CLUSTAL format seed alignment for MF_03153

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RU1C_AJECG       ---------MNYLGDYCDVYLTHDSMSVRKAHNSGRNHLRNVVEYYQEIGH-EKAQSVID
RU1C_SCLS1       ----------MPKCDYCDVYLTHDSMSVRKAHNSGRNHLRNVVDYYQQIGH-EKAQSVID
RU1C_EMENI       --------MPKFFCDYCDVYLTHDSMSVRKAHNSGRNHLRNVVEYYQQIGQ-EKAQSVID
RU1C_ASPFU       --------MPKFFCDYCDVYLTHDSMSVRKAHNAGRNHLRNVVEYYQQIGQ-EKAQSVID
RU1C_NECH7       --------MPKFFCDYCDVYLTHDSMSVRKAHNSGRNHLRNVVDYYQQIGH-EKAQSVID
RU1C_NEUCR       --------MPKFFCDYCDVYLTHDSMSVRKAHNSGRNHLRNVVDYYQQIGH-EKAQSVID
RU1C_TUBMM       --------MPKFFCDYCDVYLTHDSISVRKAHNSGRNHLRNVVDYYQQIGH-EKAQSVID
RU1C1_PUCGT      --------MGKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGH-DKAQSYID
RU1C2_PUCGT      --------MGKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGH-DKAQSYID
RU1C_CRYNJ       --------MGKYYCDYCDIYLTHDSMNARKAHNSGRNHVANVRDYFAGLGG-NQAQSLID
RU1C_COPC7       --------MPKHYCDYCDVFLTHDSASVRKAHNSGRNHLANVRDYYASLGH-DKAQSIID
RU1C_USTMA       --------MGKHYCDYCDVFLTHDSVSVRKAHNSGRNHLQNVREYYQTLEP-ECIQQVLD
RU1C_BOVIN       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_HUMAN       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_CANLF       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_MACMU       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_MOUSE       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_RAT         --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_CHICK       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_XENTR       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_DANRE       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWME-EQAQSLID
RU1C_MONDO       --------MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVRDYYQKWME-EQAQSLID
RU1C_BRAFL       --------MPKYFCDYCDTYLTHDSPSVRKTHCNGRKHKENVRVYYQKWME-EQAQQLID
RU1C_IXOSC       MFFLPVCTCCRYYCDYCDTYLTHDSPSVRKTHCNGRKHKENVKFYYQKWME-EQAQNLID
RU1C_ANODA       --------MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWME-EQAQHLID
RU1C_ANOGA       --------MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWME-EQAQHLID
RU1C_AEDAE       --------MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWME-EQAQHLID
RU1C_DROME       --------MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWME-EQAQHLID
RU1C_DROPS       --------MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWME-EQAQHLID
RU1C_PEDHC       --------MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKFYYQKWME-EQAQHLID
RU1C_CIOIN       --------MPKYFCDYCDTYLTHDSPSVRKTHCSGRKHKDNVKMYYQTWME-EQAQELID
RU1C_NEMVE       --------MPKYYCDYCDTFLTHDSPSVRKTHNNGRKHKENVRFYYQKWME-EQAQTLID
RU1C_CAEBR       --------MPKYYCDYCDTFLTHDSPSVRKTHNGGRKHKDNVRMFYQKWME-DQAQKLVD
RU1C_CAEEL       --------MPKYYCDYCDTFLTHDSPSVRKTHNGGRKHKDNVRMFYQKWME-DQAQKLVD
RU1C_ARATH       --------MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRIYYQQFEE-QQTQSLID
RU1C_VITVI       --------MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRSYYQQFEE-QQTQSLID
