNWR
TRM5_PLAF7        NK----------------NKN-ILTYNMDGREFLEKLFNLKIFSKNNNVLTLYINDQNQK
TRM5_THEAN        NK----------------VTGLVKVFNMDGREFLIDVIKKNKILDKNTLEYDKMA-----
TRM5_THEPA        NK----------------VHDLVKVFNMDGREFLIDVIKKNKILDKKTLECDGMA-----
TRM5_PARTE        NK----------------VQNQVTPLNMDAREVVLKIYNKEIDFD---------------
TRM5_CAEEL        NKI---------------KEERIEIHNMDAKMFIKENVADDVVRLMLEESTAGEFE----
TRM5_ENCCU        NRL---------------DPRNIEIFNLSANEFLEKMAGRK-------------------
B7XK87_ENTBH      NNF---------------TNKEYEISNIDAKDYLNELKTKKVI-----------------
I3EPE9_NEMP1      NRKALGLEEVESAIWNEELEGKVHLYNLDAYEFLKEATEARKKMNVSP------------
TRM5_USTMA        NKVLLREGE-----AKPDKDGGLVATCMDGREFVRWSMLEVWKRGFAGRPMGFDGEQFDV
TRM5_GIAIC        NKA----------------ENAITCFNEDVSSLLRRLLPET-------------------
TRM52_PHATC       NHV---------------SDRIERLQCGDAYDFLMDMGLQQHQKASTRSRKEDVTN----
                  *                                .                          

TRM5_HUMAN        ------------------------------------------------------------
TRM5_MACMU        ------------------------------------------------------------
TRM5_BOVIN        ------------------------------------------------------------
TRM5_MOUSE        ------------------------------------------------------------
TRM5_XENTR        ------------------------------------------------------------
TRM5_DANRE        ------------------------------------------------------------
TRM5_CIOIN        ------------------------------------------------------------
TRM5_ANODA        ------------------------------------------------------------
TRM5_ANOGA        ------------------------------------------------------------
TRM5_AEDAE        ------------------------------------------------------------
TRM5_DROME        ------------------------------------------------------------
TRM5_DROPS        ------------------------------------------------------------
TRM5_PEDHC        ------------------------------------------------------------
TRM5_EMENI        ------------------------------------------------------------
TRM5_ASPFU        ------------------------------------------------------------
TRM5_PHANO        ------------------------------------------------------------
I1RCE4_GIBZE      ------------------------------------------------------------
TRM5_NECH7        ------------------------------------------------------------
TRM5_NEUCR        ------------------------------------------------------------
TRM5_TUBMM        ------------------------------------------------------------
TRM5_AJECG        ------------------------------------------------------------
TRM5_CANAL        ------------------------------------------------------------
TRM5_CANAW        ------------------------------------------------------------
TRM5_YEAST        ------------------------------------------------------------
TRM5_YARLI        ------------------------------------------------------------
TRM5_SCHPO        ------------------------------------------------------------
TRM5_COPC7        ------------------------------------------------------------
TRM5_CRYNJ        ------------------------------------------------------------
TRM5_PUCGT        ------------------------------------------------------------
TRM5_LEIIN        ------------------------------------------------------------
TRM5_LEIMA        ------------------------------------------------------------
TRM5_LEIBR        ------------------------------------------------------------
TRM51_TRYCC       ------------------------------------------------------------
TRM52_TRYCC       ------------------------------------------------------------
TRM5_DICDI        ------------------------------------------------------------
TRM5_POLPP        ------------------------------------------------------------
TRM5_BATDJ        ------------------------------------------------------------
TRM5_PHYIT        ------------------------------------------------------------
TRM52_ARATH       ------------------------------------------------------------
TRM51_VITVI       ------------------------------------------------------------
TRM5_ENTHI        ------------------------------------------------------------
TRM51_ARATH       ---DNLQSVADNDKTKEAAVS-RGGETNSSGEEIR-------------------------
TRM52_VITVI       SIQANVQTESQNGGLTVEAIG-VHSDDSSNMDGIE-------------------------
TRM5_SORBI        --GSDCQVAADESYPKEGVPANENSSSNGNHNDVRE------------------------
TRM5_PHYPA        ----------EEGCVGEIASSTLIAENSLNGTRIP-------------------------
TRM5_TRIVA        ------------------------------------------------------------
TRM51_PHATC       ------------------------------------------------------------
TRM5_THAPS        ------------------------------------------------------------
TRM5_PLAKH        NISLDFINSPDQNNVDTGKRKKRESD----------------------------------
TRM5_PLAVS        NVSLDFVNSAGRDVVDAGKGKKRAADCKVDCKEDCKEDCKEDCKEDCKEDCKEDCKEDCK
TRM5_PLAF7        NISLDVLNSKNHIITGNGKNKSKNKN---------------ENKNENKNENKNENKNENK
TRM5_THEAN        ------------------------------------------------------------
TRM5_THEPA        ------------------------------------------------------------
TRM5_PARTE        ------------------------------------------------------------
