CLUSTAL format seed alignment for MF_03158

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

THI4_YEAST       ---------------MSATSTATSTSASQLHLNSTPVTHCLSDIVK--------------
THI4_ASHGO       ---------MQNEHSEFAKMSQTLTNVQELRLRASTTRHALSDIVR--------------
THI4_CANAL       --------MTPPTMLQTAPVESFNLNPKSTQQAINLKSDAKNGKVS--------------
THI4_CANAW       --------MTPPTMLQTAPVESFNLNPKSTQQAINLKSDAKNGKVS--------------
THI4_PHANO       --------MSPPAATFDIPVANTGNGLSLK--KDLAVKPAASGVAKSLAEI---------
THI4_YARLI       --------MAPPPAVVAHPLSSQATGLDMV--HEFNQKLTKSD-----------------
THI4_NEUCR       --------MSPSVLEPQSVPTLVNVGLKAVGRNDAPVERDARGLSKPLLELM--------
THI4_ASPOR       --------MSPPAAIYE-PTVAAT-GLKGKVVVSETAPVEGASQTKLLDHF---------
THI4_EMENI       --------MSPPAAIFE-PTVAPT-GIKGKVVVPETATIPGDSQTKLLDHF---------
THI4_ASPFU       --------MSPPAAIFE-PAVAPSPSLKAKVLVPETVPASGTSQTHLLDHF---------
THI4_AJECG       --------MSPPSATYD-VVAAAA-TSVAKTNKPSTAHGSLTSTSTILDEF---------
THI4_SCLS1       --------MAPPSAVEA-NSPIDGVHLKSAFEV-KAVHAQTASQGKTLAEL---------
THI4_FUSSH       --------MSPPAAVSP-PARSAELASAPAVKLPVGLSKNS-AAATTVEEM---------
THI4_NECH7       --------MSPPAAVSP-TTRSVELA-APAVKLPVGLSKN--NTTATIEEM---------
THI4_FUSOX       --------MAPPAAVSP-PSRSAELA--TSTKLPV-MSKN--INTKTVEEM---------
THI4_SCHPO       --------MAPATAVVTPQTAFKTDLPVEKTAHNTVVKSEMGALSKAYPTY---------
THI4_COPC7       ----------------MAPALTLEKP------------VETNAFPRKAASV------E--
THI4_USTMA       --------MTPPTASFINPATAGPQPGSFKLSKGSLHACSTTAAPKYEQYVPIKTGEE--
THI4_PUCGT       -------MSPPVATESMYKPTTIGTEAHDQALAAMKSNQ---AAPAKPVFKP-----E--
THI4_UROFA       --------MSPVATESMYKPTTINQTAHQQAMDPLKSKQQSNATVNKPAFKP-----E--
THI4_ALNGL       --------MASTLTSKPQRLALFENSASSFYGTPLAPSSIRVQPTKAGAKPSISMSGA--
THI4_CITSI       -----MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISAS--
THI4_ARATH       -----MAAIASTLSLSSTKPQ--RLFDSSFHGSAISAAPISIGLK----PRSFSVRAT--
THI41_VITVI      -----MATLTSSICSKP-KASVFDPHKSSFHGVPIATQARLSPVKSTPVNLAVTAAAM--
THI42_VITVI      --MASMATTLTSLSSNP-KPAFFD-NKSSFHGSPISYRVLPIKVSHQSPTISMSSVS---
THI41_PHYPA      MSISAAGVATGLGANVELKS-NVGSSSSSVAGVRLFTSRKAQLRRCAAPATSASLYSD--
THI43_PHYPA      MSISAAGVATGLGANVELKS-NVGSSSSSVAGVRLFTSRKAQLRRCAAPATSASLYSD--
THI42_PHYPA      --MQAAGLAAGVAFAPKISSSNVGSSSSSLAGVRMVASPKAQLRHARLPAASASMYSD--
THI44_PHYPA      ---------------MSSQAGNVGSSSSSLAGVRMVVSPKAQLRHARLPAASASMYSD--
THI41_SORBI      --------MATTAASSLLKSSFAGSRLPSATRA--PSSVVVSTGGAPRTAAISASIS--S
THI42_MAIZE      --------MATTAASSLLKSSFAGSRLPSATRTTTPSSVAVATPRAGG-GPIRASIS--S
THI42_SORBI      ---------MATTASSLLKSSFAGARLPASTRTP-SSPAVVATPRGAG-AIRASSIS--S
THI41_MAIZE      --------MATAAASSLLKSSFAGSRLPAATRTTPASLVVATGPRGAGAGPICASMSMSS
THI4_CHLRE       -MAIKMNLASSKVGAKASAKSVRGARLVARVAQPMSPSSAATAAADASMLARAGLPPT--
                                                                             