RU1C1_SORBI      --------MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRTYYQQFEE-QQTQSLID
RU1C2_SORBI      --------MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRTYYQQFEE-QQTQSLID
RU1C_PHYIT       --------MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYY--------------
RU1C_BATDJ       -MTMDGVFPLTATVDYCDIFLTHDSASVRKAHNTGWKHKMQVEHYYNAEVDPAKIQSVID
RU1C_DICDI       --------MPKYYCDYCDKYLTHDSPSVRKSHTVGKQHKLAVQLFYQQFEA-EFTQSLIE
RU1C_POLPP       --------MPKYYCEYCDKYLTHDSPSVRKSHTIGKVHQQAVTLYYKQFEA-EWFKSQMQ
RU1C_PLABA       --------MPKYYCEYCDIYLTHSSPVGRRQHNQGRKHISAKIEYFQNLLR---EEGITP
RU1C_PLAYO       --------MPKYYCEYCDIYLTHSSPVGRRQHNQGRKHISAKIEYFQNLLR---EEGITP
RU1C_PLACH       --------MPKYYCEYCDIYLTHSSPVGRRQHNQGRKHISAKIEYFQNLLR---EEGITP
RU1C_PLAF7       --------MPKYYCEYCDIYLTHSSPVGRRQHIHGRKHISAKIEYFQNLLR---EEGITP
RU1C_PLAKH       --------MPKYYCEYCDIYLTHSSPVGRRQHVQGRKHISAKIEYFQNLLR---EEGITP
RU1C_PLAVS       --------MPKYYCEYCDIYLTHSSPVGRRQHIQGRKHISAKIEYFQNLLR---EEGITP
RU1C_THEAN       --------MPKFYCEYCSIYLTHSSPAGRKQHSQGRKHISAKVEYFQRLVR---EQFFQP
RU1C_THEPA       --------MPKFYCEYCSIYLTHSSPAGRKQHSQGRKHISAKVEYFQRLVR---EQFFQP
RU1C_SCHPO       --------MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEEAQKQLEE
RU1C_CANAL       --------MPKYYCDYCKSYLTHDTMSVRKSHLQGRNHIKFYCDYYEAKAK---ETNIWN
RU1C_CANAW       --------MPKYYCDYCKSYLTHDTMSVRKSHLQGRNHIKFYCDYYEAKAK---ETNIWN
RU1C_YEAST       --------MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHK
                               :**  :*. .:   *: *  *  *      ::              

RU1C_AJECG       S-------ITNSYAAEGQ-------------ASSNPMLQQPGAPGAYPP-PAFGFPGRPG
RU1C_SCLS1       S-------ITSSYAAEGQ-------------SSSNPMLHNPAAATPFPPFPPANFPG--G
RU1C_EMENI       S-------ITSSYAAEGQ-------------AVPNPAMVPP---GAYPP--PFGFPG---
RU1C_ASPFU       S-------ITSSYAAEGQ-------------AVPNPAMAPP---GAFPP--PFGFPGRPG
RU1C_NECH7       S-------ITSSYAAEGQ-------------AHANPMLPQNQPG--------QGFP----
RU1C_NEUCR       S-------ITSSYAAEGQ-------------AHANPMLPQNQPGGVPPG---LGFP----
RU1C_TUBMM       S-------ITSSYAAEGQPM-----------PSVHSTTPGAGGAGSVGA---GGFPL---
RU1C1_PUCGT      E-------ITRMFETGGGN------------------STSNRGPGGNPP---GSQP----
RU1C2_PUCGT      E-------ITRMFETGGGN------------------STSNRGPGGNPP---GSQP----
RU1C_CRYNJ       Q-------IIQQHESGGRNQMMMAPSMRLGAGFMNPLATQPGYPGPPPP---GAFP----
RU1C_COPC7       Q-------ITSAFESGQGPPP-------------GGFGFGPQHLQAPPQ---GGFAPPMG
RU1C_USTMA       T-------LAQEYDLRGIE------------KPRDLLQPAGSSFMTFGAGPLSGSSD---
RU1C_BOVIN       K-------TTAAFQQGKIPP--------------TPFSAPP------PAGAMIPPPPSLP
RU1C_HUMAN       K-------TTAAFQQGKIPP--------------TPFSAPP------PAGAMIPPPPSLP
RU1C_CANLF       K-------TTAAFQQGKIPP--------------TPFSAPP------PAGAMIPPPPSLP
RU1C_MACMU       K-------TTAAFQQGKIPP--------------TPFSAPP------PAGAMIPPPPSLP
RU1C_MOUSE       K-------TTAAFQQGKIPP--------------APFSAPP------PAGAMIPPPPSLP
RU1C_RAT         K-------TTAAFQQGKIPP--------------APFSAPP------PAGAMIPPPPSLP
RU1C_CHICK       K-------TTAAFQQGKIPP--------------TPFSAPP------PGGAMIPPPPSIP
RU1C_XENTR       K-------TTAAFQQGKIPP--------------TPFAAPP------AGSAMIPPPPSMG
