CLUSTAL format seed alignment for MF_03163

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SPB1_YEAST            ---MGK-TQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAA
SPB1_CANAL            ---MGK-QQKKHSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAA
SPB1_YARLI            ---MGK-IQKKHGKGRLDHYYRLAKEKGYRARSSFKIIQINQKYGKFLEKSKVVIDLCAA
SPB1_EMENI            ----MA-IQKKHGKGRLDKWYRLAKEKGYRARAAFKLVQLNKKYG-FLEKSKVLLDLCAA
SPB1_ASPFU            ----MA-IQKKHGKGRLDKWYRLAKEKGYRARAAFKLIQLNKKYG-FLEKSKVLLDLCAA
A0A0E1RUQ7_COCIM      ----MA-IQKKHGKGRLDKWYKLAKEKGYRARAAFKLIQLNKKYG-FLEKSKVLLDLCAA
Q0UCU2_PHANO          ----MA-IQKKHGKGRLDKWYKLAKEKGYRARAAFKLIQLNKKYN-FLEKSKVLIDLCAA
I1RTE9_GIBZE          ----MA-VTKEKAKGRLDKWYRLAKEKGYRARAAFKLIQLNKKYG-FLEKSRVLIDLCAA
C7YTG2_NECH7          ----MA-IQKKHGKGRLDKWYKLAKEKGYRARAAFKLVQLNKKYG-FLEKSKVLLDLCAA
SPB1_NEUCR            ----MA-IQKKHGKGRLDKWYKLAKEKGYRARAAFKLIQLNKKYG-FLEKSKVALDLCAA
SPB1_SCHPO            ---MGK-SQKKTAKGRLDKWYKLAKEQGYRSRAAFKLVQLNQKYS-FLEKAKVIIDLCAA
SPB1_CRYNJ            ---MGK-HDKKTGKGRLDKFYRLAKEQGYRARSAFKLVHLNRKYD-LLSKARCCIDLCAA
A8N1R5_COPC7          ---MGK-GQKKTGKGRLDKYYKLAKEQGYRARSAFKLIQLNKKYG-FLESARCTIDLCAA
SPB1_USTMA            ---MGKKQEKKTAKGRLDKFYWLAKEQGYRSRAAFKLVQLNKKFN-FLEKARCCIDLCAA
E3KB01_PUCGT          ---MGK-REKKTGKGRLDKYYRLAKEQGYRARSAFKLIQLNKRYQ-FLESARCCIDLCAA
SPB1_DICDI            ----MGQKKKKLAKGRLDKFYYMAKEQGYRSRAAFKLIQLNKKYN-FLGTAKACLDLCAA
F0ZY00_DICPU          ----MGQKKKKLAKGRLDKFYYLAKEQGYRSRAAFKLVQLNKKYN-FLGSAKACLDLCAA
Q0DFV9_ORYSJ          ----MGKTK---GKQRQDKFYHLAKEQGYRSRAAFKLLQLDARFR-FLPTARAVLDLCAA
I1PY11_ORYGL          ----MGKTK---GKQRQDKFYHLAKEQGYRSRAAFKLLQLDARFR-FLPTARAVLDLCAA
C5YVX0_SORBI          ----MGKAK---GKQRQDKFYHLAKEQGYRSRAAFKLLQLDARFR-FLPTARSVLDLCAA
I1HGA5_BRADI          ----MGKAK---GKQRQDKFYHLAKEQGYRSRAAFKLLQLDARYR-FLPTARAVLDLCAA
I1LJC4_SOYBN          ----MGKAK---GKHRLDKYYHLAKEHGYRSRASWKLVQLNNKFH-FLESARAVLDLCAA
I1LQ27_SOYBN          ----MGKAK---GKHRLDKYYHLAKEHGYRSRASWKLVQLNSKFG-FLESARAVLDLCAA
F6I0L2_VITVI          ----MGKVK---GKHRLDKFYHLAKEHGYRSRAAWKLVQLDSKYN-FLRSSRAVLDLCAA
B9HRL4_POPTR          ----MGKVK---GKHRLDKFYKLAKEHGYRSRASWKLIQLDTKFK-FLQSSRAVLDLCAA
F4JTD2_ARATH          ----MGKVK---GKHRLDKYYRLAKERGFRSRASYKLLQLDAKYS-LLHSAHAVLDLCAA
A9RQI9_PHYPA          ----MGKSKT-TGKGRLDRFYYLAKEQGFRSRASFKLVQLDRKFQ-FLSSARSVLDLCAA
H3GC19_PHYRM          --------MVKRKKHDKDKYYNLARQQGYRARSAFKLIQLNKKYD-FLSTAKVCIDLCAA
D0MRD5_PHYIT          --------MVKRKKHDKDKYYNLARQQGYRARSAFKLIQLNKKYD-FLSTAKVCIDLCAA
A0EER5_PARTE          -----MPRK-TKARSRLDKYYNLAKDQGYRSRAAFKLFQLNRKYN-FLNNARTVVDLCAA
Q23MN4_TETTS          -----MPRKEKKGKTRKDVHYYMAKEYGYRSRACFKLIQINKKYG-FLEKANAVIDLCAA
SPB1_HUMAN            -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
H2QDN5_PANTR          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
G3QV89_GORGO          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
SPB1_PONAB            -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
G1QW13_NOMLE          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
F7DBK9_MACMU          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
F7HIR2_CALJA          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
H0XRX1_OTOGA          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
I3NA29_ICTTR          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
G1PIT9_MYOLU          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
F6SYP9_HORSE          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
F1RSJ8_PIG            -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
E2RHC4_CANLF          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
G1SLJ8_RABIT          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
SPB1_MOUSE            -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
SPB1_RAT              -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
H0VJ21_CAVPO          -----MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
F1MY97_BOVIN          -----MGKKSKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
F6UUX8_MONDO          -----MGKKGKVGKSRRDKFYHLAKETGFRSRSAFKLIQLNRRFQ-FLQKARALLDLCAA
G3WIR8_SARHA          -----MGKKGKVGKSRRDKFYHLAKETGFRSRSAFKLIHLNRPFQ-FLQKARALLDLCAA
SPB1_CHICK            -----MGKKSKVGKSRRDKFYHLAKETGFRSRSAFKLLQLNRKFQ-FLQKARALLDLCAA
H3DDM8_TETNG          -----MGKKLKVGKTRRDKFYHLAKETGYRSRSSFKLIQLNRKFQ-FLQKARALVDLCAA
H2V6Z5_TAKRU          -----MGKKLKVGKTRRDKFYHLAKETGYRSRSSFKLIQLNRKFQ-FLQKARALVDLCAA
I3IZN4_ORENI          -----MGKKLKVGKTRKDKFYHLAKETGYRSRSSFKLIQLNRKFQ-FLQKARALVDLCAA
A0A0R4IQB8_DANRE      -----MGKKLKVGKTRKDKFYHLAKETGYRSRSSFKLIQLNRKFQ-FLQKARALVDLCAA
H2XWZ3_CIOIN          -----MGKKKQVAKARKDKYYHLAKETGYRARSAFKLLQLNKKFN-FLQSSQACVDLCAA
Q7QD87_ANOGA          -----MGKKAKVGKDRRDKFYKLAKESGYRSRAAFKLIQLNRRFG-FLQQSQVCLDLCAA
W5J3R9_ANODA          -----MGKKGKVGKDRKDKFYKLAKESGYRSRAAFKLIQLNRRFA-FLQQSQVCIDLCAA