THI4_YEAST       ---KEDWSD-FKFAPIRESTVSRAMTSRYFKDLDKFAVSDVIIVGAGSSGLSAAYVIAKN
THI4_ASHGO       ---EKDWSD-FQFAPIREATVSRAMTTRYFEDLYRYAVSDVVIVGAGSSGLSAAYVLAKN
THI4_CANAL       ---FADWNE-FKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKN
THI4_CANAW       ---FADWNE-FKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKN
THI4_PHANO       ---EHNWEK-FTFAPIRESQVSRAMTRRYFNDLDTYAESDVVIIGAGSCGLSAAYTLASK
THI4_YARLI       ---EHTWES-FKFAPIRESTVSRAMTRRYFEDLDKYAESDVVIIGAGSCGLSAAYVLAKS
THI4_NEUCR       --PTLGTDA-FTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSAAYVLSTL
THI4_ASPOR       ---GGKWDE-FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKA
THI4_EMENI       ---GGKWDN-FKFAPIRESQVSRAMTRRYFQDLDRYAESDVVIVGAGSCGLSTAYVLAKA
THI4_ASPFU       ---GGKWDD-FKFAPIRESQVSRAMTRRYFQDLDKYAESDIVIVGAGSCGLSTAYVLAKA
THI4_AJECG       ---AGKWDD-FSFGHIRESQVSRAMTRRYFEDLDTYAESDIVIVGAGSCGLSTAYVLGKA
THI4_SCLS1       ---AEKWDQGFTFAPIRESQVSRAMTRRYFKDLDTYAESDVVIVGAGSCGLSTAYMLGKA
THI4_FUSSH       ---EGKWDD-FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKK
THI4_NECH7       ---EGKWDD-FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKK
THI4_FUSOX       ---LGQWDD-FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKK
THI4_SCHPO       -----SLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTR
THI4_COPC7       --TSENYEGNYKFAPIEEAQVSRAMIKRYFNTMYDRAISDVVIVGAGSAGLSCAYSLATQ
THI4_USTMA       --PIEDFNGHYRFAEIKESHTSRAMTARYMADMMDAAVSDVVIIGAGSAGLTCAYTLAKQ
THI4_PUCGT       --PAVNLE-PIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGKA
THI4_UROFA       --PAVNLT-PIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTA
THI4_ALNGL       -PSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSK-
THI4_CITSI       -ASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSK-
THI4_ARATH       --TAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISK-
THI41_VITVI      ----PYDLRSFKFEPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSK-
THI42_VITVI      ----PYDLQSFKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSK-
THI41_PHYPA      ---ANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSK-
THI43_PHYPA      ---ANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSK-
THI42_PHYPA      ---AKYDLNNYKFEPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSK-
THI44_PHYPA      ---AKYDLNNYKFEPIKESIVAREMTRRYMTEMITHADTDVVVVGAGSAGLSCAYELSK-
THI41_SORBI      S-NPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSK-
THI42_MAIZE      P-NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSK-
THI42_SORBI      S-NPPYDLTSFRFSPIKESVVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSK-
THI41_MAIZE      S-NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSK-
THI4_CHLRE       ----TTPYDDYKFAPIREAEVNRAMTRRYFKDMDEFAESDVVIVGAGSAGLACAFELGRI
                             *  *.*  . * *  **:  :   * :*::::****.**   : :.  