TRM5_CAEEL        ------------------------------------------------------------
TRM5_ENCCU        ------------------------------------------------------------
B7XK87_ENTBH      ------------------------------------------------------------
I3EPE9_NEMP1      ------------------------------------------------------------
TRM5_USTMA        Q-----------------------------------------------------------
TRM5_GIAIC        ------------------------------------------------------------
TRM52_PHATC       ------------------------------------------------------------
                                                                              

TRM5_HUMAN        ------------------------------------------------------------
TRM5_MACMU        ------------------------------------------------------------
TRM5_BOVIN        ------------------------------------------------------------
TRM5_MOUSE        ------------------------------------------------------------
TRM5_XENTR        ------------------------------------------------------------
TRM5_DANRE        ------------------------------------------------------------
TRM5_CIOIN        ------------------------------------------------------------
TRM5_ANODA        ------------------------------------------------------------
TRM5_ANOGA        ------------------------------------------------------------
TRM5_AEDAE        ------------------------------------------------------------
TRM5_DROME        ------------------------------------------------------------
TRM5_DROPS        ------------------------------------------------------------
TRM5_PEDHC        ------------------------------------------------------------
TRM5_EMENI        -------------------------------------------------------TKRTR
TRM5_ASPFU        -------------------------------------------------------VRRDR
TRM5_PHANO        -------------------------------------------------------VKFSR
I1RCE4_GIBZE      -------------------------------------------------------PPR--
TRM5_NECH7        -------------------------------------------------------PPR--
TRM5_NEUCR        -------------------------------------------------------PKP--
TRM5_TUBMM        -------------------------------------------------------IPT--
TRM5_AJECG        -------------------------------------------------------VPKAE
TRM5_CANAL        ------------------------------------------------------IIKKVS
TRM5_CANAW        ------------------------------------------------------IIKKVS
TRM5_YEAST        ------------------------------------------------------LPLKKR
TRM5_YARLI        ------------------------------------------------------------
TRM5_SCHPO        -------------------------------------------------------ITVFP
TRM5_COPC7        ------------------------------------------------------VQEEKE
TRM5_CRYNJ        ------------------------------------------------------RQRDRE
TRM5_PUCGT        ------------------------------------------------------------
TRM5_LEIIN        ---------------------------------------------------------PFP
TRM5_LEIMA        ---------------------------------------------------------SLP
TRM5_LEIBR        --------------------------------------------------------TSHP
TRM51_TRYCC       ------------------------------------------------------------
TRM52_TRYCC       ------------------------------------------------------------
TRM5_DICDI        ------------------------------------------------------------
TRM5_POLPP        ------------------------------------------------------------
TRM5_BATDJ        ------------------------------------------------------------
TRM5_PHYIT        ------------------------------------------------------------
TRM52_ARATH       ------------------------------------------------------------
TRM51_VITVI       ------------------------------------------------------------
TRM5_ENTHI        ------------------------------------------------------------
TRM51_ARATH       -------------------------------------------ESNASINEPLGANKKPS
TRM52_VITVI       -------------------------------------------GSCTVADDTVAAVKKHS
TRM5_SORBI        -------------------------------------------GSQNGANESSVASTTAK
TRM5_PHYPA        --------------------------------------------SSKENSSSLTEGSDMP
TRM5_TRIVA        ------------------------------------------------------------
TRM51_PHATC       ------------------------------------------------------------
TRM5_THAPS        ------------------------------------------------------------
TRM5_PLAKH        -----------------------RVGHVDDDITANATIDKKKKLRHADTNDPLEERPLGL
TRM5_PLAVS        EDCKEDCEVKDCKAGDSHQSNSHQSNPHESNPHESAPRDKKKKLAHGDANGPLGERPPGV
TRM5_PLAF7        NENKNENKNENKKDIQNNNMCEKENNISDRKCPYIHNNNNQRNITCDNNNNNNNMNVSGN
TRM5_THEAN        ------------------------------------------------------------
TRM5_THEPA        ------------------------------------------------------------
TRM5_PARTE        ------------------------------------------------------------
TRM5_CAEEL        ------------------------------------------------------------
TRM5_ENCCU        ------------------------------------------------------------
B7XK87_ENTBH      ------------------------------------------------------------
I3EPE9_NEMP1      ------------------------------------------------------------