RU1C_DANRE       K-------TTAAFQQGKIPP--------------TPFPGAP------PPGGSLLPHPSIG
RU1C_MONDO       K-------TTTAFQQGRIPP--------------NLFSAPP------LGGPMIPP-----
RU1C_BRAFL       Q-------TTAAFQAGKIPN--------------NPFPNAAGQVGNEPGAKVLPPAILQA
RU1C_IXOSC       A-------TTAAFKAGKIQS--------------SQYQNKP-----ISGAMIPPPAALQ-
RU1C_ANODA       A-------TTAAYKAGKIAQ--------------NPFTAGP----PKPN-ISIPP---PT
RU1C_ANOGA       A-------TTAAYKAGKIAP--------------NPFTAGP----PKPN-ISIPP---PT
RU1C_AEDAE       A-------TTAAFKAGKIAQ--------------NPFSAGP----PKPN-VAIPP---PS
RU1C_DROME       A-------TTAAFKAGKITN--------------NPFAGGPGGAPPKPAGVSIPP---PN
RU1C_DROPS       A-------TTAAFKAGKITN--------------NPFAGGPSSAPPKPSGVSIPP---PN
RU1C_PEDHC       A-------TTAAFKAGKIA---------------NPFAPKPGAAIPPPANMQGPPRPVPP
RU1C_CIOIN       K-------TTQAFQKGKMG----------------NFGGLP------PNGMMMGP-----
RU1C_NEMVE       Q-------TTAAFQSKPNSQ--------------MPPNAPPG---LMPPPGMLPP-----
RU1C_CAEBR       Q-------TARAFATNRMHG--------------AVPRTTM-------GMAPVPPVGHHP
RU1C_CAEEL       Q-------TARAFATNRMQG--------------AVPRTTM-------GMAPVPPVGHHP
RU1C_ARATH       QRIKEHLGQTGGYQQVGAVF--------------NQHMLA------RPRPPMMLPPG---
RU1C_VITVI       QRIKEHLGQTAAFQQVGAAY--------------NQHLVSFPGNPPRPRLPVLPTPGMPV
RU1C1_SORBI      QRIKEHLGQAAAFQ-AGAPF--------------NQHMLTFPGAVARPRLPILPTPGMP-
RU1C2_SORBI      QRIKEHLGQAAAFQ-AGAPF--------------NQHMLAFPGAVARPRLPILPTPGMP-
RU1C_PHYIT       --------------EQFLAG--------------QGVIMNPGEWLRGPAPMGSLPPRPNG
RU1C_BATDJ       N-------VTKAYIDAGLPG--------------FPELIAVGVNGQRGQPVGGPPRPPQP
RU1C_DICDI       ARL-----KEYEESKGRLIH-------------QPPMGIIP--TPYGQMYQQQQQQQ---
RU1C_POLPP       QK------------GGQVPM-------------MPPFGMQPGLLPPNMVPGQFNIPM---
RU1C_PLABA       Q-------NFLGFLGNQGYNN----------TLANPMMNNFMPGNYNAYMKYNPMRNYHH
RU1C_PLAYO       Q-------NFLGFLGNQGYNN----------ALANPMMNNFMPGNYNAYMKYNPMRNYHH
RU1C_PLACH       Q-------NFLGFLGSQAYNN----------ILSNPMMNNFMHGNYNGYMKYSPMRNYHH
RU1C_PLAF7       Q-------NFLGFLNNRNINN----------PLGNPMMNYM---NPNMYMKYNPMKSYHS
RU1C_PLAKH       Q-------NFLGFLGPRALNN----------ILGNPMMNNMMPGNFPMHMKHNNMKHHSH
RU1C_PLAVS       Q-------NFLGFLGNRAFNN----------MLGNPMMNNMMPGNFPMHMKHGGMKHHSH
RU1C_THEAN       P-------VFLGQTPP------------------------IFPGNFRAINHSLGPPMMGV
RU1C_THEPA       P-------VFLGQTPP------------------------IFPG----------LPMMGV
RU1C_SCHPO       R-------ASSGFLKKGNGS--------------LDLPYAYAFPPKYNVFNLGCPP----
RU1C_CANAL       P-------SSIPYEITLEKL--------------NRYSDAKKSNGSSEDNMDIDKKE---
RU1C_CANAW       P-------SSIPYEITLEKL--------------NRYSDAKKSNGSSEDNMDIDKKE---
RU1C_YEAST       RRHIGKRGRKERENSSQNETLKVTCLS-------NKEKRHIMHVKKMNQKELAQTSIDTL
                                                                             

RU1C_AJECG       MLPPP---PPFGM----PGAPPGAPPGGMIPLPGGRGMPPFPPPPPF-------------
RU1C_SCLS1       VPPPF---PPASG----PGGMPFPPPG-----ARGFPMPPLP------------------
RU1C_EMENI       QFPP----PPFGIP--PPG-PGGA--AMP-PPPGARNLPFPPPFPPSSG-----------
RU1C_ASPFU       QLPP----PPFGIP--PPGGPNGAPPGMPIPPPGGRGLPFPPPFPPA-------------