THI4_YEAST       RPDLKVCIIESSVAPGGGSWLGGQLFSAMVMRKPAHLFLQELEIPYEDEGD---YVVVKH
THI4_ASHGO       RPDLRIAIIEANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEIPYEDEGD---YVVVKH
THI4_CANAL       RPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGD---YVVVKH
THI4_CANAW       RPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGD---YVVVKH
THI4_PHANO       RPDLKIAMVEAGVAPGGGAWLGGQLFSAMVMRKPAELFLNEIGVPYEDEGD---FVVVKH
THI4_YARLI       RPDLKIAIVEAGVAPGGGAWLGGQLFSAMVMRKPAEQFLEEIGVPYEDEGD---YVVVKH
THI4_NEUCR       RPDLRITIVEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGVPYEDEGD---YVVVKH
THI4_ASPOR       RPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDAN-PNYVVVKH
THI4_EMENI       RPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRRPAELFLNELGVPYEEDPDMPNYVVVKH
THI4_ASPFU       RPDLKIAIIEASVSPGGGAWLGGQLFSAMVLRRPAEVFLNEIGVPFEEDPANPNFVVVKH
THI4_AJECG       RPDLKIAVIEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGVPYEEEPSNPNMVVIKH
THI4_SCLS1       RPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLIDLGVPFEDEGD---FVVVKH
THI4_FUSSH       RPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGN---YVVVKH
THI4_NECH7       RPDLRIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGN---YVVVKH
THI4_FUSOX       RPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGN---YVVVKH
THI4_SCHPO       RPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGD---YVVVKH
THI4_COPC7       RPDLKITIVEAGVAPGGGAWLGGQLMTPMVIRKPADAFLRELGVPYEDEGN---FVVVKH
THI4_USTMA       RPDLRITMLEASVAPGGGAWLGGQLMSGMVIRKPAHNLLVEIGVPFDDEGS---YVVVKH
THI4_PUCGT       RPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADKFLDEVGVPYEDEGN---FVVVKH
THI4_UROFA       RPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGN---FVVVKH
THI4_ALNGL       NPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEY-DEQ--DNYVVIKH
THI4_CITSI       NPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDY-DEQ--DNYVVIKH
THI4_ARATH       NPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAY-DEQ--DTYVVVKH
THI41_VITVI      NPSVQVAIIEQSVSPGGGAWLGGQLFSSMVVRKPAHRFLDELGLEY-DEQ--DNYVVIKH
THI42_VITVI      NPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIEY-DEQ--DNYVVIKH
THI41_PHYPA      NPNVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEVPY-EEM--ENYVVIKH
THI43_PHYPA      NPNVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEVPY-EEM--ENYVVIKH
THI42_PHYPA      NPNVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPY-EEL--ENYVVIKH
THI44_PHYPA      NPNVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPY-EEL--ENYVVIKH
THI41_SORBI      DPTVRVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAY-DEAA-DDYVVVKH
THI42_MAIZE      DPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGY-DEA--EDYVVVKH
THI42_SORBI      DPSVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAY-DEA--EDYVVIKH
THI41_MAIZE      DPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAY-DEA--EDYVVIKH