Q17ME6_AEDAE          -----MGKKGKVGKDRKDKFYKLAKETGYRSRAAFKLIQLNRRFG-FLQQSQVCIDLCAA
Q9VXK5_DROME          -----MGKKTKVGKTRKDKFYQLAKETGLRSRAAFKLIQLNRKFG-FLQQSQVCLDLCAA
A0A088A7G6_APIME      -----MGKKGKIGKQRKDKFYQLAKETGYRSRAAFKLIQLNRKFE-FLQKSRVCIDLCAA
A0A158NJW7_ATTCE      -----MGKKSKIGKQRKDKYYQLAKETGYRSRAAFKLIQLNRKFE-FLQKSRVCIDLCAA
E0VIT4_PEDHC          -----MVQKKKIGKQRKDRYYKLAKETGFRSRAAFKLLQLNRKFG-FLESSKVLIDLCAA
E9G6A2_DAPPU          -----MGKK---GKARQDKFYHLAKETGYRSRAAFKLLQLNRKFE-FLEKSRVVIDLCAA
B7P3V3_IXOSC          -----MGKKTKIGKQRKDKFYHLAKETGYRSRAAFKLIQLNRKFE-FLQKSRVLIDLCAA
A0A1X7UGH0_AMPQE      -----MGKKAKIGKKRKDKFYHLAKETGYRARSAFKLIQLNRKFQ-FLQKSRVLIDLCAA
G4VQU5_SCHMA          -----MGKKIKTGKARKDKFYFLAKETGFRSRAAFKLIQLNRRFK-FLNSSKVLIDLCAA
Q9N5N9_CAEEL          -----MGKKVKIGKQRRDKYYKLAKEAGYRSRAAFKLVQLNKRFE-FLEKSRATVDLCAA
A8Y2C8_CAEBR          -----MGKKVKIGKQRRDKYYKLAKEAGYRSRAAFKLVQLNKRFE-FLEKSRATVDLCAA
A0A2H2IUP1_CAEJA      -----MGKKVKIGKQRRDKYYKLAKEAGYRSRAAFKLVQLNKRFE-FLQKSRATVDLCAA
C4M6R5_ENTHI          -----MGKEGKAGKERLDKYYHLAKQYGYRARSAFKLVQMNKRYD-FLSSAHILIDLCAA
E9ADH8_LEIMA          ----MGVKSKKKAKTRLDAYYRLAKDQGYRARSAYKLIQLNRKYD-FLAKSRVLVDLCAA
A4I305_LEIIN          ----MGVKSKKKAKTRLDAYYRLAKDQGYRARSAYKLIQLNRKYD-FLAKSRVLVDLCAA
A4HFX5_LEIBR          ----MGVKSKKKAKTRLDAYYRLAKDQGYRARSAYKLIQLNRKYD-FLAKSRVLVDLCAA
Q586Q7_TRYB2          ----MGTKSKKKAKTRLDAYYRLAKDQGFRARSAFKLVQLNRKYD-FLSKCRVLVDLCAA
K2MLU3_TRYCR          ----MGTKSKKKAKTRLDAYYRLAKDQGFRARSAFKLIQLNRKYD-FLAKSRVLVDLCAA
Q4U8L6_THEAN          -----MKTKSKTGKNRLDKYYHLAKEHGYRSRSAFKIIQLSKKFN-IFQNCNVLVDLCAA
Q4N1B5_THEPA          -----MKTKTKTGKNRLDKYYHLAKEHGYRSRSAFKIIQLAKKFN-IFQNCNVLVDLCAA
B3L783_PLAKH          -----MGKKKKVGKERIDKYYKLAKSAGYRARSAFKLIQIAQKYN-IFKDANILIDLCAA
A5K2F1_PLAVS          -----MGKKKKVGKERIDKYYKLAKSAGYRARSAFKLIQIAQKYN-IFKDANILIDLCAA
Q4Z2U4_PLABA          -----MGKKKKVGKERIDKYYKLAKSAGYRARSAFKLIQIARKYN-IFKNANILIDLCAA
Q8IDF8_PLAF7          -----MGKKKKVGKERIDKYYKLAKTAGYRARSAFKLIQIAQKFN-VFKNANILIDLCAA
B9QL21_TOXGV          MAGGDSHRKKKTGKQRLDKFYHLAKEQGYRARSAFKLLQLSQRFRLFEKSCASVVDLCAA
                                   :   *  * :*:  * *:*:.:*:.::   :  .   .   :*****

SPB1_YEAST            PGSWCQVASKLCPVNSLIIGVDIVPMKPMP-NVITFQSDITTEDCRSKLRGYMKTW---K
SPB1_CANAL            PGSWCQVASQLCPINSLIIGVDIVPIKPLP-NVITFQSDITTEDCRSRLRGHMKTW---K
SPB1_YARLI            PGSWCQVASQLCPVNSLIIGCDIVPIKPLP-NVITFQSDITTDHCRQQLRQYMKTW---K
SPB1_EMENI            PGSWCQVAAECMPAQSLIVGVDLAPIKPIP-RVITFQQDITTEKCRATIRSHLKHW---K
SPB1_ASPFU            PGSWCQVAAECMPTQSIIIGVDLAPIKPIP-RVITFQSDITTEKCRATIRQHLKHW---K
A0A0E1RUQ7_COCIM      PGSWCQVAAECMPTESLIVGVDLAPIKPIP-RVITFQSDITTDKCRATIRQHLKTW---K
Q0UCU2_PHANO          PGSWCQVASEVMPAQSLIVGVDLAPIKPIP-RCITFQSDITTDKCRATLRQHLKHF---K
I1RTE9_GIBZE          PGSWLQVAAEVMPQGSLIVGCDLSPIKPIP-RVTSFQSDITSEDCRATLKRLLLSH---K
C7YTG2_NECH7          PGSWCQVAAEVMPPNSLIVGVDLAPIKPIP-RVITFQSDITTEKCRATIRQHFKTW---K
SPB1_NEUCR            PGSWCQVCAETMPTNSIIIGVDLAPIKPIP-KVITFQSDITTEKCRATIRSHLKTW---K
SPB1_SCHPO            PGGWLQVASKTCKPGSLIVGVDLAPIKPIP-NCHTFVEDITSDKCRSQLRGYLKTW---K
SPB1_CRYNJ            PGGWLQVAEKYMPKGSLIIGVDLNAIKPLP-HVTTFVADITTPHCRQTLRQHMHDW---K
A8N1R5_COPC7          PGGWLQVASKYMPPNSLIIGVDLVPIKPIP-RVITFASDITTTQCRNYLRGEMKDW---K
SPB1_USTMA            PGGWLQVASKFMPANSLIVGVDLVPIKPIP-RTITFAEDINSYKCRDQLRQILKDW---K
E3KB01_PUCGT          PGGWLQVAAKWMPANSLILGVDLVPIKPIP-KVVTATEDIRTQSCRMWLRSELKDW---K
SPB1_DICDI            PGGWMQVASKYMPVQSLIVGVDLVPIRQVR-NCIGLTEDITTQKCRTEIKKALKTW---K
F0ZY00_DICPU          PGGWMQVASKYMPVQSLIVGVDLVPIRQVR-NCISLAEDITTQKCRTEIKKALKTW---K
Q0DFV9_ORYSJ          PGGWVQVAVNHAPVGAFVVGVDLVPIRPIR-GAHSLTEDITTTKCRAAVRRLMDSNGVAA
I1PY11_ORYGL          PGGWVQVAVNHAPVGAFVVGVDLVPIRPIR-GAHSLTEDITTTKCRAAVRRLMDSNGVAA
C5YVX0_SORBI          PGGWVQVAVNHAPVGAFVVGVDLVPIRPIR-GAHSLTEDITTTKCRAAVRRLMDSNGVSA
I1HGA5_BRADI          PGGWVQVAVNHAPVGAFVVGVDLVPIRPIR-GAHSLTEDITTTKCRSSIRKLMDSKGVGA
I1LJC4_SOYBN          PGGWMQVAVKSMPVNHLVIGVDLSPIAPVR-GAIAIQEDITRPECKSRIKKLMNDHGCRA
I1LQ27_SOYBN          PGGWMQVVVQRVPVDHLVIGVDLAPIAPVR-GAIAIQEDITRPECKSRIKKLMNDHGCRA
F6I0L2_VITVI          PGGWMQAAVERVPVGSFILGVDLNPIAPVR-GAISIEEDITKPACKARVKKLMSEYGCAA
B9HRL4_POPTR          PGGWMQVAVQRVPVRSLVLGIDLVKIAPLR-GAVSIEQDITKPECRAKIKKIMGEHGVRA
F4JTD2_ARATH          PGGWMQVAVEKVPVGSLVLGIDLVPILPVR-GCVTMTQDITRTECKSKIKQVMEQHGVSA
A9RQI9_PHYPA          PGGWMQVCSKNMPVGSLIIGIDLVPIRPIR-GCVTLQEDITTPQCRAAIKKVLKEKKHDM
H3GC19_PHYRM          PGGWCQVAAKYMPASSIILGIDLLPIRPIR-GVKTFQCDITTVRCRQIIKQEMQSW---Q
D0MRD5_PHYIT          PGGWCQVAAKYMPASSIILGIDLLPIRPIR-GVKTFQCDITTVRCRQIIKQEMQSW---Q
A0EER5_PARTE          PGGWMQVCAQIMPTSSIIIGLDLVHIKPIP-GCKAFTQDITTPQCVQLLKKEIPQ----K
Q23MN4_TETTS          PGGWLQVAAKFCPVTCTKIGLDLVPIKPIP-GVKTYVQDITAPVTYQLLKRELKGG---K
SPB1_HUMAN            PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQQDITTERCRQALRKELKTW---K
H2QDN5_PANTR          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
G3QV89_GORGO          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
SPB1_PONAB            PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
G1QW13_NOMLE          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
F7DBK9_MACMU          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
F7HIR2_CALJA          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
H0XRX1_OTOGA          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
I3NA29_ICTTR          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
G1PIT9_MYOLU          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
F6SYP9_HORSE          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
F1RSJ8_PIG            PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
E2RHC4_CANLF          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
G1SLJ8_RABIT          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
SPB1_MOUSE            PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
SPB1_RAT              PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
H0VJ21_CAVPO          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
F1MY97_BOVIN          PGGWLQVAAKFMPVSSLIVGVDLVPIKPLP-NVVTLQEDITTERCRQALRKELKTW---K
F6UUX8_MONDO          PGGWLQVASKFMPVSSLIVGVDLVPIKPIP-NVVTLQEDITTEKCRQALRKELKTW---K
G3WIR8_SARHA          PGGWLQVASKFMPVSSLIVGVDLVPIKPIP-NVVTLQEDITTDRCRQALKKELKTW---K
SPB1_CHICK            PGGWLQVASKFMPVSSLVIGVDLVPIKPIP-NVVTLQEDITTEKCRQALRKELQTW---K
H3DDM8_TETNG          PGGWLQVASKFMPVSSLIIGVDLVPIKPIP-NVVTLQEDITTEKCRQALRKELQTW---K
H2V6Z5_TAKRU          PGGWLQVASKFMPVSSLIIGVDLVPIKPIP-NVVALQEDITTEKCRQALRKELQTW---K
I3IZN4_ORENI          PGGWLQVASKFMPVSSLIIGVDLVPIKPIP-NVVTLQEDITTEKCRQALRKELQTW---K
A0A0R4IQB8_DANRE      PGGWLQVASKFMPVSSLVIGVDLVPIKPIP-NVVTLQEDITTEKCRQALRKELQTW---K
H2XWZ3_CIOIN          PGGWLQVASEHMPMSSIIVGVDLVPIRPVP-KCVTFQDDITKESCRTQLRRELHKW---K
Q7QD87_ANOGA          PGGWMQVAKQNMPVSSIVIGVDLYPIKNVP-GCISLIGDITSDKTKADLAKELKTW---K
W5J3R9_ANODA          PGGWMQVAKQNMPVSSIVIGVDLYPIKNVP-GCISLVGDITSDKTKSDLAKELKTW---K
Q17ME6_AEDAE          PGGWMQVAKQNMPVSSVVIGIDLFPIKNVP-GCISLVGDITSDKTKSDLAKELKTW---K
Q9VXK5_DROME          PGGWMQVAKQNMPVSSIVIGVDLFPIRPIA-GCIGLVEDITTEKCRQSLTKELQSW---K
A0A088A7G6_APIME      PGGWMQVARQNMPVSSIVIGVDLFPIKPIP-GCISLIEDITTDKCRVSITRELKTW---K
A0A158NJW7_ATTCE      PGGWMQVARQNMSISSIVIGVDLFPIKPIP-GCLSLVEDITTDKCRVAISRELKTW---K
E0VIT4_PEDHC          PGGWMQVAKQNMPVSSVIVGVDLFPIKPIP-GCISLVEDITTSKCKSSLTKALQTW---K
E9G6A2_DAPPU          PGSWMQVAKQHMPVSSLIIGIDLFPMKPIQ-GCLTLQEDITTEKCYQSLKKELTTW---K
B7P3V3_IXOSC          PGGWLQVAQKYMPVSSVIVGVDLVPIRAIP-NVITIQDDITTGSCRFKLKKELKTW---K
A0A1X7UGH0_AMPQE      PGGWLQVASQHMPVSSLIIGVDLVSIKPIP-NAITIQADITTPNCRHLIQKELKTW---K
G4VQU5_SCHMA          PGGWLQVAAKEMPMTSHIIGVDLVPIHPIP-KVKTFVADITTDKCKQILRSELNDL---K
Q9N5N9_CAEEL          PGGWMQVASQFMPVSSLIVGVDLAPIKPIK-NCIALQGDITTNETRAAIKKELKTW---S
A8Y2C8_CAEBR          PGGWMQVASQFMPVSSLIVGVDLAPIKPIK-NCIALQGDITTNETRAAIKKELKTW---S
A0A2H2IUP1_CAEJA      PGGWMQVASQMMPISSLIVGVDLAPIKPIK-NCIALQGDITTNETRAAIKKELKTW---S
C4M6R5_ENTHI          PGGWCQVATKEMPVESKIFGVDLEPILPIP-RCTTYVGDITTGMCFAEMKKLMKGE---H
E9ADH8_LEIMA          PGGWCQVAAQHMAIGSKIVGVDLVPIAPIR-GVKTFVGDITDDKTRKMIVTYLKKE---P
A4I305_LEIIN          PGGWCQVAAQHMAIGSKIVGVDLVPIAPIR-GVKTFVGDITDDKTRKMIVTYLKKE---P
A4HFX5_LEIBR          PGGWCQVAAQHMPIGSKIVGVDLVPIAPIR-GVKTFVGDIVDDKTRKMIVTYLKKE---P
Q586Q7_TRYB2          PGSWCQVAAKHMPVGSKIVGVDLVPIAPIR-GVKTFVGDITEEKTKKIIMTYLKRE---P
K2MLU3_TRYCR          PGGWCQVAAKHMPVGSKIVGVDLVPIAPIR-GVKTFVGDITDDKTRKMIVTYLKKE---P
Q4U8L6_THEAN          PGGWLQVASNQLPVSSTIIGVDLVPIKPIK-GVTTFQADIRTPKCLSLITNHLNGM---N
Q4N1B5_THEPA          PGGWLQVASNQLPVSSTIIGVDLVPIKPIK-GVITFQADIRTPKCHSLITNQLNGL---S
B3L783_PLAKH          PGGWLQVAYKNMKRSSTIIGVDLVPIRKIDNNVITLKCDITTSACVKQIKNIIKNE---K
A5K2F1_PLAVS          PGGWLQVAYKNMKRSSTIIGVDLVPIRKIDNNVITLKCDITTGACIKQIKNIIKNE---K
Q4Z2U4_PLABA          PGGWLQVAYKNMNKNSTIIGVDLVPIRKIDNNVITIKSDITSAECIKKIKDIIQYE---K
Q8IDF8_PLAF7          PGGWLQVAYKNMSKQSTIIGVDLVPIRKIDDNVITIKSDITTSDCIKKIKNIIKMD---K
B9QL21_TOXGV          PGGWLQVAAKHCPVATTIVGVDLVPISPIR-GVQTFTGDITTPQCAAKLRKLVKFG---E
                      **.* *.  :        .* *:  :  :         **        :   .       

SPB1_YEAST            ADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWV
SPB1_CANAL            ADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLTAGGTFVTKIFRSRDYNNLMWV
SPB1_YARLI            ADTVMHDGAPNVGMAWAQDAFTQSELVLQSLKLAVEFLNKGGTFVTKVFRSKDYNNLMWV
SPB1_EMENI            ADTVLHDGAPNVGTAWVQDAFSQAELVLESLKLATEFLVEGGTFVTKVFRSKDYNPLLWV
SPB1_ASPFU            ADTVLHDGAPNVGTAWVQDAFSQAELVLQSMKLATEFLVEGGTFVTKVFRSKDYNPLLWV
A0A0E1RUQ7_COCIM      ADTVLHDGAPNVGTAWVQDAFSQAELALQSLKLATEFLVAGGTFVTKVFRSKDYNSLLWV
Q0UCU2_PHANO          ADTVLHDGAPNVGTAWVQDAFTQAELVLQSMKLATEFLVEGGTFVTKVFRSKDYNSLLWV
I1RTE9_GIBZE          ACTVIHDGAPNVGTAWTQDAFDQNALVLQSLKLATEFMKPDGTFVTKVFRSKDYNSLLWV
C7YTG2_NECH7          ADTVLHDGAPNVGTAWAQDSFNQAELALQAMKLATEFLIEGGTFVTKVFRSKDYNPLLWV
SPB1_NEUCR            ADVVLHDGAPNVGTAWVQDSYNQAELALHSLKLATEFLIEGGTFVTKVFRSKDYNSLLWV
SPB1_SCHPO            ADVVLHDGAPNVGSAWLQDAYGQAQLVLMSMKLACEFLVAGGTFVTKVFRSRDYNNLLWV
SPB1_CRYNJ            ADLVLHDGAPNVGSAWVQDAFTQNELVLQSLKLATEFLAKGGSFVTKVFRSQDYNSLLWV
A8N1R5_COPC7          ADVVLHDGAPNVGTAWVQDAYSQSELVLMSLKLAVEFLAKGGTFVTKVFRSVDYNSLIWV
SPB1_USTMA            ADIVIHDGAPNVGTAWVQDAYAQSELTLQSLRLAVEFLTAGGTFVTKVFRSKDYNNLLWV
E3KB01_PUCGT          ADVVLHDGAPNVGTAWVQDAFSQSELVLHSLKLATEMLAQNGTFITKVFRSKDYNSLLYI
SPB1_DICDI            VDVCLHDGAPNMGTSWVQDAYQQAELTLHALKLATEFLTTGGWFVTKVFRGSDYNSLIWV
F0ZY00_DICPU          VDVCLHDGAPNMGTSWVQDAYQQAELTLHALKLATEFLATGGWFVTKVFRGADYNSLIWV