RU1C_NECH7       --PP-----PFG----FPGGIPPP----FPGMPGA----PPGQF----------------
RU1C_NEUCR       --PPGAGVPPFPP---FPGGMPPP----FPGMPGGAPVPPPGAFGAPGV-----------
RU1C_TUBMM       -LPPSAAAAAAAAGLQMPLSLPPPPFG-FPARPGMMVPPPPPPF----------------
RU1C1_PUCGT      GPPNAGMSGPMRP----PFSNSTAG----PNMPP-LPPAMLALMN---------------
RU1C2_PUCGT      GPPNAGMSGPMRP----PFSNSTAG----PNMPP-LPPAMLALMN---------------
RU1C_CRYNJ       TFPPTAGTPPFRP----PFPPSSAPGAPPPTMPPFLPPNASAGAA---------------
RU1C_COPC7       GFPPGGFPPGPRP----PFPPGPGF---PPMMPPGAPPFPPNAMP---------------
RU1C_USTMA       -RAFRSQVPPSRMSMGGGVGGGSDRRGDSRGGSGGYGRYGNNDGS---------------
RU1C_BOVIN       GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_HUMAN       GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_CANLF       GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_MACMU       GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_MOUSE       GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_RAT         GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_CHICK       GPPRPGMMPA---------PHMGGPPMMPMMGPPPPGMMPVGPAP---------------
RU1C_XENTR       GPPRPGMMPA---------PPMAGPPMMPMMGPPPPGMMPVGHGP---------------
RU1C_DANRE       GPPRPGMLPA---------PPMGGPPMMPMMGPPPHAMMPGGPGP---------------
RU1C_MONDO       --PHP-----------------------SMMGPPPPGMMPVGPPP---------------
RU1C_BRAFL       AAFQAGKIASNPFP--TSQAGPGPQGGGTMIPPPPSLQGPGGPGS---------------
RU1C_IXOSC       ---------------------PGPPQRMPLVGPPH-----MGPMP---------------
RU1C_ANODA       MNMPP---------------RPGIIPGMPAGAPP-LLMGPNGPLPPP-------------
RU1C_ANOGA       MNMPP---------------RPGMIPGMPAGAPP-LLMGPNGPLPPP-------------
RU1C_AEDAE       MGMPA---------------RPGMIPGMPAGAPP-LLMGP-GP-----------------
RU1C_DROME       MGAPP---------------RPG-MPGMPYMPP---LMNPMM------------------
RU1C_DROPS       MGAPP---------------RPG-MPGMPFMPP---MMNPMMT-----------------
RU1C_PEDHC       GPMGP---------------GPNMLGPGPMGPMGPMMMGPNGP-----------------
RU1C_CIOIN       ---------------------RGPMPMMPMMPVRPMGMGGMLPM----------------
RU1C_NEMVE       ---------------------PGGMPP-GRMPPQGLPFPPPGPIP---------------
RU1C_CAEBR       M--------------------MGGPPGMPMMAPRPFPGPPVGFPG---------------
RU1C_CAEEL       M--------------------MGGPPGMPMMAPRPFPGPGVGFPG---------------
RU1C_ARATH       ----SMPM-------------GMRPPVLPRPMMPPQGYMPPPGVPQM-------------
RU1C_VITVI       AGSAPLPMN-------SPLVPGMRPPVLPRPVPGAPGYMPAPGMPSM-------------
RU1C1_SORBI      ---HGFPQAPG-----APLMPGVRPPILPAPGIPGYPGGP-PTMLQP-------------
RU1C2_SORBI      ---HGFPQ--------APLMPGVRPPILPAPGVPGYPGAP-PTMPQP-------------
RU1C_PHYIT       PMNGGMPGGY----------PPRGVPPRGMMPPPGPVMRPPMFR----------------
RU1C_BATDJ       FHNGGRPG-------------PPGRPPMGMFPPQRPMMPPPHMRPGLSQMPPG-------
RU1C_DICDI       --------------------QQQGILPFQGMQPPPHQQQGMVLSP---------------
RU1C_POLPP       --------------------MPPGQFPFP---PPPGQPMG--------------------
RU1C_PLABA       SNRNSNYQHSIGM-------HNNKYSRAGYVPPG-SNKYPNNHFHNN-----------KR