TRM5_USTMA        ---------------------------------------DDKLRQSARKMRKEQAKKNRA
TRM5_GIAIC        ------------------------------------------------------------
TRM52_PHATC       ------------------------------------------------------------
                                                                              

TRM5_HUMAN        ----------------------------------------RKPSVHVVMNLPAKAIEFLS
TRM5_MACMU        ----------------------------------------RKPSVHIVMNLPAKAIEFLS
TRM5_BOVIN        ----------------------------------------RKHSVHIVMNLPAKAIEFLS
TRM5_MOUSE        ----------------------------------------AKPSVHIVMNLPAKAIEFLS
TRM5_XENTR        ----------------------------------------EKPSLHIAMNLPALAVEFLD
TRM5_DANRE        ----------------------------------------GSQKIHVVMNLPALALEFLD
TRM5_CIOIN        ------------------------------------------HKVHVLMNLPAIAVEFLD
TRM5_ANODA        ----------------------------------------FQGNIHITMNLPAMAVEHLV
TRM5_ANOGA        ----------------------------------------MEGDIHITMNLPAMAVEHLV
TRM5_AEDAE        ----------------------------------------FTGTIHITMNLPALAVEHLE
TRM5_DROME        ----------------------------------------TTYGIHITMNLPAMAVEFLD
TRM5_DROPS        ----------------------------------------SSYATHITMNLPAMAVEFLD
TRM5_PEDHC        ----------------------------------------FLGQIHVVMNLPAKALSFLK
TRM5_EMENI        --DASGQVKETQPPL-EVYTRPKV-------------------FHHYVMNLPGNALEFLD
TRM5_ASPFU        --KSGNKVEQAPPPHPEEYHRPVF-------------------FDHYVMNLPATAIEFLD
TRM5_PHANO        --SAPPTQKPVPDRT---LVQPRT-------------------FQHYVMNLPASAITFLP
I1RCE4_GIBZE      ----PSRKSTAPPPEPVRVPVPPT-------------------ISHFVMNLPASAIEFTH
TRM5_NECH7        ----PPRKSAAPPPEPVRVPVPPT-------------------ISHFVMNLPASAIEFLH
TRM5_NEUCR        ----PSRAKKAPKPEPKRVDIPPT-------------------ISHFVMNLPATAIEFLG
TRM5_TUBMM        ----PGKRGQKRPPPPTVIPVPPT-------------------FSHFVMNLPASATTFLG
TRM5_AJECG        RENSPIRQRKPKAFDTEYLTCPRT-------------------FDHFVMNLPATAIEFLD
TRM5_CANAL        IDDNKTKKNFERKPIIETTKIPKF-------------------YHHFVMNLPDSALTFLD
TRM5_CANAW        IDDNKTKKIFERKPIIETTKIPKF-------------------YHHFVMNLPDSALTFLD
TRM5_YEAST        HRSQQHNDQQPPQPRTKELIIPSH-------------------ISHYVMNLPDSAISFLG
TRM5_YARLI        INPVQVRKRKAGQPVVKQ-DIPNH-------------------YSHYVMNLPDSAIEFLW
TRM5_SCHPO        PRKRARKLEENKDPVRQDIPIPPV-------------------FSHYVMNLPGSAIEFLD
TRM5_COPC7        ----RRRLQRLKAEGQTVPIP-----PSE----KQHGR---RRISHFVMNLPDSAISFLD
TRM5_CRYNJ        AKEARRKREQAKAAGQPVTETAPMSIPSQEVAIKPHPPQPPKLISHFIMNLPDSAITFLP
TRM5_PUCGT        -----------------------------------------LLPDHFIINLPDSSIQFLD
TRM5_LEIIN        GHLCTGRRHVTMNLPAIAVEFLDV-------------------FQPLSSTCASASGQQCN
TRM5_LEIMA        GHLCTGRRHVTMNLPAIAVEFLDV-------------------FQPLSSTCAPASEQRCN
TRM5_LEIBR        GCVCTGRRHVTMNLPAVAVEFLDV-------------------FQPLSNTSSLAGEQQSN
TRM51_TRYCC       ----CGRRHVTMNLPAMAVEFLDV-------------------FTKPPWSQPLVSLSLLE
TRM52_TRYCC       ----CGRRHVTMNLPAIAVEFLDV-------------------FTKPPWSQPLVSLSSLE
TRM5_DICDI        -----------------------------------------IPFTHVVMNLPSTSIEFLD
TRM5_POLPP        -----------------------------------------VAFTQAIMNLPSTSIEFLD
TRM5_BATDJ        ---IWNKITKQKPTSNDKKRNRKVESPTVAPLTDQPAISGIRHFKHYVMNLPATAIEFLD
TRM5_PHYIT        -----------------KK-----------------------QFTQVLMNLPAIALEFLD
TRM52_ARATH       --------------------------------------EKGQKVTQVVMNLPKDAAESLD
TRM51_VITVI       --------------------------------------DKAESITQVVMNLPNDAAEFLD
TRM5_ENTHI        --------------------------------------EKHIQPNYILMNLPATAIEFLD
TRM51_ARATH       GTTKTENGVGKDCK-SIEGHANKRLRQTLL-----PIAKPWEHIDHVIMNLPASALQFLD
TRM52_VITVI       GSCEEENGTYDNATVSVVGRRKDRMNKRMRGSESSSNIKPWEHVDHVIMNLPASAIQFLD
TRM5_SORBI        KRQQTSEECESDCQDGDASQTKRRNNKRVRGP-GPPPSKPWEHFDHVLMNLPASALQFLD
TRM5_PHYPA        SSKKPEERKAKKAKVSEVVKMKI------------SDVKPWEHFDHVVMNLPASALEFLD
TRM5_TRIVA        -----------------------------------------GGCDYIVMNLPGTAVEFLD
TRM51_PHATC       -----------------------------------------IEVDHVIMNLPASAPEFLD
TRM5_THAPS        -----------------------------------------IEADHFIMNLPQMAPEFLD
TRM5_PLAKH        AATHHGEENIQSVERTNNDSEKTKEDAPRDVTHQVDINLGIYGDIHVLMNLPQTAFEFLD
TRM5_PLAVS        AATHGGEE--VPPEPTNNEAEQKAEDAPTNETHQVDINLGIYGDVHVLMNLPQTALDFLD
TRM5_PLAF7        NSIHQYTDMYEHKFKYQKIGEENMDNSKNEENHKIDINLNIYEDIHILMNLPQTALEFLN
TRM5_THEAN        --------------------------------------LKPTGRVHLIMNLPKIAIEFLG
TRM5_THEPA        --------------------------------------LKASGKVHLIMNLPKIAIEFLG
TRM5_PARTE        -------------------------------------------FNHVYMNLPVLAINFLD
TRM5_CAEEL        -----------------------------------NEVPKPMSEVHVVMNLPAYAVNFLP
TRM5_ENCCU        -------------------------------------------IDHFFLNLPEHSLDYLR
B7XK87_ENTBH      -------------------------------------------INHFIFNLPEYSLDFVS
I3EPE9_NEMP1      ------------------------------------------RFNHYILNLPELTLTFIK
TRM5_USTMA        LYAVRQAENTLEGAAESLANLSVDEPDVAATMGQVERHPERKLVDHFVMNLPAIALEFLD
TRM5_GIAIC        ------------------------------------------NLKAVIFSLPELSINLLQ
TRM52_PHATC       -----------------------------KDGNHVTPTEPMRLPDHVVMNYPVEAPKFLG
                                                                   . .        