Q0DFV9_ORYSJ          FDVVLHDGSPNVGGAWAQEATAQSSLVIDAVRLATMFLAPKGAFITKVFRSQDYNAIMYC
I1PY11_ORYGL          FDVVLHDGSPNVGGAWAQEATAQSSLVIDAVRLATMFLAPKGAFITKVFRSQDYNAIMYC
C5YVX0_SORBI          FDVVLHDGSPNVGGAWAQEATSQSALVIDALRLATMFLAPKGAFITKVFRSQDYNAIMYC
I1HGA5_BRADI          FDVVLHDGSPNVGGAWAQEATTQSALVIDSVRLATMFLAPKGTFVTKVFRSQDYNAIMFC
I1LJC4_SOYBN          FDVILHDGSPNVGGAWAQEATSQNALVIDAVKLATQFLAPKGIFVTKIFRSQDYSSVVYC
I1LQ27_SOYBN          FDVILHDGSPNVGGAWAQEAMSQNALVIDAVKLATQFLAPKGKFVTKIFRSQDYSSVVYC
F6I0L2_VITVI          FDIVLHDGSPNIGGAWTQEATAQNALVIDALRLATQFLAPKGAFVTKVFRSQDYNSVLYC
B9HRL4_POPTR          FDLVLHDGSPNIGGAWSQEAMAQNSLVIDSVRLATQFLAPKGTFVTKVFRSQDYSSVIYC
F4JTD2_ARATH          FNLVLHDGSPNVGGAWAQEAMSQNALVIDSVRLATEFLARNGNLVTKVFRSRDYNSVLYC
A9RQI9_PHYPA          VQVVLHDGSPNVGGAWSSESSAQTALVLDSLKLATDVLCPGGTFVTKIFRSQDYNALLFA
H3GC19_PHYRM          ADVVLCDGAPNVGAEYSKDAYVQNELALVALKLAVDVMGRGGTFVSKVFRSQDYNALLWV
D0MRD5_PHYIT          ADVVLCDGAPNVGTEYSKDAYVQNELALIALKLAVDVMGRGGTFVSKVFRSQDYNALLWV
A0EER5_PARTE          ADVFLHDGAPNVGASWAKDAYNQNDLVLSALRLASQFLKKGGVFVTKVFRSTDYNSLMWV
Q23MN4_TETTS          ADVVLNDGAPNVGANWQKDAFNQIELTLAALKLAVNFLRRGGTFVTKVFRSKDYNALIWV
SPB1_HUMAN            VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWI
H2QDN5_PANTR          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWI
G3QV89_GORGO          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWI
SPB1_PONAB            VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWI
G1QW13_NOMLE          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
F7DBK9_MACMU          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
F7HIR2_CALJA          VDVVLNDGAPNIGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
H0XRX1_OTOGA          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
I3NA29_ICTTR          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
G1PIT9_MYOLU          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
F6SYP9_HORSE          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
F1RSJ8_PIG            VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLGRGGCFITKVFRSRDYQPLLWI
E2RHC4_CANLF          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
G1SLJ8_RABIT          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGYFITKVFRSRDYQPLLWI
SPB1_MOUSE            VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
SPB1_RAT              VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
H0VJ21_CAVPO          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
F1MY97_BOVIN          VDVVLNDGAPNVGASWAHDAYSQAHLTLMALRLACDFLGRGGCFITKVFRSRDYQPLLWI
F6UUX8_MONDO          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWI
G3WIR8_SARHA          VDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQALLWI
SPB1_CHICK            VDVVLNDGAPNVGASWVHDAYSQANLTLMALKLACEFLCKGGWFITKVFRSRDYQPLLWI
H3DDM8_TETNG          VDVVLNDGAPNVGANWQHDAFSQAHLTLMALKLACEFLTKGGTFVTKVFRSKDYQPLIWI
H2V6Z5_TAKRU          VDVVLNDGAPNVGANWQHDAFSQAHLTLMALKLACEFLTKGGTFVTKVFRSKDYQPLLWI
I3IZN4_ORENI          VDVVLNDGAPNVGANWQHDAFSQAHLTLMALKLACEFLTKGGTFVTKVFRSKDYQPLLWI
A0A0R4IQB8_DANRE      VDVVLNDGAPNVGANWQHDAFSQANLTLMALKLACEFLAKGGTFITKVFRSKDYQPLMWI
H2XWZ3_CIOIN          VDCFLHDGAPNVGKNWLHDAYSQSVLTLAALKLASEFLCKGGWFITKVFRSKDYQALMWI
Q7QD87_ANOGA          VDVVLNDGAPNVGKNWLHDAYQQVCLTLSAVKLATQFLRPGGWFITKVFRSKDYNALIWV
W5J3R9_ANODA          ADVVLNDGAPNVGKNWLHDAYQQVCLTLSAVKLATQFLRPGGWFITKVFRSKDYNALIWV
Q17ME6_AEDAE          ADVVLNDGAPNVGRNWLFDAYQQVCLTLSAVKLATQFLRPGGWFVTKVFRSKDYNALIWV
Q9VXK5_DROME          ADVVLHDGAPNVGRNWLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWV
A0A088A7G6_APIME      ADVVLHDGAPNVGKNWLHDAYQQIVLTLSALKMATHFLRSGGWFITKVFRSKDYHPLIWV
A0A158NJW7_ATTCE      ADVVLNDGAPNVGKSWLHDAYQQAVLTLSALKLATQFLKAGGWFITKVFRSKDYNPLIWV
E0VIT4_PEDHC          ADVVLHDGAPNVGTNWIHDAYQQVCLTLSALKLGTEFLREGGWFITKVFRSSDYNSLLWV
E9G6A2_DAPPU          ADVVLHDGAPNVGQNWIYDAFIQNQLVLSALKLATEFLVKGGWFVTKIFRSKDYNSLMWV
B7P3V3_IXOSC          ADIVLNDGAPNVGKSWVHDAYGQNVLTLHAVKLATEFLTKGGWFITKVFRSKDYQALMWV
A0A1X7UGH0_AMPQE      VDCVLNDGAPNVGSAWIQDAFSQARLTLSALKLATDFLKPGGWFVTKVFRSKDYQQLLNV
G4VQU5_SCHMA          ADVVLHDGAPNVGAAWSIDEYTQAVLSLNSFAIATEFLRRGGWFVTKVFRSRDYEPLKWV
Q9N5N9_CAEEL          ADCVLHDGAPNVGLNWVHDAFQQNCLTLSALKLATQILRKGGTFVTKVFRSNDYSCLIRV
A8Y2C8_CAEBR          ADCVLHDGAPNVGLNWVHDAFQQNCLTLSALKLATQILRKGGTFVTKVFRSNDYSCLIRV
A0A2H2IUP1_CAEJA      ADCVLHDGAPNVGLNWVHDAFQQNCLTLSALKLATQILRKGGTFVTKVFRSNDYSCLIRV
C4M6R5_ENTHI          ADVVLHDGSPNMGKSWIQDAYTQSELCIAALKFAVTFLKKGGWFISKVFRSQDYYAILFV
E9ADH8_LEIMA          VDCVIHDGAPNVGGVWSRDLFDQNALVLASAKMACSMLKANGWFVTKVFRSPDFHNLLWV
A4I305_LEIIN          VDCVIHDGAPNVGGVWSRDLFDQNALVLASAKMACSMLKANGWFVTKVFRSPDFHNLLWV
A4HFX5_LEIBR          VDCVIHDGAPNVGGVWSRDLFDQNALVLASAKMACSMLKASGWFVTKVFRSPDFHNLLWV
Q586Q7_TRYB2          VDCVIHDGAPNVGGVWSRDLFEQNSLVLHAAKLASKLLRPGGWFVTKVFRSQDFHKLMWV
K2MLU3_TRYCR          VDCVIHDGAPNVGGVWSRDLFEQNALVLHAAKMAASMLKPSGWFVTKVFRSQDFHKLMWV
Q4U8L6_THEAN          VDVVLHDGSPNMGCNWNLDAFNQNVLVLTACKMACSLLRKGGIFVTKVFRSSDYNSLVWM
Q4N1B5_THEPA          VDVVLHDGSPNMGCNWNLDAFNQNVLVLTAAKLACSLLRKGGIFVTKVFRSSDYNSLVWM
B3L783_PLAKH          ADVILNDGAPNVGTTYSYDSFNQNVLVLNSIKIANLFLKKKGIFITKVFRNEEYVSLIWV
A5K2F1_PLAVS          ADVILNDGAPNVGTTYSYDSFNQNVLVLNSIKIANLFLKKRGIFITKVFRNEEYVSLIWV
Q4Z2U4_PLABA          ADVILNDGAPNVGTTYSYDSFNQNILVLSSIKLAYKFLTKGGIFITKVFRNEEYVSLIWV
Q8IDF8_PLAF7          ADVILNDGAPNVGTTYSYDSFNQNVLVLNSIKIAYIFLKKNGIFITKVFRNEEYISLIWV
B9QL21_TOXGV          VDLVLHDGSPNMGTDWSVDAFSQNVLVLCAAKLACQLLAAGATFVSKVFRSADYAALLYV
                          : **:**:*  :  :   *  * : :  :.   :   . :::*:**. ::  :   

SPB1_YEAST            FQQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRLLDPKEVFEELPDG-------
SPB1_CANAL            FQQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDPKEVFEELGGGNES----
SPB1_YARLI            FQQFFEKVEATKPPSSRNVSAEIFVVCLKFKAPKKIDPRLLDAKYVFEEVSQG-------
SPB1_EMENI            FKQLFMSVEATKPPSSRNVSAEIFVVCRGYKAPKRIDPKFLDSKHVFAELADP-------
SPB1_ASPFU            FKQLFTSVEATKPPSSRNVSAEIFVVCRGFKAPKRIDPKFLDPKHVFAELTDS-------
A0A0E1RUQ7_COCIM      FKQLFTSVEATKPPSSRNVSAEIFVVCRGFKAPKRMDPKFLDPRHVFAELQDP-------
Q0UCU2_PHANO          FNQLFTKVEATKPPSSRNVSAEIFVVCRGYKAPKNLDPKFLDARSVFAELAEP-------
I1RTE9_GIBZE          FKQLFNKVEATKPSSSRNVSSEIFVVCRGYKAPKKMDPRFLDPTYVFAELAGP-------
C7YTG2_NECH7          LNQLFTKVEATKPPSSRNVSAEIFVVCRGYKAPKKIDPRFLDPRAVFAELTGA-------
SPB1_NEUCR            CNQLFAKVEATKPPSSRNVSAEIFVVCRGFKAPKRIDPKLLDPRSVFEDVAGP-------
SPB1_SCHPO            FKQLFNKVEATKPPSSRNVSAEIFVVCRGYKAPKKLDPRFTDPRTVFEEVQEP-------
SPB1_CRYNJ            FGQLFKSVEATKPPSSRNVSAEIFVVCRDFIAPKHIDPKFLDPKHVFKDIASLPTSITEP
A8N1R5_COPC7          FSQLFSKVEATKPPSSRNVSAEIFVVCRDFLAPKFIDPKFLDPKHVFKDLSSLISADKGP
SPB1_USTMA            FNQLFKKVEATKPSSSRNVSAEIFVVCQGYKNPARIDPKFLDPRHVFKELDPASLADQDQ
E3KB01_PUCGT          FNQLFKKVEATKPPSSRNVSAEIFVVCQGYLAPKKIDPRLLDPAHVFKDVDLTKKPTDDQ
SPB1_DICDI            FNKLFKKVESTKPPSSRNASAEIFVVCQGFLNPKRIDPKLLDPKFVFKE-IQE-V-----
F0ZY00_DICPU          FNKLFRKVESTKPQASRNASAEIFVVCQGFLNPKKIDPKLLDPKFVFKE-VQEGP-----
Q0DFV9_ORYSJ          LKQLFEKVEVTKPTASRSTSAEIYIICLRYKAPAKIQPELLDIKHLFSVDPDPK------
I1PY11_ORYGL          LKQLFEKVEVTKPTASRSTSAEIYIICLRYKAPAKIQPELLDIKHLFSVDPDPK------
C5YVX0_SORBI          LKQFFEKVEATKPSASRSTSAEIYIICQKYKAPAKIQPELLDIKHLFSVVPEQT------
I1HGA5_BRADI          LKQLFEKVEATKPTASRSTSAEIYIICQKYKAPAKIQPELLDIKHLFSVDEEKS------
I1LJC4_SOYBN          LKQLFEKVEVDKPAASRSESAEIYVLGLKYKAPAKIDPRLLDVKHLFQGSVEPQP-----
I1LQ27_SOYBN          LKQLFEKVEVDKPAASRSESAEIYVLGLGYKAPAKIDPRLLDVKHLFQGSVEPQP-----
F6I0L2_VITVI          LKQLFEKVEVDKPAASRSTSAEIFVLGLKYKAPAKIDPRLLDVKHLFQGTIEPR------
B9HRL4_POPTR          LNQLFEKVEVDKPAASRSASAEIFVLGLRYKAPAKIDPRLLDIKHLFQGSDEPQR-----
F4JTD2_ARATH          LGRLFEKVEVFKPPASRSASAETYLVGLKYLAPAKIDPRLLDYRHLFKESAEPTR-----
A9RQI9_PHYPA          FKQLFEKVEVTKPIASRATSAEIYVICQKYRAPAKIDPRLLDAKHLFKETIEAP------
H3GC19_PHYRM          FKQLFKKVSATKPLSSRNESAEIFVVCEQFLAPHSIDPKLFDPKYVFDQVDAQE------
D0MRD5_PHYIT          FKQLFKKVSATKPLSSRNESAEIFVVCEQFLAPHSIDPKLFDPKYVFDQVDSQE------
A0EER5_PARTE          FNKFFSKVEATKPLASRFVSAEIFVVCLDYLAPEYIDEKLFDSKHVFKDTETDMLQ----
Q23MN4_TETTS          CNKFFRKIEANKPKASRFTSAEIFIVCTDFIDPDFIDDKLFDAKYIFKDTEDDYYT----
SPB1_HUMAN            FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
H2QDN5_PANTR          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
G3QV89_GORGO          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
SPB1_PONAB            FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
G1QW13_NOMLE          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
F7DBK9_MACMU          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
F7HIR2_CALJA          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPVKVDSKFFDPKFAFKEVEVQAK-----
H0XRX1_OTOGA          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEDQAK-----
I3NA29_ICTTR          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
G1PIT9_MYOLU          FQQLFRHVQATKPQASRHESAEIFVVCQGYLAPDKVDSKFFDPKFAFKEVEVQAK-----
F6SYP9_HORSE          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQTK-----
F1RSJ8_PIG            FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEIQAK-----
E2RHC4_CANLF          FQQLFHRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEIEVQAK-----
G1SLJ8_RABIT          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
SPB1_MOUSE            FQQLFHRVQATKPQASRHESAEIFVVCQGFLAPDKVDAKFFDPKFAFKEVEVQAK-----
SPB1_RAT              FQQLFHRVQATKPQASRHESAEIFVVCQGFLAPDKVDAKFFDPKFAFKEVEVQAK-----
H0VJ21_CAVPO          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
F1MY97_BOVIN          FQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK-----
F6UUX8_MONDO          FQQLFRHVQATKPQASRQESAEIFVICQGFLAPDKIDSKFFDPKFAFKEVEVQAK-----
G3WIR8_SARHA          FQQLFRHVQATKPQASRQESAEIFVVCQGFLAPDKIDSKFFDPKFAFKEVEVQAK-----
SPB1_CHICK            FQQFFHKVQATKPQASRNESAEIFVVCQGYQAPDKIDSKFFDPKYAFKEVEVHAK-----
H3DDM8_TETNG          FQQFFNKVQSTKPQASRNESAEIFVVCQGFLAPDKIDSKFFDPKHAFKEVDVQAK-----
H2V6Z5_TAKRU          FQQFFNKVQSTKPQASRNESAEIFVVCQGFLAPDKIDSKFFDPKHAFKEVEVQAK-----
I3IZN4_ORENI          FQQFFKKVQATKPQASRNESAEIFVICQGFVAPDKIDSKFFDPKYAFKEVEVQAK-----
A0A0R4IQB8_DANRE      FQQFFKKVQATKPQASRNESAEIFVVCQGFLAPDKIDNKFFDPKHAFKEVDVQVK-----
H2XWZ3_CIOIN          FGQLFNKVHATKPQASRNVSAEIFVVCQGFKSPDKIDKKFFDPKSVFQEVEAKTR-----
Q7QD87_ANOGA          LKQLFRKVHATKPSASRKESAEIFVVCQYYKAPDKIDPRFLDSKYVFEELDIQSKDI---
W5J3R9_ANODA          LKQLFKKVHATKPSASRKESAEIFVVCQHYRAPDKIDPRFLDSKYVFEELDIEPKDG---
Q17ME6_AEDAE          LKQLFKKVHATKPSASRNESAEIFVVCQHYRAPDKIDPRFLDAKYVFEELDVEPQ-----
Q9VXK5_DROME          LKQLFKKVHATKPSASRKESAEIFVVCQGYLAPDHIDPRLLDSKYVFEELDLDAK-----
A0A088A7G6_APIME      LKQLFKKVHATKPQASRTESAEIFVVCQYYIAPDKLDPKFLDPKYVFSELEIEPT-----
A0A158NJW7_ATTCE      LKQLFKKVHATKPQASRSESAEIFVVCQYYIAPDKLDPKFFDPKHVFSELQIETI-----
E0VIT4_PEDHC          FKQLFKKVQATKPQASRSESAEIFVACKHFFAPDKIDPKFFQPQYVFKELDLKSP-----
E9G6A2_DAPPU          LRQLFKRVHSTKPHASRMESAEIFVICQGYRAPDKLDPKFLDPKHVFQEVENISN-----
B7P3V3_IXOSC          LKKLFRKISATKPQASRHESAEIFVVCQYYIAPDKIDSKFLDPAYVFGDVDTGEA-----
A0A1X7UGH0_AMPQE      FQKLFKKVHATKPQASRSESAEIFVVCQEYLVKGKPDEKLLDPKFVFEEQEPLEK-----
G4VQU5_SCHMA          LSQFFRTVRAIKPEASRLESAEIFLVGQNYIAPARIDPKFLDARHVFGEVDAPKD-----
Q9N5N9_CAEEL          FEKLFKRVHVWKPAASRLESAEIFVVCEVYQKPDKVGAEYLDPKKVFANPDGSEG-----
A8Y2C8_CAEBR          FEKLFKRVHVWKPAASRLESAEIFVVCEVYQKPEKVGAEYLDPKKVFANPDGSEG-----
A0A2H2IUP1_CAEJA      FEKLFKRVHVWKPAASRLESAEIFVVCEVYQKPDKVGAEFLDPKKVFANPDGSEG-----