RU1C_PLAYO       SNRNPNYQHSIGM-------HNNKYSRAGYVPPG-SNKYPNNHFHNN-----------KR
RU1C_PLACH       SNRNPNYQHSVGM-------HNNKYSRAGYVPPG-ANKYPNNNFHNN-----------KR
RU1C_PLAF7       YSMRSSHPYRLNI-------HNNKYSRAGYVPPS-HHKYSVNPMHNNYHQAHNNYSYPNS
RU1C_PLAKH       YSRRS---HRHHM-------PHGRYGRERHGHYSYSSKYHSHPMHMN----------SSS
RU1C_PLAVS       YSRHS---HRHHM-------SHGRYNRERHGHHSYSSKYHSHPMHMN----------SNS
RU1C_THEAN       FPGFAPLQTPNII-------PQGMMNGIPGGLPGPIPGVPPVPVPMP-------------
RU1C_THEPA       FPGFTPLQPPNII-------PQGLMNGIPGGLPGPVPPVPPVPVPMP-------------
RU1C_SCHPO       --------------------PPYIVSANTYMAPKGMNAMNAAAFVPM-------------
RU1C_CANAL       --------------------NSSDHNKGNVVNHSDAGNDNDDDDD---------------
RU1C_CANAW       --------------------NSSDHNKGNVVNHSDAGNDNDDDDD---------------
RU1C_YEAST       KLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDE-------
                                                                             

RU1C_AJECG       ---------------GGTSGGPPMPGDLPPPPLPNMPSGNIPFPPPNGFPP---NFQFP-
RU1C_SCLS1       ----------------GQPGAPPMP------PFPGMPAG-MPFPPPGGLPP---NFQFP-
RU1C_EMENI       ---------PMGAPPGAGPAGLPTPP--NMPPNMATPPG--SAPPPGQFPPPPGGFPIP-
RU1C_ASPFU       --------------PGGAPGGLPPPPLGNMPPGQGFPP----VPPPGGFPP---NFQIP-
RU1C_NECH7       ---------PQGMPPP-PGGGRGMPPMPPFPPGPNG-MPVPPNGLPFPPPG---GFPFP-
RU1C_NEUCR       ---------PGGIPPPGAPGARGMPPMPPFPGMPGAPAGIPGVPPPMPGPG---GLPFP-
RU1C_TUBMM       -----------GFPPPPLGRGGAAAGFSGFPGMDAAGGGAGGGVQPQLLPG---MVVPPG
RU1C1_PUCGT      -------------GQNGMSSPGSGPPPMRFAGPPIPNNM-----PPGMMQP-----PHV-
RU1C2_PUCGT      -------------GQNGMSSPGSGPPPMRFAGPPIPNNM-----PPGMMQP-----PHV-
RU1C_CRYNJ       -------------PGIGMGSTPPFPPNTASPNPGMPPFR-----PPMGMGM-----PPA-
RU1C_COPC7       -------------PPGAFGGPPPFPPNGPPGAPPFPPNASQQGGPPGAPSF-----PPP-
RU1C_USTMA       -------------RDQGAPPNYSRPPPQGGPYSRPPPDMMAGGPPGISNGP----YPPR-
RU1C_BOVIN       -----------GMRPPMGGHMPMMPGPPM-----MRPPARPMMVPTRPGMTR--------
RU1C_HUMAN       -----------GMRPPMGGHMPMMPGPPM-----MRPPARPMMVPTRPGMTR--------
RU1C_CANLF       -----------GMRPPMGGHMPMMPGPPM-----MRPPARPMMVPTRPGMTR--------
RU1C_MACMU       -----------GMRPPMGGHMPMMPGPPM-----MRPPARPMMVPTRPGMTR--------
RU1C_MOUSE       -----------GMRPPMGGHMPMMPGPPM-----MRPPARPMMVPTRPGMTR--------
RU1C_RAT         -----------GMRPPMGGHMPMMPGPPM-----MRPPARPMMVPTRPGMTR--------
RU1C_CHICK       -----------GMRPPMGGHMPMMPGPPM-----MRPPSRPMMVPTRPGMTR--------
RU1C_XENTR       -----------GMRPPMGAHMPMMPGPPM-----MRPPTRPMMLQSRPGMAR--------
RU1C_DANRE       -----------GMRPPMGGPMQMMPGPHM-----MRPPARPMMPAVRPGMVR--------
RU1C_MONDO       -----------GMRMPMGGHMPMMPGPPM-----MRPLPHPMMVPTRPVMPR--------
RU1C_BRAFL       ----------APAPPRMPGPLLMTPPPGA-----AAPGMAPPGAPTLPQPARGPILSVGA
RU1C_IXOSC       ----------GPMPGPMPGPMPMMGHPGP-----MPPNMMMPGDSFFPAP----------
RU1C_ANODA       --------MMGMRPPPMMVPT-MGMPPMG-----LGMR--PPVMSAAPPQLN--------
RU1C_ANOGA       --------MMGMRPPPMMVPT-MGMPPMG-----LGMR--PPVMSAAPPQLN--------
RU1C_AEDAE       ---------MGMRPP-MMMP--MGMPPMG-----MGMR--PPMMNGPPPQMN--------