TRM5_HUMAN        AFKWLLDGQP--------CSSEFLPI-------------VHCYSFSKDANPAE-------
TRM5_MACMU        AFKWLLDGQP--------CSNEFLPI-------------VHCYSFSKDANPAK-------
TRM5_BOVIN        AFKALLEGQP--------CGSELLPI-------------VHCYSFSKDANPAK-------
TRM5_MOUSE        VFRSLLDGQP--------CSTELLPT-------------VHCYCFSKDSDPAK-------
TRM5_XENTR        AFKNLLEEEP--------CNSFILPT-------------IHCYSFSKDDDPLQ-------
TRM5_DANRE        AFKGLLDPEPD-------QSLSNLPQ-------------VHCYGFSKENDPQR-------
TRM5_CIOIN        VFRGLLCNGDC-------LAANDLSNASHKKLLSIPEVCVHLYIFAPEKDGIA-------
TRM5_ANODA        HFPGLFSGE----------SIELR-----------IKPLVHVYCFAQGADDKKPI-----
TRM5_ANOGA        HFPGLLKDE----------DVVLR-----------KQPLVHVYCFAKGVEDKKQI-----
TRM5_AEDAE        NYVGLLKDE----------QIELK-----------HFPLVHVYCFAKGVEDNKLL-----
TRM5_DROME        AFRGLYSAD----------ELAQLPT-------NVCYPTVHVYSFAKG-ENTKEL-----
TRM5_DROPS        AFRGLYTDN----------ELADISD-------AVVFPTVHVYSFAKG-ENTKAL-----
TRM5_PEDHC        YFKGLFDEQDL-------KEIKKDHL-------EKHLPIIYCYFFAKKDESLDEI-----
TRM5_EMENI        AFIGVYAG--------CEELFEPHTK--------EQLPMVHVYCFSGHSENEVDD-----
TRM5_ASPFU        AFPGIYAG--------KESLFAPHTS--------QRLPMVHVYCFSGHSENELDD-----
TRM5_PHANO        SFIGLYSNIPGLSIGEAKKLFAPHTQ--------QKLPMIHVHCFSTKSDDNVAE-----
I1RCE4_GIBZE      NYRGLYHG--------HEELFEPHTE--------AKLPMIHVHCFSVKADDETP------
TRM5_NECH7        NYRGLYHG--------HEDLFEPHTE--------TKLPIVHVHCFSAKMDDDTP------
TRM5_NEUCR        CYRGVYAG--------HEDLFSAESG--------RKLPLVHVHCFSFKADDETP------
TRM5_TUBMM        AFRGAYRG--------LEDVVTG--Q--------EMLPIIHVYTFHKSSVTENA------
TRM5_AJECG        AFRGLYAG--------MQELFEPYTD--------RKLPLIHVYCFSTNSEDEALE-----
TRM5_CANAL        EFIGLYGS---------NPQLKTDPE--------FKLPIIHVHCFEKFENNEN-PTPEEL
TRM5_CANAW        EFIGLYGS---------NPQLKTDPE--------FKLPIIHVHCFEKFENNEN-PTPEEL
TRM5_YEAST        NFRGIFAA---------HTKGATDT---------IQMPWVHVHCFEKYPPGDQ-VTEDEL
TRM5_YARLI        SFKGLYTT---------VDGLSQDT----------PLPHVHVHCFHKWEAGEEEPSKEET
TRM5_SCHPO        AFKGCYYG---------LEYLFKDR----------SLPKVHVHCFCRFPDPEE-------
TRM5_COPC7        AFRGLLSG--------AEPALREQYS---------TMPMVHCHCFTREVDSRV-----NA
TRM5_CRYNJ        SYVSCYTPLL------AERSFIDEYGGEEEAKRKVEMPMVHCYCFTKEIEIG------KA
TRM5_PUCGT        AFRDLYHPLS-----DSEGFLNAVKK-------KSRLPLLHCYCFTKQVDEPE-------
TRM5_LEIIN        ASA-AAIVNE------RWNHLPAHVDPNA----IDRCTLFHVYCFSA-AEDLI-------
TRM5_LEIMA        ASA-AAVVNE------RWNHLPAHVDPNA----IDRRTLFHVYCFSA-AEDLI-------
TRM5_LEIBR        AAT-AVAVNE------RWNRLPAHVEPND----IDQGTLFHVYSFSA-AEDLI-------
TRM51_TRYCC       EKEKAKEGKE------KEEHVEMHP---------DKRVLFHVYCFSKNMDDFL-------
TRM52_TRYCC       EK--AKEGKE------KGEHVKMHP---------DKRLLFHVYCFSKNMDDFL-------
TRM5_DICDI        VFRDIFLNS-TIP-------------------PPIPPPIINCYTFTKLDESS------DL
TRM5_POLPP        VFREIFLNP-EKA-------------------PPIPAPTIHCYTFTPVSETAG----GDL
TRM5_BATDJ        AFHGLYSGMRDVI-------------------MDSDLPTIHCHCFSNA---------KDV
TRM5_PHYIT        AFPGQFDHW------------------------EGELPFVHCYCFSNA---------DDV
TRM52_ARATH       AFRGVYNDRHRD--------------------EGLSFPTIHVYGFSKAS---------DP
TRM51_VITVI       AFRGIFRKKSRD--------------------KQLKLPMIHVYGFSKAQ---------DP
TRM5_ENTHI        CIPELY----------------------------LQHCMIHCYGFSPL-----------P