THI4_CHLRE       APHLKVALMEQSVAPGGGAWLGGQLFSAMVVRKPAHEMLDALQVPY-EDE--GHYVVVRH
                  * : : ::* .*:****.******:: *: *:*:. :*  : : : ::      **::*

THI4_YEAST       AALFISTVLSKVLQLPNVKLFNATCVEDLVTRPPTE-------------KGEVTVAGVVT
THI4_ASHGO       AALFTSTVLSKVLQFPNVKLFNATAVEDLVTKPSA--------------NGGVTIAGVVT
THI4_CANAL       AALFMSTLMSKVLQFPNIKLFNATAVEDLITRKDPA-------------TNLQRIAGVVV
THI4_CANAW       AALFMSTLMSKVLQFPNIKLFNATAVEDLITRKDPA-------------TNLQRIAGVVV
THI4_PHANO       AALFTSTLMSKVLNFPNVKLFNATAVEDLITRPAPTSNDPNA----------VRIAGVVT
THI4_YARLI       AALFTSTLMSQVLKFPNVKLFNATAVEDLITRKDAQGN--------------LRIAGVVT
THI4_NEUCR       AALFTSTVLSKVLQRPNVKLFNATTVEDLITRKHHAESSSSSDDGEAEDEAKVRIAGVVT
THI4_ASPOR       ASLFTSTLMSKVLSFPNVKLFNATAVEDLITRPTEN-GNPQ-------------IAGVVV
THI4_EMENI       ASLFTSTLLSKVLSFPNVKLFNATCVEDLVTRPGPN-GNAQE----------VQIAGVVT
THI4_ASPFU       ASLFTSTLMSKVLSFPNVKLFNATAVEDLVTRPSAS-GDAKD----------TQIAGVVV
THI4_AJECG       AALFTSTLLSKVLSFPNIKLFNATCVEDLITRPAPAAGDGEG----------IRIAGVVT
THI4_SCLS1       AALFTSTLLSKVLAFPNIKLFNATSVEDLITRQTAD----GN----------IRIAGVVT
THI4_FUSSH       AALFTSTIMSKVLQLPNCKLFNATCVEDLITRPSKE-----G----------VRISGVVT
THI4_NECH7       AALFTSTIMSKVLQLPNIKLFNATCVEDLITRPSEE-----G----------VRISGVVT
THI4_FUSOX       AALFTSTIMSKVLQMPNIKLFNATCVEDLITRPSEE-----G----------VRIAGVVT
THI4_SCHPO       AALFTSTVMARTLALPNVKLFNATAVEDLIVKEGKD--------------GKQRIAGVVT
THI4_COPC7       AALFTSTLLSKVLAKPNVVMMNATAVEDLIVHED--------------FAGQQRVAGVVT
THI4_USTMA       AALFTSTLMSKLLAMDNVKLFNATCCEDLIIKKDQTG--------------AQRVNGVVT
THI4_PUCGT       AALFTSTVLSKVLAMPNVKMFNATACEDLIIKPCPI------------NPGVQRVAGCVT
THI4_UROFA       AALFTSTVLSKVLAMPNVKMFNATACEDLIIKPCPI------------NPGVQRIAGCVT
THI4_ALNGL       AALFTSTIMSKLLARPNVKLFNAVAAEDLIVK-------------------GGRVGGVVT
THI4_CITSI       AALFTSTIMSKLLARPNVKLFNAVAAEDLIVK-------------------GGRVGGVVT
THI4_ARATH       AALFTSTIMSKLLARPNVKLFNAVAAEDLIVK-------------------GNRVGGVVT
THI41_VITVI      AALFTSTIMSKLLARPNVKLFNAVAAEDLIIK-------------------EGKVGGVVT
THI42_VITVI      AALFTSTIMSKLLARPNVKLFNAVAAEDLIVK-------------------EERVAGVVT
THI41_PHYPA      AALFTSTIMSKLLARPNVKLFNAVAAEDLIIR-------------------GDRVSGVVT
THI43_PHYPA      AALFTSTIMSKLLARPNVKLFNAVAAEDLIIR-------------------GDRVSGVVT
THI42_PHYPA      AALFTSTIMSKLLARPNVKLFNAVAAEDLIIR-------------------GDRVSGVVT
THI44_PHYPA      AALFTSTIMSKLLARPNVKLFNAVAAEDLIIR-------------------GDRVSGVVT
THI41_SORBI      AALFTSTVMSAVLARPNVKLFNAVAVEDLIVK-------------------GGRVGGVVT
THI42_MAIZE      AALFTSTVMSRLLARPNVKLFNAVAVEDLIVR-------------------RGRVGGVVT
THI42_SORBI      AALFTSTVMSRLLARPNVKLFNAVAVEDLIVK-------------------GGRVGGVVT
THI41_MAIZE      AALFTSTVMSLLLARPNVKLFNAVAVEDLIVR-------------------GGRVGGVVT
THI4_CHLRE       AALLTSTLMSHVLKNPNVKLFNATAVEDLIVKPDPA-----------LGPGGRRVAGVVT
                 *:*: **:::  *   *  ::**.  ***: :                      : * *.