RU1C_DROME       ----------GMRPPPIMNPMAMMGPPPP-----LGTI--PGVR---PGIMNG-------
RU1C_DROPS       ----------GMRPPPIMNPMAMMGPPPP-----LGTI--PGVR---PPIMNG-------
RU1C_PEDHC       --------IRGPMAGPIMGPMGPMMGPMGHMGPMMGPIGGPMMSPMRPIMTNM-------
RU1C_CIOIN       ----------RPVPPAMMGGGQVMM---------MGPR---------PGM----------
RU1C_NEMVE       -------------PPPGAGGMRPPHGQMH-----MGGPRPQMGRPPMSLRS---------
RU1C_CAEBR       ----------APGLAPFPGPPMGLAGPPG-----MPPMMPRPPQQFRPM-----------
RU1C_CAEEL       ----------APGMPPFPGGPMGMAGPPG-----MPPMMPRPPQQFRPM-----------
RU1C_ARATH       --------MAPPGAP-LPPPPQNGILRP---PGMAPIPGQGGGPPGMAPIPGQGGGPPPN
RU1C_VITVI       --------MAPPGAPSMPMPPLNSLPRP---PTMNVPPAV----PGSTSTPTSGGAPS--
RU1C1_SORBI      --------GAPPGSMPQPGAPPGSMPQPGAPPGSMPMQMAPLPRPPTLPPPTSGVPGAPI
RU1C2_SORBI      --------GAPPGSMPQPGAPPGSMPQPGAPPGSMPMQMAPLPRPPTLPPPTSGVPGAPI
RU1C_PHYIT       ------------GPP-------RGPPPMGAMGMRGPPGPGAMGGPPPRSIYGP-------
RU1C_BATDJ       --------MRPPGPPPHGFMNGSMPPPLGTPVMENGPVAGQQSQAPVAPRIHPDRLRLAG
RU1C_DICDI       -----------GMPIHKMQPHQFNNNNNPHQQHSFQPPHHQHHPHQQHQQHQQ-------
RU1C_POLPP       -----------GMPPHQQQPMSFN------PHHPYPPPHLQQSAQQFNSNSPP-------
RU1C_PLABA       IN----------------NIPKPYNN-------YTNKPITNSSYKNDKQD-YRNNNESND
RU1C_PLAYO       IN----------------NIQKPYNNFDNKNNNYNNKPITNSSYKNDKQD-YRNNNENND
RU1C_PLACH       IS----------------NTPKPYNN-------YTNKPITNSPYKNDKQD-YRNNNE---
RU1C_PLAF7       INPSNQINYSNNYGSNNFNNSNEFNKNMNEKDNINNNDIHDNKVKTDENDPINNDNLNNT
RU1C_PLAKH       MSSMSGFPY-NEHSGNFFSLSNSMHGNGKMGNMVIRDLVSNVNIENDLVKDNPNEERNGD
RU1C_PLAVS       IGNPSGFSN-GKYSGSFFSSPNAMHGNGKMFNNTIRDLVSNVNIDSDPVKDSQNGERVGD
RU1C_THEAN       -----------------------------------AIPVIPTELPNMKIDLNQHNAPSVN
RU1C_THEPA       -----------------------------------AIPVIPNEPPNMKIDLNQHNASGVN
RU1C_SCHPO       ------------MPAVNLTNQVAFSAPQTTASSNTQLTQQQQSLPQTNEHQRARTHSNAN
RU1C_CANAL       -----------EMIFLPPPPNLSGLPLPPPAVYNNQKEYQKAILRQTLTKS---------
RU1C_CANAW       -----------EMIFLPPPPNLSGLPLPTAAVYNNQKEYQKAILRQTLTKS---------
RU1C_YEAST       --------TCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVDILQTTIKESKKRM
                                                                             

RU1C_AJECG       --PPG-AAGFPPPP-IPGQGQTQSTSPGPGATGTPVPPPGFPLPGAP-------------
RU1C_SCLS1       --IPP-PGGFPGMP-PPGQG----------------------FPGMP-------------
RU1C_EMENI       --PPNFQGGFPPMPGAPGQG-----------PAGFSPSPGPGLSGPPGGGSGPDAPGGFA
RU1C_ASPFU       --PPG-AGGFPPVP-PPGQ-------------PGFSPSPGPGMSGPP-------------
RU1C_NECH7       ---PPGAPGAPGAP--GASG--------------GAPPPFPGLPGMPPPGQ--------G
RU1C_NEUCR       ---PPG--GLPFPP--PGAG--------------NFPFPPPGAPGAFP-----------G
RU1C_TUBMM       FVPPPG--GMMVPP--PGAGF-------------TMPPPLGGFPAGAP------------
RU1C1_PUCGT      ---NGYSSGPLPPQPQPASG-----------------GQGAPPLT---------------
RU1C2_PUCGT      ---NGYSSGPLPPQPQPASG-----------------GQGAPPLT---------------
RU1C_CRYNJ       ---PAQAQAQGSPMGMPQQG-----------------QQGTFTPTQEV------------
RU1C_COPC7       ---PGGFNGPPPPSGQNSQG-----------------PPPPTNPGP--------------