C4M6R5_ENTHI          FEKFFKSVIATKPPASRNTSAEVYLVCKDFLAPSKYDPNLLDPKFVFAKEE---------
E9ADH8_LEIMA          FKQLFEKVEATKPQASRMESAEIFVVCAGFKAPKNIDPAFFNPQKVFAEVGQEK------
A4I305_LEIIN          FKQLFEKVEATKPQASRMESAEIFVVCAGFKAPKSIDPAFFNPQKVFAEVGQEK------
A4HFX5_LEIBR          FKQLFDKVEATKPQASRMESAEIFVVCAGFKAPKNIDPAFFNPQKVFAEVGEEK------
Q586Q7_TRYB2          MKQLFDKVEATKPLASRMESAEIFVTCAGYKAPKQLDPAMFNPQKVFSDVEEEK------
K2MLU3_TRYCR          LKQLFEKVEATKPLASRMESAEIFVVCAGFKAPKQLDPSMFNAQKVFSDVGEEK------
Q4U8L6_THEAN          LSNCFDKVKVTKPQSSRNVSAEIFAVCIGFKTLKLIDQRLFNPDYVFQNSDVPIEQNELS
Q4N1B5_THEPA          LGNCFERVKVTKPQSSRNVSAEIFAVCIGFKSLKLIDPRLFNADFVFQSS----------
B3L783_PLAKH          MEKLFGQVKHIKPRSSREISSEIYLVGLNFLS-TKVDKKLFDYNYVFSEQFKQDSN----
A5K2F1_PLAVS          MEKLFGQVKHIKPRSSREISSEIYLIGLNFLS-AKVDKKLFDYTYVFSEQFKQDSN----
Q4Z2U4_PLABA          LEKLFGEVKHIKPRSSREISSEIYLIGLNFLG-NKIDKKYFDFTYIFSNQFRKDENKLSN
Q8IDF8_PLAF7          LEKLFGDVKHIKPRSSREISSEIYLVGLNFLG-KKVDKKLFDYTYIFSDQFKKNSNKSSL
B9QL21_TOXGV          LQTLFERVDATKPQASRAVSAEIFVVCRGFRKPPVLDERLFDPKHVFLQGSDDGDAPAAA
                          *  :   ** :**  *:* :     :           :    *             

SPB1_YEAST            ------------------------Q-----------------QNMESKIYNPEKK--VRK
SPB1_CANAL            ------------------------K-----------------QNNEAKIFNPEKFSSQRQ
SPB1_YARLI            ------------------------N-----------------NNNEAKVFNPEVK--RRK
SPB1_EMENI            ------------------------T-----------------PNNEAKVFNPEKK--KRK
SPB1_ASPFU            ------------------------T-----------------PNNEARVFNPEKK--KRK
A0A0E1RUQ7_COCIM      ------------------------T-----------------PNNEAKVFNPEKK--KRK
Q0UCU2_PHANO          ------------------------A-----------------PNNEAKVFNPEKK--KRK
I1RTE9_GIBZE          ------------------------T-----------------PNNEAKVYNPEVK--KRK
C7YTG2_NECH7          ------------------------T-----------------PNNEAKVYNPEVK--KRK
SPB1_NEUCR            ------------------------A-----------------PNNEAKVYNPEVK--KRK
SPB1_SCHPO            ------------------------V-----------------TNVDAKVFHPEKR--KRS
SPB1_CRYNJ            TDTSIAPTSSSTASAAAAAARLAAN-----------------SHAHSNVYAPEKK--RRH
A8N1R5_COPC7          -----------------------TV-----------------NDTQSNVFHPEKK--RRH
SPB1_USTMA            ------------EAGVPLSLKGTSA-----------------GNAHANVFEPKKI--RRN
E3KB01_PUCGT          -----------------AEASSSKL-----------------TPNAQNVFKPEKK--RRT
SPB1_DICDI            --------------------------------------------KKVDVLSEKK---KVN
F0ZY00_DICPU          --------------------------------------------KKVDVLSEKKA--KRN
Q0DFV9_ORYSJ          --------------------------------------------KVRDPLKPDRQ--KRN
I1PY11_ORYGL          --------------------------------------------KVRDPLKPDRQ--KRN
C5YVX0_SORBI          --------------------------------------------KSRDVMD-GRK--KRH
I1HGA5_BRADI          --------------------------------------------VPRDITNPGKK--KRE
I1LJC4_SOYBN          --------------------------------------------KVVDVLRDSKQ--KRH
I1LQ27_SOYBN          --------------------------------------------KVVDVLRDTKQ--KRH
F6I0L2_VITVI          --------------------------------------------KVVDVLRGTKQ--KRH
B9HRL4_POPTR          --------------------------------------------KVVDVLRGTKQ--KRH
F4JTD2_ARATH          --------------------------------------------KVVDVLGGSKQ--KRN
A9RQI9_PHYPA          --------------------------------------------KVIDVMKASKQ--KRH
H3GC19_PHYRM          --------------------------------------------KTITIFHPKFGDRKRH
D0MRD5_PHYIT          --------------------------------------------KTITIFHPKFGDRKRH
A0EER5_PARTE          ------------------------Q-----------------QIQKEIVS-----RTQRH
Q23MN4_TETTS          ------------------------Q-----------------QVEHEVNSIDKIMAKRRK
SPB1_HUMAN            ----------------------------------------------TVTELVT--KKKPK
H2QDN5_PANTR          ----------------------------------------------TVTELVT--KKKPK
G3QV89_GORGO          ----------------------------------------------TVTELVT--KKKPK
SPB1_PONAB            ----------------------------------------------TVTELVT--KKKPK
G1QW13_NOMLE          ----------------------------------------------TVTELVT--KKKPK
F7DBK9_MACMU          ----------------------------------------------TVTELVT--KKKPK
F7HIR2_CALJA          ----------------------------------------------TVTELVT--KKKPK
H0XRX1_OTOGA          ----------------------------------------------TVTELVT--KKKPK
I3NA29_ICTTR          ----------------------------------------------TVTELVS--KKKPK
G1PIT9_MYOLU          ----------------------------------------------TVTELVT--KKKPK
F6SYP9_HORSE          ----------------------------------------------TVTELVT--KKKPK
F1RSJ8_PIG            ----------------------------------------------TVTELVT--KKKPK
E2RHC4_CANLF          ----------------------------------------------TVTELVT--KKKPK
G1SLJ8_RABIT          ----------------------------------------------TVTELVT--KKKPK
SPB1_MOUSE            ----------------------------------------------TVTELVT--KKKPK
SPB1_RAT              ----------------------------------------------TVTELVT--KKKPK
H0VJ21_CAVPO          ----------------------------------------------TVTELVT--KKKPK
F1MY97_BOVIN          ----------------------------------------------TVTELVT--KKKPK
F6UUX8_MONDO          ----------------------------------------------TVTELVT--KKKPK
G3WIR8_SARHA          ----------------------------------------------TVSELVT--KKKPK
SPB1_CHICK            ----------------------------------------------SVSELVS--KKKPK
H3DDM8_TETNG          ----------------------------------------------TVRELIP--VKKPK
H2V6Z5_TAKRU          ----------------------------------------------TVRELIP--VKKPK
I3IZN4_ORENI          ----------------------------------------------TVKELIP--VKKPK
A0A0R4IQB8_DANRE      ----------------------------------------------TVKELVN--KKKPK