THI4_YEAST       NWTLVTQAHGTQCCMDPNVIELAGYKNDGTRDLSQKHGVILSTTGHDGPFGAFCAKRIVD
THI4_ASHGO       NWTLVTMAHDVQSCMDPNVIELEGYKDDGTRDPKKKHGVVLSTTGHDGPFGAFCAKRLAA
THI4_CANAL       NWA--QLDHDTQSCMDPNTI---------------NCNVVLSTSGHDGPFGAFTAKRLEQ
THI4_CANAW       NWA--QLDHDTQSCMDPNTI---------------NCNVVLSTSGHDGPFGAFTAKRLEQ
THI4_PHANO       NWTLVSMHHDDQSCMDPNTI---------------NAPLIISTTGHDGPFGAFSVKRLVS
THI4_YARLI       NWTLVSMHHDDQSCMDPNTI---------------NAPIIISTTGHDGPFGAFSVKRLVS
THI4_NEUCR       NWTLVSMHHDDQSCMDPNTI---------------NAPVIISTTGHDGPFGAFSVKRLVS
THI4_ASPOR       NWTLVTLHHDDHSCMDPNTI---------------NAPVIISTTGHDGPFGAFCAKRLVS
THI4_EMENI       NWTLVTLHHDDHSCMDPNTI---------------NAPVIISTTGHDGPFGAFSAKRLVS
THI4_ASPFU       NWTLVTLHHDDHSCMDPNTI---------------NAPVVISTTGHDGPFGAFCAKRLVS
THI4_AJECG       NWTLVTLHHDDHSCMDPNTI---------------NAPLVISTTGHDGPFGAFCAKRLVS
THI4_SCLS1       NWTLVTMHHDDQSCMDPNTI---------------NAPIVISTTGHDGPFGAFCVKRLVS
THI4_FUSSH       NWTLVSMHHDDQSCMDPNTI---------------NAPLVISTTGHDAPMGAFCVKRLVS
THI4_NECH7       NWTLVSMHHDDQSCMDPNTI---------------NAPLVISTTGHDGPMGAFSVKRLVS
THI4_FUSOX       NWTLVSMHHDDQSCMDPNTI---------------NAPLIISTTGHDGPMGAFCVKRLVS
THI4_SCHPO       NWTLVSLNHGLQSCMDPNTI---------------NAHLVVSATGHDGPFGAFCVKRLAS
THI4_COPC7       NWTLVALNHDTQSCMDPNTI---------------TAPVIVSATGHDGPMGAFSAKRLVS
THI4_USTMA       NWTLVTMAHGLQSCMDPQTI---------------TAPVVIGACGHDGPFGAFSVKRLSS
THI4_PUCGT       NWTLVSLNHDHQSCMDPSTI---------------TAPLVCSFAGHDGPFGAFCVKRIAS
THI4_UROFA       NWTLVSLNHDHQSCMDPSTI---------------TAPLVCSFAGHDGPFGAFCVKRVAS
THI4_ALNGL       NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKSLRS
THI4_CITSI       NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLKS
THI4_ARATH       NWALVAQNHHTQSCMDPNVM---------------EAKIVVSSCGHDGPFGATGVKRLKS
THI41_VITVI      NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLRS
THI42_VITVI      NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLKS
THI41_PHYPA      NWALVAQNHNTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLRS
THI43_PHYPA      NWALVAQNHNTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLRS
THI42_PHYPA      NWALVAQNHNTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLRS
THI44_PHYPA      NWALVAQNHNTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLRS
THI41_SORBI      NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLQD
THI42_MAIZE      NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLQD
THI42_SORBI      NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLQD
THI41_MAIZE      NWALVSMNHDTQSCMDPNVM---------------EAKVVVSSCGHDGPFGATGVKRLQD
THI4_CHLRE       NWSLVAQAHGTQSCMDPNVI---------------EAGVVVSACGHDGPFGATGVKRLAR
                 **:     *  :.****..:                  :: .  ***.*:**  .* :  

THI4_YEAST       ID--------------------------QNQKLGGMKGLDMNHAEHDVVIH---SGAYAG
THI4_ASHGO       LD--------------------------AQHAIKGMQSLDMNTAEAGVVKE---SGATAG
THI4_CANAL       LGRAPRDVTAGFTKPSITTSKLQEPEPISNFQLGGMKGLDMNKAEDAIVK-----GTREV
THI4_CANAW       LGRAPRDVTAGFTKPSITTSKLQEPEPISNFQLGGMKGLDMNKAEDAIVK-----GTREV
THI4_PHANO       MQ--------------------------QLPQLGGMRGLDMRTAEDAIVK-----RTREV
THI4_YARLI       MN--------------------------AIEKLGGMRGLDMGLAEDAIVK-----RTREI