TRM51_ARATH       SFSNVIQKKYW----------------------KGPLPLIHCYCFIRAS---------ET
TRM52_VITVI       AFRGLIQRKYW----------------------KGSLPWIHCYCFIRAN---------ET
TRM5_SORBI        CFDGLVQKKYW----------------------TGSLPWIHCYCFIRSS---------ES
TRM5_PHYPA        VLNGLLCKGRW----------------------KGTMPRVHCYCFMRSN---------ET
TRM5_TRIVA        AIGEGAKKNRE----------------------TARMPIVIFHSFDNKDG--------DY
TRM51_PHATC       AFRGYE---------------------------GVKRPCIHVHCFAPKASE------ATD
TRM5_THAPS        AFRGWKFDD-----------------------TTGHRPIIHVHCFDEKTRNEEET--ARM
TRM5_PLAKH        IFRELLDTYSTDQKDFQGKCRRDQ----------MRNVFIHCYFFSKPE-----------
TRM5_PLAVS        VFRELLHMYSAGQKDPQGRCRRDQ----------MRNVFIHCYFFSKPE-----------
TRM5_PLAF7        VFKKYK------------KEKNDE----------LRNVFIHCYYFAKPE-----------
TRM5_THEAN        SLVINH-TSSDTLVGLADNIEEEN----------IRRFMVHCYCFSGSN-----------
TRM5_THEPA        NLVMKH-RFSDTLIGLADNIEEEN----------MRKLLVHCYCFSASE-----------
TRM5_PARTE        VFKGFTQRTGK-----------------------VDLPYIHVYGFAKGKDD---------
TRM5_CAEEL        AFRGALSRFKD--------EIEKVPL------DKRYKWNVYCYLFAKSHVDVP-------
TRM5_ENCCU        RISAWEGN-----------------------------PLVHCYFFCRSNE----------
B7XK87_ENTBH      YLTGFNNF------------------------------ILHCYFFCKRD-----------
I3EPE9_NEMP1      HFAALEKTTEPH---------------------KSGHATVHAYFFIRTGE----------
TRM5_USTMA        AFRGAYTHLATIVG---KQRLLCQLELHKLDASIHRLPMIHVHCFSKDPFTPA-------
TRM5_GIAIC        AMKGVPDIYCFLEC------------------FTRAPPHLAYYDLLLRCSESLLD---TK
TRM52_PHATC       ALRWWPVPPSS----------RRGSTTRDGGIGSVIVPRVHVYTFARADPTTDRD---AE
                                                         .  : :               

TRM5_HUMAN        --DVRQRAGAVLGISLEACSS------------VHLVRNVAPNKEMLCITF---------
TRM5_MACMU        --DVRQRAGAVLGISLEACSS------------VHLVRNVAPNKEMLCITF---------
TRM5_BOVIN        --DVQQRAATVLGISLEAYSS------------VHLVRNVAPNKEMLCITF---------
TRM5_MOUSE        --DVRQQAEAVLGVSLETSSS------------VHLVRNVAPNKEMLCITF---------
TRM5_XENTR        --DVKARAESFLGTTLEDCS-------------MHLVRNVAPNKEMVCISF---------
TRM5_DANRE        --DVVERAEASLKTNLQGQCS------------VHLVRNVAPNKEMMCVSF---------
TRM5_CIOIN        --DLKSRIKQSLGCALPEDAV------------IYNVRNVAPKKQMYCVSF---------
TRM5_ANODA        -AQQKVEQWLGVEVTDM-LKE------------ITFVRNVAPNKDMMRVR----------
TRM5_ANOGA        -ARELVEHWLGTDVTDK-LKE------------IAFVRNVAPNKDMMRVSFYLTEDLLLG
TRM5_AEDAE        -ARGLVEKNMGIPLGNN-LKE------------IAFVRNVAPNKDMMRVSFYLTRQILCH
TRM5_DROME        -VRQLVESNLGASLDENLLQG------------INFVRNVAPNKDMYRVS----------
TRM5_DROPS        -VRAQVEQNLASTLDEKQLQG------------ISFVRNVAPNKDMYRVS----------
TRM5_PEDHC        -FKTHLEYKFDEN-----EYE------------FNFVRNVSNGKNMHRVTF---------
TRM5_EMENI        HIDICKRMSERLEYPITVEDRVGGAGNTELELSIHNVRLVSPNKQMFCASF---------
TRM5_ASPFU        HIDICQRISERIGYTITPEDRIGGSGNQSVELSIHNVRLVSPKKQMFCASF---------
TRM5_PHANO        TKEICAEISRQLQCEMTPE---------TPDVNIHDVRDVAPKKRMFCASF---------
I1RCE4_GIBZE      LNDICERIRKEIGVLLKPGDP-----ENEGEVLIYDVRDVAPAKRMYCASF---------
TRM5_NECH7        LKDICERIHKEIGVMLKPGDA-----EKEGEVLIYDVRDVAPAKRMFCASF---------
TRM5_NEUCR        LNDICERITKYLGFPVKPGNP-----DVEGEVAVHDVRDVAPAKRMFCASF---------
TRM5_TUBMM        AGDICADISRHLGREMGEGDL----------ENLENVRLVSPNKTYYCVSF---------
TRM5_AJECG        RKDICERISERLGFKITPEDE-------GRELEIRSVRLVSPTKKMFCASF---------