H2XWZ3_CIOIN          ----------------------------------------------PVNILDFEPKKKKK
Q7QD87_ANOGA          ------------------------------------------SSNNILKELERKTPKKPK
W5J3R9_ANODA          ------------------------------------------AGLNILKELERKVAKKPK
Q17ME6_AEDAE          ------------------------------------------VKVNLLKEVEKAK--KPK
Q9VXK5_DROME          -------------------------------------------KKSSLLHPEKQK--RIK
A0A088A7G6_APIME      ---------------------------------------------NKLNIFNPTK-KKDK
A0A158NJW7_ATTCE      ---------------------------------------------NKLNVLYPEKQKKAK
E0VIT4_PEDHC          ---------------------------------------------ATLNIFNPRKQKKAK
E9G6A2_DAPPU          ----------------------------------------------TVMGLQAHEKSKPK
B7P3V3_IXOSC          ---------------------------------------------AKLNAAHPEK-QKAK
A0A1X7UGH0_AMPQE      ---------------------------------------------PKITLQNIQKHTKSS
G4VQU5_SCHMA          --------------------------------------------RAALISSFLKESRKKK
Q9N5N9_CAEEL          -------------------------------------------TKPNPQNLLIGKQKKAK
A8Y2C8_CAEBR          -------------------------------------------TKPNPQNMLIGKQKKAK
A0A2H2IUP1_CAEJA      -------------------------------------------TKPNPQNLLIGKQKKTK
C4M6R5_ENTHI          ----------------------------------------------ETQVPDLFSTKRPK
E9ADH8_LEIMA          ----------------------------------------------IVSASGMLVTPKSN
A4I305_LEIIN          ----------------------------------------------IVSASGMLVAPKSN
A4HFX5_LEIBR          ----------------------------------------------IVSASGLLVTPKSD
Q586Q7_TRYB2          ----------------------------------------------ILTPSGALVVPRSN
K2MLU3_TRYCR          ----------------------------------------------ILTPSGALVVPKSN
Q4U8L6_THEAN          QSNKLL--SNTPKSLSNTPKTLTHT-----------------SKTPNHVSKTLNQLLKEQ
Q4N1B5_THEPA          ---------NTPLSIEDD-----KS-----------------AKTKNQAPKTLNQLLKEQ
B3L783_PLAKH          ---KIVTNDASDNDLFTDSSDNEKE-------------NQKKNKKKKGLSTILKEKKKKN
A5K2F1_PLAVS          ---KAVTNDASEDDIFSNSSDNEKE-------------DKKKSKKKKGLSTILKEKKKKN
Q4Z2U4_PLABA          IHSKNETEEDSENDISGNDTDNNT--------------SKHKTKKKKGLNTILKEKKKKN
Q8IDF8_PLAF7          LETKQESYLDNNENYFSDEESNDEEK----------VGEKIDKKKKKGLSTILKEKKKKN
B9QL21_TOXGV          QKAVRRSGGDDGAAQRLAEGDEADDGEAAKEEEEDEEREGIFFGSRGGRKGQFAELVRRR
                                                                                  

SPB1_YEAST            RQGYEEG-DNLLYHETSILDFVRTE--DPISMLGEMNKFTIDE-----------------
SPB1_CANAL            RQGYQEG-DYTLFHTMPIMDFIKQD--DPINQLGSLNKFDLPAPKDDDNDDDD-------
SPB1_YARLI            REGYEEG-EYLQHKRLSILDFITDS--TPIDNLGETNEMTWTPRSIKEGEVDEEEEKEKD
SPB1_EMENI            REGYEEG-DWTQFKEIPVTEFINTT--DPIAILGSCNKLSFQQQPG--------------
SPB1_ASPFU            REGYEEG-DYTQFKEIPVTEFINTT--DPIAILGTYNKLSFEQSPG--------------
A0A0E1RUQ7_COCIM      REGYEEG-DYTQHKEIPVTEFINTT--DPIAILGTYNTLSFHQSPS--------------
Q0UCU2_PHANO          RGGYEEG-DWTQFHEVPVSEFIQTT--DPIAMLGSLNKLSFEQPPN--------------
I1RTE9_GIBZE          RDGYDEE-NFLQFKEMPASEFIQTT--DPIAVLGSYNKLSFQQPRN--------------
C7YTG2_NECH7          RDGYEDG-DYTQFKEMPASEFIQTT--DPIAVLGSYNKLTFQQPLN--------------
SPB1_NEUCR            REGYEEG-DYTQFKEISASEFINTV--DPIAILGQYNKLSFEQPKN--------------
SPB1_SCHPO            REGYADD-DYTLHKTVLASEFVTAN--DPIQILGTSAEIVFPK-----------------
SPB1_CRYNJ            REGYAEG-DYTLHHTASAEEFVRGQ--DPVLLLGNMNKIEFR------------------
A8N1R5_COPC7          RDGYNDG-DYTLYHSIPVTKFIHSP--EPIAILGTYNKITFD------------------
SPB1_USTMA            REGYADG-DYTLFHSLDAMDFIKGQ--DVIGMLGSYNQISFE------------------
E3KB01_PUCGT          REGYDEG-DYTLHKSSTASALINAK--DPVSILGVANCIKFDN-----------------
SPB1_DICDI            RAGYEDG-VTVLYKKGFISDFVNSN--EHLQDLANFNAFEFDE-----------------
F0ZY00_DICPU          RSGYEDG-VTMLRKKGFISDFIESS--QHLLDLASFTEYEFDE-----------------
Q0DFV9_ORYSJ          RDGYEEG-NTTLRKVGLASDFIWSEGQTPLEFLGSFNAISFDDP----------------
I1PY11_ORYGL          RDGYEEG-NTTLRKVGLASDFIWSEGQTPLEFLGSFNAISFDDP----------------
C5YVX0_SORBI          RDGYEEG-NTTLRKVGLASDFVWSDAQAPLEFLGSYNAISFDNP----------------
I1HGA5_BRADI          RSGYGEG-ETVLGKAGLASDFIWSEAQTPIEFLGSFGAISFEDP----------------
I1LJC4_SOYBN          RDGYEDG-DTTLRKLSSAANFIWSN--SPLEILGSVTSITFTDP----------------
I1LQ27_SOYBN          RDGYEDG-NTTLRKVSSAANFIWSN--SPLEILGSVTSITFTDP----------------
F6I0L2_VITVI          RDGYEDG-DTTLRKVSSATNFIWSD--TPLEILGSVTSISFDDP----------------
B9HRL4_POPTR          RDGYEDG-ESIVRKVSSAADFIWSD--SPLEILGSVTSIAFDDE----------------
F4JTD2_ARATH          RDGYEDG-ESILRRVASAADFIWSE--NPLDVLGTTTSISFDDQ----------------
A9RQI9_PHYPA          REGYEEG-TTVLRKEVKASDFVWSE--KPLDMLGSITSMSFKDP----------------
H3GC19_PHYRM          REGYDEALGVMLTNECSVSQFIDEH--DPIRLLTDTTSIKFMPE----------------
D0MRD5_PHYIT          REGYDEALGVTLTNECSVTQFIDAH--DPIRLLTDTTRVKFLPE----------------
A0EER5_PARTE          RSGYADDVHQTVYQMIDFEEFLHAE--NPYPIFIEYAGIKMTEE----------------
Q23MN4_TETTS          RVGYGDDVKQTVFQPITFEEFVNID--NPFAVFLTHNSISFPKD----------------
SPB1_HUMAN            AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMVD------------------
H2QDN5_PANTR          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMVD------------------
G3QV89_GORGO          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMVD------------------
SPB1_PONAB            AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMVD------------------
G1QW13_NOMLE          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMVD------------------
F7DBK9_MACMU          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMVD------------------
F7HIR2_CALJA          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIMID------------------
H0XRX1_OTOGA          AEGYA-EGDLTLYHRTSITDFLRAA--NPVDFLSKSSEILLD------------------