THI4_NEUCR       MK--------------------------QMERLNGMRGLDMQSAEDAIVN-----NTREI
THI4_ASPOR       MG--------------------------SVDKLGGMRGLDMNSAEDAIVK-----NTREV
THI4_EMENI       MT--------------------------TIDKLGGMRGLDMNSAEDAIVK-----NTREV
THI4_ASPFU       MN--------------------------TVDKLGGMRGLDMNSAEDAIVK-----NTREV
THI4_AJECG       MA--------------------------AIEKLGGMRGLDMNSAEEAIVK-----NTREV
THI4_SCLS1       MN--------------------------QIKELGGMRGLDMNVAEDAIVK-----KTREI
THI4_FUSSH       MG--------------------------RIEKLGGMRGLDMNVAEDAIVK-----GTREI
THI4_NECH7       MQ--------------------------RIEKLGGMRGLDMNVAEDAIVK-----GTREI
THI4_FUSOX       MQ--------------------------RIEKLGGMRGLDMNLAEDAIVK-----GTREI
THI4_SCHPO       AQ--------------------------LVSNLHDMRPLDMNRAEDLIVK-----GTREV
THI4_COPC7       TG--------------------------LLKELGNMRGLDMNRAEP-----AIVNGTREV
THI4_USTMA       AG---------------------------LIKLGDMRPMDMNKSEGLIVN-----NTREV
THI4_PUCGT       AG--------------------------LSEGLGDMRPLDMERAED-----HIANKTREI
THI4_UROFA       AG--------------------------LSEGLGDMRPLDMERAED-----HIANKTREI
THI4_ALNGL       IGMI--------------------------DTVPGMKALDMNVAEDAIVR-----LTREI
THI4_CITSI       IGMI--------------------------EEVPGMKALDMNSAEDAIVR-----LTREV
THI4_ARATH       IGMI--------------------------DHVPGMKALDMNTAEDAIVR-----LTREV
THI41_VITVI      VGMI--------------------------DSVPGMKALDMNTAEDEIVR-----LTREV
THI42_VITVI      IGMI--------------------------DSVPGMKALDMNTAEDAIVR-----LTREI
THI41_PHYPA      IGMI--------------------------ESVPGMKCLDMNAAEDAIVK-----HTREV
THI43_PHYPA      IGMI--------------------------ESVPGMKCLDMNAAEDAIVK-----HTREV
THI42_PHYPA      IGMI--------------------------ESVPGMKCLDMNAAEDAIVK-----HTREV
THI44_PHYPA      IGMI--------------------------ESVPGMKCLDMNAAEDAIVK-----HTREV
THI41_SORBI      IGMI--------------------------AAVPGMKALDMNAAEDAIVR-----LTREV
THI42_MAIZE      IGMI--------------------------SAVPGMKALDMNAAEDEIVR-----LTREV
THI42_SORBI      IGMI--------------------------SDVPGMKALDMNTAEDEIVR-----LTREV
THI41_MAIZE      IGMI--------------------------SAVPGMKALDMNTAEDEIVR-----LTREV
THI4_CHLRE       LGMVP------------------------GGEVPGMGALDMEAAEGSIVN-----NTREV
                                                 : .*  :**  :*           :   

THI4_YEAST       VDNMYFAGMEVAELDGLNRMGPTFGAMALSGVHAAEQILKHFAA----------------
THI4_ASHGO       VEYMYFAGMETATKKGVSRMGPTFGAMAVSGIKAAEEILRHFAE----------------
THI4_CANAL       VPGLVIAGMELAEVDGSNRMGPTFGAMALSGVKAAESVLNVLELRKQQNEACYGAYKG--
THI4_CANAW       VPGLVIAGMELAEVDGSNRMRPTFGAMALSGVKAAESVLNVLELRKQQNEACYGAYKG--
THI4_PHANO       VPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEAIGVWDERKAQNDE---------
THI4_YARLI       VPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAETVLEVFDTRKKQNQE---------
THI4_NEUCR       VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVFDLRKAQNDKC--------
THI4_ASPOR       TKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALKVFDERQRECAE---------
THI4_EMENI       AKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALRVFDDRKRECAE---------
THI4_ASPFU       AKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALKVFDQRQRECAE---------
THI4_AJECG       TKGLIIGGMELSEIDGWHRMGPIFSAMMLSGVRAAEVALEVFEERKRECADKK-------