TRM5_CANAL        HNRVYEKICKLIQFPLNK-----------EKMEFHEVRMVSPTKPMFCVSF---------
TRM5_CANAW        HNRVYEKICKLIQFPLNK-----------KKVEFHEVRMVSPTKPMFCVSF---------
TRM5_YEAST        HARVHARIIAALKVTADDLPL--------NAVSLHLVRKVAPTKPMYCASF---------
TRM5_YARLI        KAALLERVYKQIDVRLDP-----------NEVGMHWVRKVSPKKDMFCISF---------
TRM5_SCHPO        --DLINRIYASLGYRFSP-----------EEVDFYYVRKVAPNKDMYCCTF---------
TRM5_COPC7        EGDIRKRVEEKLGGALTSET------------SFHFVRSVAPNKDMYCISF---------
TRM5_CRYNJ        EIDILQRASTNLSFNLTPQVE---------NYNLHHVRSVAPNKDMYCLSF---------
TRM5_PUCGT        -SDICQRVSEVMKVEISPSTV--------ARFELKFVRAVAPHKDMYRITF---------
TRM5_LEIIN        -TDAVRQVEVNLGYTLPPEN----------IEETLMVRDVAPTKRMMCVSF---------
TRM5_LEIMA        -TDAVRQVEVNLGYTLPPEN----------IEETLMVRDVAPTKRMMCVSF---------
TRM5_LEIBR        -ADAVRQVEANLGYTLPPES----------IEEVLMVRDVAPTKRMMCVSF---------
TRM51_TRYCC       -GDAVKQVERWLAFSLAGEN----------LEAVHMVRDVAPLKRMVCVSF---------
TRM52_TRYCC       -GDAVKQVERWLAFSLAGEN----------LEAVHMVRDVAPLKRMVCVSF---------
TRM5_DICDI        IKDTIKNVENVIGAKVPSD------------YVCYEVRDVAPKKSMMRITF---------
TRM5_POLPP        KELTIKNVEAIIKHPLPAD------------TTVYEVRDVSPNKRMMRISF---------
TRM5_BATDJ        KADVIERVERVIGMPLGSNL-----------IMVHSVRTVAPNKDMLCISF---------
TRM5_PHYIT        KQDVKQRAEKIMGGELDPER-----------TSFHLVRDVAPKKVMVCISF---------
TRM52_ARATH       EFDFHERIRIALSEVAVDV-------------KMRKVRLVAPGKWMLCASF---------
TRM51_VITVI       EFDFHQRIRIALSEVAVDV-------------EMHRVRLVAPGKWMLRASF---------
TRM5_ENTHI        NAEDLKKKAFELLKGEYPI-------------TIREVRDVAPKKVMYCLSI---------
TRM51_ARATH       TEFIIAEAETALKFHIEDP-------------VFHKVRDVAPNKAMFCLSF---------
TRM52_VITVI       NEMIISEAETALNASIQEP-------------ILHRVRDVAPNKAMFCLSF---------
TRM5_SORBI        EESILS---NKLNAKIAEP-------------IFHRVRDVAPNKAMFCLSF---------
TRM5_PHYPA        NADIVKKAETYLGGSIADP-------------DVYVVRDVAPNKASLAFTA---------
TRM5_TRIVA        VASLRARAEKALGMKLPEM-------------DIHNVRDVSPGKFMFRCTF---------
TRM51_PHATC       YQDALDRCSSALG---CTLD------RISNDVHVHVVRDVSPNKNMLSVSF---------
TRM5_THAPS        ETHVLQRCEAALGSSGCLVDK-----RQENDVQIRVVRDVGPRKNMLCVSF---------
TRM5_PLAKH        --LFYEDAERNIRMQLGGLPR---------EMKITEIRKVSPSKLMYVAEF---------
TRM5_PLAVS        --LFYEHAERNIRMQLGGIPR---------EMKITEIRKVSPSKLMYVVEF---------
TRM5_PLAF7        --FFYEHAEKNILLHFNQLPK---------DIKITEIRKVSPSKLMYVVEF---------
TRM5_THEAN        --EYENEIEQRLSKSIGTKLP---------EYTITNVRGVSPKKQMYCIEF---------
TRM5_THEPA        --EYEKEIEQRLYKSIGRKLP---------EYTITHVRGVSPKKQMYCIEF---------
TRM5_PARTE        -QELIEQFSQRIIKGLPGFDK-------SQILRFHILKNVTKMKKMCCLSF---------
TRM5_CAEEL        -DSWYEDEARRMCDEKTKWER-------SLVVKCHNVRTVSSRKEMFCAQL---------
TRM5_ENCCU        --DVVQYIFSRTGLRVDPGM-------------LKVVRKVSPSKYMYKLET---------
B7XK87_ENTBH      -INVVIFLRQKLSSNKINEKH------------VRHIRDVSPSKSVFKLEI---------
I3EPE9_NEMP1      --SATEKIEKEMNRRIKGTAR--------------LVRKVSPSKEMWVVSF---------
TRM5_USTMA        -LDILTRANEALNIPRDAPYRLMAKPILPPAQTFAGLRKLCDASQSASYLS---------
TRM5_GIAIC        VCTGIQQALSDIEKVAENKELIDLLIACYETFEVKEIRTVSTNKFMYRVTLKIN------
TRM52_PHATC       EVAVDLVAANLLPLGNTIHCRTEMNEDYDCDIQVHPVRDVAPGKVVLCGDFR--------
                                                      :: :   .                