RU1C_USTMA       --GPPLGYGAPLPGAYPSGP-----------------PPNMRGPPP--------------
RU1C_BOVIN       -------PDR--------------------------------------------------
RU1C_HUMAN       -------PDR--------------------------------------------------
RU1C_CANLF       -------PDR--------------------------------------------------
RU1C_MACMU       -------PDR--------------------------------------------------
RU1C_MOUSE       -------PDR--------------------------------------------------
RU1C_RAT         -------PDR--------------------------------------------------
RU1C_CHICK       -------PDR--------------------------------------------------
RU1C_XENTR       -------PDR--------------------------------------------------
RU1C_DANRE       -------PDR--------------------------------------------------
RU1C_MONDO       -------PDR--------------------------------------------------
RU1C_BRAFL       VMGPRLCKHSYHINKALFLIKIHTLQKATQSQLVVYKTVEKSK-----------------
RU1C_IXOSC       -------KHVH-------------------------------------------------
RU1C_ANODA       -------PK---------------------------------------------------
RU1C_ANOGA       -------PKS--------------------------------------------------
RU1C_AEDAE       -------QKVYHNTDRRYHR----------------------------------------
RU1C_DROME       -------PK---------------------------------------------------
RU1C_DROPS       -------PK---------------------------------------------------
RU1C_PEDHC       -------PQPGQPPRAKE------------------------------------------
RU1C_CIOIN       ------------------------------------------------------------
RU1C_NEMVE       ------------------------------------------------------------
RU1C_CAEBR       ------------------------------------------------------------
RU1C_CAEEL       ------------------------------------------------------------
RU1C_ARATH       YNGLPPPPPYHTNP---AAPPSGNFNNP--NLNNPNPSAESPESNE--------------
RU1C_VITVI       ---MMTQPMYQANP---AGPTSGGFDSF--NIN-----AQGPEANH--------------
RU1C1_SORBI      PNSAAPPAIYQTNPPAPAGPTSGAPPAPPTAPQPAFSYAQPSEGNH--------------
RU1C2_SORBI      PNSAAPPAIYQANPPAPAGPTSGAPPAPPTAPQPAFSYALPSEGNH--------------
RU1C_PHYIT       ------------------------------------------------------------
RU1C_BATDJ       NSIKSKLVIESIYCFYPFGCLDSQIATHTFLYHCANDS----------------------
RU1C_DICDI       ------HQHQHQHQQQHNQPTIPGL-----------------------------------
RU1C_POLPP       ------SNNDQ-------------------------------------------------
RU1C_PLABA       NMNSNNFSNYQVNKENAN------------FVNKNNEQPN--------------------
RU1C_PLAYO       NMNSNHFSNYQMNKENAN------------FVNKNNE-----------------------
RU1C_PLACH       --NSNNFSNYQMNKDNSN------------FVNKNSEQPN--------------------
RU1C_PLAF7       RNFSYEENHYSTDHKKPS------------FLNPENSKEHIESDIS--------------
RU1C_PLAKH       SAIANQPSTMHHEEDQDD------------PANATGGTANNNDNVSINA-----------
RU1C_PLAVS       NAIDKVSSGMHDQGDRGDLGDHADHADHAGPVSATDGTANGNDQVSVDA-----------
RU1C_THEAN       STSTTGAQ----------------------------------------------------
RU1C_THEPA       NTSATTAQ----------------------------------------------------