THI4_SCLS1       VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDERKAQNAY---------
THI4_FUSSH       VPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALKVIDIRQKQNSF---------
THI4_NECH7       VPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKIFDIRKKQNAF---------
THI4_FUSOX       VPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKIFDTRKKQNDL---------
THI4_SCHPO       FPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVNEKYL-------
THI4_COPC7       VPGLILTGMELSEHDGSNRMGPTFGAMIGSGHKAAHEAIRILDRHKVVNGKVVA------
THI4_USTMA       FPGLIVSGMELSEHDGHPRMGASFGGMIGSGQKAAYEAIKLYDSLEIDDGEVVGLKH---
THI4_PUCGT       VPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLGRVKVEEGEVVGSAK---
THI4_UROFA       LPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLDRVKIEEGEVVGLAK---
THI4_ALNGL       VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVG----GI
THI4_CITSI       VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVG----GV
THI4_ARATH       VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVG----NL
THI41_VITVI      VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYIG----NL
THI42_VITVI      VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTE--AETM
THI41_PHYPA      VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKP----NV
THI43_PHYPA      VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNEVDGNYKP----NV
THI42_PHYPA      VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKP----NV
THI44_PHYPA      VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKL----NV
THI41_SORBI      VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVS-PAL
THI42_MAIZE      VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVS-PAL
THI42_SORBI      VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIKVVS-PAL
THI41_MAIZE      VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTM---S-PPL
THI4_CHLRE       VPGMVLTGMELAEVDGSPRMGPTFGAMIVSGMRAAHMAVAALER----------------
                    : . *** :  .*  ** . *..*  ** :*.   :                     

THI4_YEAST       ------------------
THI4_ASHGO       ------------------
THI4_CANAL       ------------------
THI4_CANAW       ------------------
THI4_PHANO       ------------------
THI4_YARLI       ------------------
THI4_NEUCR       ------------------
THI4_ASPOR       ------------------
THI4_EMENI       ------------------
THI4_ASPFU       ------------------
THI4_AJECG       ------------------
THI4_SCLS1       ------------------
THI4_FUSSH       ------------------
THI4_NECH7       ------------------
THI4_FUSOX       ------------------
THI4_SCHPO       ------------------
THI4_COPC7       ------------------
THI4_USTMA       ------------------
THI4_PUCGT       ------------------
THI4_UROFA       ------------------
THI4_ALNGL       HPELILAAA-DSAEIADA
THI4_CITSI       HPELILAAA-DSAETADA
THI4_ARATH       SPELVLAAA-DSAETVDA
THI41_VITVI      HPELVLAAAADAAEIAEA
THI42_VITVI      QPELILAAA-ETGEIVDA
THI41_PHYPA      HPELVLASTDDETASA--
THI43_PHYPA      HPELVLASTDDMTASA--
THI42_PHYPA      HPELVLASTDDETASA--
THI44_PHYPA      HPELVLASTDDETASA--
THI41_SORBI      REEFVIASKDDEVVDA--
THI42_MAIZE      REEFVIASKDDEVVDA--
THI42_SORBI      RQEFVIASKDDEVVDA--
THI41_MAIZE      REELMIAYKDDEVVDA--
THI4_CHLRE       RRALSAAAAEGAAAEAQA