TRM5_HUMAN        -----------------------------------------------------------Q
TRM5_MACMU        -----------------------------------------------------------Q
TRM5_BOVIN        -----------------------------------------------------------R
TRM5_MOUSE        -----------------------------------------------------------Q
TRM5_XENTR        -----------------------------------------------------------K
TRM5_DANRE        -----------------------------------------------------------T
TRM5_CIOIN        -----------------------------------------------------------V
TRM5_ANODA        ------------NPSALGMAKK-ANKLK-------------DQPKQLAKKAKNVFAVSQT
TRM5_ANOGA        RTAVKKRQHEEEDLPQLEEAKRPSNKMK-------------DQRKQLAKKAKTVFSVSQV
TRM5_AEDAE        NDIQLKRPT---SETSHQDAKRKCNVLRKIATMGKRNIKNRNQQKQTAKKVKNVFAVNQS
TRM5_DROME        ------------------------------------------------------------
TRM5_DROPS        ------------------------------------------------------------
TRM5_PEDHC        ---------------------------------------------------------QMP
TRM5_EMENI        -----------------------------------------------------------R
TRM5_ASPFU        -----------------------------------------------------------R
TRM5_PHANO        -----------------------------------------------------------R
I1RCE4_GIBZE      -----------------------------------------------------------R
TRM5_NECH7        -----------------------------------------------------------R
TRM5_NEUCR        -----------------------------------------------------------R
TRM5_TUBMM        -----------------------------------------------------------R
TRM5_AJECG        -----------------------------------------------------------R
TRM5_CANAL        -----------------------------------------------------------E
TRM5_CANAW        -----------------------------------------------------------E
TRM5_YEAST        -----------------------------------------------------------Q
TRM5_YARLI        -----------------------------------------------------------E
TRM5_SCHPO        -----------------------------------------------------------T
TRM5_COPC7        -----------------------------------------------------------R
TRM5_CRYNJ        -----------------------------------------------------------R
TRM5_PUCGT        -----------------------------------------------------------E
TRM5_LEIIN        -----------------------------------------------------------T
TRM5_LEIMA        -----------------------------------------------------------T
TRM5_LEIBR        -----------------------------------------------------------T
TRM51_TRYCC       -----------------------------------------------------------T
TRM52_TRYCC       -----------------------------------------------------------T
TRM5_DICDI        -----------------------------------------------------------R
TRM5_POLPP        -----------------------------------------------------------K
TRM5_BATDJ        -----------------------------------------------------------R
TRM5_PHYIT        -----------------------------------------------------------Q
TRM52_ARATH       -----------------------------------------------------------I
TRM51_VITVI       -----------------------------------------------------------I
TRM5_ENTHI        -----------------------------------------------------------F
TRM51_ARATH       -----------------------------------------------------------R
TRM52_VITVI       -----------------------------------------------------------R
TRM5_SORBI        -----------------------------------------------------------K
TRM5_PHYPA        -----------------------------------------------------------V
TRM5_TRIVA        -----------------------------------------------------------S
TRM51_PHATC       -----------------------------------------------------------L
TRM5_THAPS        -----------------------------------------------------------R
TRM5_PLAKH        -----------------------------------------------------------N
TRM5_PLAVS        -----------------------------------------------------------N
TRM5_PLAF7        -----------------------------------------------------------N
TRM5_THEAN        -----------------------------------------------------------E
TRM5_THEPA        -----------------------------------------------------------E
TRM5_PARTE        -----------------------------------------------------------Q
TRM5_CAEEL        -----------------------------------------------------------E
TRM5_ENCCU        ------------------------------------------------------------
B7XK87_ENTBH      -----------------------------------------------------------S
I3EPE9_NEMP1      -----------------------------------------------------------T
TRM5_USTMA        -----------------------------------------------------------S
TRM5_GIAIC        -----------------------------------------------------------E
TRM52_PHATC       ------------------------------------------------------------
                                                                              

TRM5_HUMAN        IPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT------------------
TRM5_MACMU        IPAAVLYKNQTKNPENHEDPPLKRQRTAEAFSDEKTQIASNT------------------
TRM5_BOVIN        IPAAILYKNQTVNRDNHEGPPLKRQRTDKDF-----------------------------
TRM5_MOUSE        IPTATLYRNQSLSLQNDQEPPLKRQKTGDPFSGE-PQIASDS------------------
TRM5_XENTR        LPSSVLFQRLSDTGE----PESKRPRTAEAFPLPHVQQSRNS------------------
TRM5_DANRE        LPRGVLYKTHTQDRDTSEEPCPKKQKCEDSTN----------------------------
TRM5_CIOIN        LSQHWMDQKE----QDVYEPAPKKIKECIS------------------------------
TRM5_ANODA        KKGNLKKTKEVAAKLKKINVQDKREKVDANFKTLHAQIVAKKTPKP--APRPLPAKNKTT
TRM5_ANOGA        KKGNLKKTKEVSSNLKKIQVNDKREKVDKKFENLHAQIVSKKAAKP--APKPLPAKNKSK
TRM5_AEDAE        KKGNVKKAKEVTSKLKKINVQDKREKADKKFQDLHAHIVAKKPEKKPLPAKPASKKNKNQ
TRM5_DROME        ----FKLSLNMLTTLKEVEVT--RKRYAEEE----LEVATKVKCV---------------
TRM5_DROPS        ----FKLTRHLLTTSKEAEANNVRKRCAEDEKVDPEVAATKVKCV---------------
TRM5_PEDHC        LSILMIDNSDISEPLPKRISKSLKAKTKAKEYTGNLKKIKETLNKNISKIDSDFLKLQND
TRM5_EMENI        LPRAVAFRKK--------------------------------------------------
TRM5_ASPFU        LPAEVAFKKV--------------------------------------------------
TRM5_PHANO        LPEEVAFREI--------------------------------------------------