RU1C_SCHPO       NHFTKTHHQGQRSHQRFVRA----------------------------------------
RU1C_CANAL       ------------------------------------------------------------
RU1C_CANAW       ------------------------------------------------------------
RU1C_YEAST       HSDGIRKPSSANGYKRRRYGN---------------------------------------
                                                                             

RU1C_AJECG       -PLGQSAGITPPPGVPQKPASSPGPSQEGK-
RU1C_SCLS1       -PPG-------------------GNHDERR-
RU1C_EMENI       PPPGMGPGGFSGP---------PPALGDKR-
RU1C_ASPFU       APPGTGSSSLPGP---------PPGLSEKR-
RU1C_NECH7       FPPGGPPGFAPPGA--------GAPGHEKR-
RU1C_NEUCR       MPP-----FGAPGQ--------GPPGADKR-
RU1C_TUBMM       LPG------APPGY--------GPPGAK---
RU1C1_PUCGT      ------ARMNPDR---------ARQLGLI--
RU1C2_PUCGT      ------ARMNPDR---------ARQLG----
RU1C_CRYNJ       -PQGAGAGIHPDR---------LRMLGQ---
RU1C_COPC7       ------GGMHPDR---------ARMMGPGGR
RU1C_USTMA       -PLASNGSHAPHSR---------TGYGPR--
RU1C_BOVIN       -------------------------------
RU1C_HUMAN       -------------------------------
RU1C_CANLF       -------------------------------
RU1C_MACMU       -------------------------------
RU1C_MOUSE       -------------------------------
RU1C_RAT         -------------------------------
RU1C_CHICK       -------------------------------
RU1C_XENTR       -------------------------------
RU1C_DANRE       -------------------------------
RU1C_MONDO       -------------------------------
RU1C_BRAFL       -------------------------------
RU1C_IXOSC       -------------------------------
RU1C_ANODA       -------------------------------
RU1C_ANOGA       -------------------------------
RU1C_AEDAE       -------------------------------
RU1C_DROME       -------------------------------
RU1C_DROPS       -------------------------------
RU1C_PEDHC       -------------------------------
RU1C_CIOIN       -------------------------------
RU1C_NEMVE       -------------------------------
RU1C_CAEBR       -------------------------------
RU1C_CAEEL       -------------------------------
RU1C_ARATH       -------------------------------
RU1C_VITVI       -------------------------------
RU1C1_SORBI      -------------------------------
RU1C2_SORBI      -------------------------------
RU1C_PHYIT       -------------------------------
RU1C_BATDJ       -------------------------------
RU1C_DICDI       -------------------------------
RU1C_POLPP       -------------------------------
RU1C_PLABA       -------------------------------
RU1C_PLAYO       -------------------------------
RU1C_PLACH       -------------------------------
RU1C_PLAF7       -------------------------------
RU1C_PLAKH       -------------------------------
RU1C_PLAVS       -------------------------------
RU1C_THEAN       -------------------------------
RU1C_THEPA       -------------------------------
RU1C_SCHPO       -------------------------------
RU1C_CANAL       -------------------------------
RU1C_CANAW       -------------------------------
RU1C_YEAST       -------------------------------