I1RCE4_GIBZE      LPREVAFASRA-------------------------------------------------
TRM5_NECH7        LPREVAFAARA-------------------------------------------------
TRM5_NEUCR        IPREVAFAERV-------------------------------------------------
TRM5_TUBMM        LPANVAFEDAQVA-----------------------------------------------
TRM5_AJECG        LPAEVAFKKA--------------------------------------------------
TRM5_CANAL        LPEEVAFKQSK-------------------------------------------------
TRM5_CANAW        LPEEVAFKQTK-------------------------------------------------
TRM5_YEAST        LPANV-------------------------------------------------------
TRM5_YARLI        LPKEVAWAPQVNKE----------------------------------------------
TRM5_SCHPO        LPGSIIFAKPVSG-----------------------------------------------
TRM5_COPC7        LPPEVAFGERM-------------------------------------------------
TRM5_CRYNJ        LPREVAFRHNG-------------------------------------------------
TRM5_PUCGT        LPLKLLFSSSSEESRA--------------------------------------------
TRM5_LEIIN        LPPAFWENLLASRPGQGEEPRGAHAETASTLVEEEEVEQAAKKAKTDKM-----------
TRM5_LEIMA        LPPAFWKNLLASRPGQGGEPGGAHAETASTLV---EVEQAAKKARPDKM-----------
TRM5_LEIBR        LPPAFWANLLASQPGNDG-ASFTHAETVSALVEE-GAEPTIKRAKADALLTRGV------
TRM51_TRYCC       LPEAFWLHREAKG------------------------MSPLKRARSD-------------
TRM52_TRYCC       LPEAFWLHREAKG------------------------MSPLKRARSD-------------
TRM5_DICDI        MPTILPYVGSLTTASTTTTPTTSNTNTSTTTSTTSTSTTTTESTNTNNSANNVEDKNNKK
TRM5_POLPP        MPTLK---------------------------KRKDTENNDDQENNNNSSNNN---NNNK
TRM5_BATDJ        LPSALAFA----------------------EPKILGKRKGLETEENLVSQSDVSKSSDNI
TRM5_PHYIT        LPESIAFS----------------------SERQASKQD--DPKRRKVAAENAA------
TRM52_ARATH       LPKN----------------------------------VAFSRKNLSYVD----------
TRM51_VITVI       LPKS----------------------------------VVFAKAVLYM------------
TRM5_ENTHI        IEST----------------------------------KHLTSGNNVPEAKKTLN-----
TRM51_ARATH       LPE-----------------------------------ACLKQEE---------------
TRM52_VITVI       LSEE----------------------------------ACFKEDATKSLLDSSGDL----
TRM5_SORBI        LPM-----------------------------------ECLREDDSENHIESVA------
TRM5_PHYPA        VSWFISRS-------------------------FIWSLYFFCLIQAHLVLDSIEHR----
TRM5_TRIVA        CAD-------------------------------------LFADEDDDKPHKVE------
TRM51_PHATC       LPVETQSL----------------------------VKMKLQPLRTETSEPGAKRIKSN-
TRM5_THAPS        LPVEVAGV----------------------------EKLLLTKNSDAEVNGKRKRENYDC
TRM5_PLAKH        LKDVF-------------------------------------------------------
TRM5_PLAVS        LKDVFSQGDQLG------------------------------------------------
TRM5_PLAF7        LKDLL-------------------------------------------------------
TRM5_THEAN        CPVSILRGKKE-------------------------------------------------
TRM5_THEPA        CPISILRGNKE-------------------------------------------------
TRM5_PARTE        LDKKSAESEFGLVEQEDGNNSDFEDDEKMEQHELVEDVVNKKVKID--------------
TRM5_CAEEL        LPYEFLLAEPFPDE---------------------PEAQCESEEAEEPSSKRIKVDT---
TRM5_ENCCU        -SSLFLRRGLG-------------------------------------------------
B7XK87_ENTBH      HNDIFNID----------------------------------------------------
I3EPE9_NEMP1      LLQ---------------------------------------------------------
TRM5_USTMA        HPNYSKYKHLESQHDFMQYVHQEWLERDAAQHTPNLSIHYVRDVAPNKQMYCLSFQCPSQ
TRM5_GIAIC        QKETVKVLKK--------------------------------------------------
TRM52_PHATC       ------------------------------------------------------------
                                                                              

TRM5_HUMAN        ------------------------
TRM5_MACMU        ------------------------
TRM5_BOVIN        ------------------------
TRM5_MOUSE        ------------------------
TRM5_XENTR        ------------------------
TRM5_DANRE        ------------------------
TRM5_CIOIN        ------------------------
TRM5_ANODA        PDTNKMETDLTKLEMK--------
TRM5_ANOGA        PDTKKIEADLNEMQM---------
TRM5_AEDAE        ANTKQVEAGLDKMQM---------
TRM5_DROME        ------------------------
TRM5_DROPS        ------------------------
TRM5_PEDHC        ISKKKEKPDDK-------------
TRM5_EMENI        ------------------------
TRM5_ASPFU        ------------------------
TRM5_PHANO        ------------------------
I1RCE4_GIBZE      ------------------------
TRM5_NECH7        ------------------------
TRM5_NEUCR        ------------------------
TRM5_TUBMM        ------------------------
TRM5_AJECG        ------------------------
TRM5_CANAL        ------------------------
TRM5_CANAW        ------------------------
TRM5_YEAST        ------------------------
TRM5_YARLI        ------------------------
TRM5_SCHPO        ------------------------
TRM5_COPC7        ------------------------
TRM5_CRYNJ        ------------------------
TRM5_PUCGT        ------------------------
TRM5_LEIIN        ------------------------
TRM5_LEIMA        ------------------------
TRM5_LEIBR        ------------------------
TRM51_TRYCC       ------------------------
TRM52_TRYCC       ------------------------
TRM5_DICDI        RNSTEDSNETNETDSIDTNKKLKN
TRM5_POLPP        IDYNEAVSSGGE------GKKIKH
TRM5_BATDJ        LEKDT-------------------
TRM5_PHYIT        ------------------------
TRM52_ARATH       ------------------------
TRM51_VITVI       ------------------------
TRM5_ENTHI        ------------------------
TRM51_ARATH       ------------------------
TRM52_VITVI       ------------------------
TRM5_SORBI        ------------------------
TRM5_PHYPA        ------------------------
TRM5_TRIVA        ------------------------
TRM51_PHATC       ------------------------
TRM5_THAPS        VAEVSNVSKKERDS----------
TRM5_PLAKH        ------------------------
TRM5_PLAVS        ------------------------
TRM5_PLAF7        ------------------------
TRM5_THEAN        ------------------------
TRM5_THEPA        ------------------------
TRM5_PARTE        ------------------------
TRM5_CAEEL        ------------------------
TRM5_ENCCU        ------------------------
B7XK87_ENTBH      ------------------------
I3EPE9_NEMP1      ------------------------
TRM5_USTMA        VLWANTSTSQHT------------
TRM5_GIAIC        ------------------------
TRM52_PHATC       ------------------------