I3NA29_ICTTR          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISIN------------------
G1PIT9_MYOLU          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISLD------------------
F6SYP9_HORSE          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISLD------------------
F1RSJ8_PIG            AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEIAID------------------
E2RHC4_CANLF          AEGYA-EGDLTLYHRASVTDFLRAA--NPVDFLSKASEISLD------------------
G1SLJ8_RABIT          AEGYA-EGDLTLYHRASVTDFLRAA--NPVDFLSKASEISLD------------------
SPB1_MOUSE            AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISID------------------
SPB1_RAT              AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISID------------------
H0VJ21_CAVPO          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISID------------------
F1MY97_BOVIN          AEGYA-EGDLTLYHRTSVTDFLRAA--NPVDFLSKASEISLD------------------
F6UUX8_MONDO          AEGYA-EGDLTLYHRVSITDFLRAA--NPVDFLSKASEIMLD------------------
G3WIR8_SARHA          AEGYA-DGDLTLYHRVSITDFLRAA--NPVDFLSKASEIILD------------------
SPB1_CHICK            AEGYA-DGDTTLYHRFTLMDFLKAP--NPVDFLSKANEITLG------------------
H3DDM8_TETNG          AEGYT-DGDLTLFHSFPVTAFLKAE--NPVDFLAKASEIILD------------------
H2V6Z5_TAKRU          AEGYT-DGDLTLFHSFPITAFLKAE--NPVDFLAKASEIIFD------------------
I3IZN4_ORENI          AEGYT-DGDLTLYHSFTVTDFLKAE--NPVDFLGKASEITFN------------------
A0A0R4IQB8_DANRE      AEGYS-DGDLTLYHKFTITEFLKAE--NPVDFLSKANEITFD------------------
H2XWZ3_CIOIN          AKGYGDEAKDLLYMKKTVSEFLGCS--QPMQMLSEISEIVFE------------------
Q7QD87_ANOGA          VEGYD-STDV--RKIITALEYMQSD--KPLALLSRVTEITFTKA----------------
W5J3R9_ANODA          VEGYD-STDV--RKIVTAREFLQQE--KPLPVLSRVTEIRFTET----------------
Q17ME6_AEDAE          VEGYD-GTDV--RKIITVTEFLKEE--KPLGLLGRVTEIRFD------------------
Q9VXK5_DROME          AEGYT-AQDIALRNDLAATEFLKAE--NALAALQGIGSIRID------------------
A0A088A7G6_APIME      VEGYP-ENDYTLYHKLSVKDFIAHE--NVVEALQNTSEIVFD------------------
A0A158NJW7_ATTCE      AEGYR-ENDYTLYHKISAKEFIACE--DAVAALQNASEIVID------------------
E0VIT4_PEDHC          PEGYE-EGDYTLHHTINVTEFLKSE--NAIEVLQRASTIVFD------------------
E9G6A2_DAPPU          AGGYE-EGITSLHKSAQISDFVHKE--NFVDILNNATVLNMN------------------
B7P3V3_IXOSC          AEGYP-EGDYTLYHRVSVLDFIRCE--DHLELLGQCSEVVLD------------------
A0A1X7UGH0_AMPQE      STGYP-EGQHVLFNSLPVVDFILSD--DHMSVLASSHQFVFDKT----------------
G4VQU5_SCHMA          AEGYD--EGDTLYHELPLSKFLESS--DPLEALAKANKVIFD------------------
Q9N5N9_CAEEL          AEGYD-TDSLAIHSTINATDFIKSS--GYLDILGTANVITLD------------------
A8Y2C8_CAEBR          AEGYD-TNSLAIHSKVNASDFIKSS--GYLDILGEANVILLD------------------
A0A2H2IUP1_CAEJA      AEGYD-TNSLAIYATVNATDFIKSP--AYLDMLGSANVILLD------------------
C4M6R5_ENTHI          PQGYD-TSKALVYNVGNAKEFLQAE--DPKAWLATHTAIQFD------------------
E9ADH8_LEIMA          VPTGYEEFATVSHHVASFSDFLNAD--DPKGFLKTHHELRFSDD----------------
A4I305_LEIIN          VPTGYDEFATVSHHVASFSDFLNAD--DPKVFLKTHHELRFSDD----------------
A4HFX5_LEIBR          VPIGYDEFATVSHRVASFSDFLRAD--DPKGFLKIHHELRFSDD----------------
Q586Q7_TRYB2          VPAGYEEFATVQQHVASFSEFMSSS--DPKAFLRSHHELRFTTP----------------
K2MLU3_TRYCR          VPTGYSEFATVSHHVASFSEFLHCS--DPKSFLRSHHELRFSAA----------------
Q4U8L6_THEAN          KKINREGYEGPIYSEISVIDFLKSK--EPAVILVTYNKLLFTTTNS--------------
Q4N1B5_THEPA          KKTNREGYDGAIYSEISVIDFLKSK--EPATILVTHNKLLFTTTHNCINSNHNSVNSSI-
B3L783_PLAKH          RQGYE---VGDDYRVTDICNFIHSD--NYVDLLIKTNKFTFDRDYL--------------
A5K2F1_PLAVS          RQGYD---LGDDYRVTDICNFIHSD--NYVDLLIKTNKFTFDKDYL--------------
Q4Z2U4_PLABA          RQGYE---EGDDYRTADISDFINSD--NYVDLLIKSNKFIFDKNYE--------------
Q8IDF8_PLAF7          RQGYD---VGDDYRATDICTFIKSD--NYVDLLIKNNKFTFDKNYK--------------
B9QL21_TOXGV          LKRHRNGDLLAGLRRVTVDEFFRSK--DPTTLLVEQAREIFFQTPA--------------
                                           .          :                           

SPB1_YEAST            --------------------NDHEWKILKKLKQTTDEFRSCIEDLKVLGKKDFK--MILR
SPB1_CANAL            --------------------HDHEWKILSKLKLCTPELLECIKDLKVLGRKEFK--MILK
SPB1_YARLI            KEARDERGNVQYVLDDKVYSDEDALKMVSKLPQTTPELLECLKDLKVLGRKEFR--AILK
SPB1_EMENI            --------------------GDLALATLDRLPETTDEIRNCCEDLKVLGKKEFR--NLLR
SPB1_ASPFU            --------------------GDLALATLNRLEETTDEIRTCCEDLKILGKKEFR--SLLR
A0A0E1RUQ7_COCIM      --------------------GDLALATLERLPETTDEIRSCCEDLKVLGKKEFR--TLLR
Q0UCU2_PHANO          --------------------GDVAIATIDKLKETTKEVRNCCADLKVLGRADFK--RLLR
I1RTE9_GIBZE          --------------------GDVALAALDKLPETTEEIRNSCSDLRVLGRKDFK--LLLK
C7YTG2_NECH7          --------------------GDVALAALDKLPETTPEIRNCCDDLRVLGRKDFK--LLLK
SPB1_NEUCR            --------------------GDVALAALDKLPETTEEIRLCCADLKVLGRKEFK--LLLK
SPB1_SCHPO            --------------------DDEECQRLYNLDVTTEEILLCCSDLQVLGKKEFR--DILR
SPB1_CRYNJ            ---------------------NETEKGWLKSRHTTPDIIANFEDLKVLGKGDFK--ALMK
A8N1R5_COPC7          ---------------------TDEEKEWLKLDITKPDVKLNCDDLKVLGKGDFK--SLLK
SPB1_USTMA            ---------------------SDESKKLLSLPDTNDEMRENCSDLKVLGKKDFR--NLMN
E3KB01_PUCGT          ---------------------SQQDQAIYKLKATTAEIKTTLTDLKVLGKGDFK--KILK
SPB1_DICDI            -----------------------AAKIFEQHELTTPEIKELVKDLKVLNKNDFQ--KIIK
F0ZY00_DICPU          -----------------------NAQIFKQHPSTTPEIIECFRDLRVLGKNDFS--KIIK
Q0DFV9_ORYSJ          -----------------------ASLPIKNHELTTDEIKALCEDLYVLDKNSFK--HILK
I1PY11_ORYGL          -----------------------ASLPIKNHELTTDEIKALCEDLYVLDKNSFK--HILK
C5YVX0_SORBI          -----------------------ESLPIKNHELTTDDIKNFCEDLLLLDKNSFK--HILK
I1HGA5_BRADI          -----------------------ASLPIKNHELTTEEIKHLCEDLYVLDKNSFK--HILK
I1LJC4_SOYBN          -----------------------ADSPIKDHDLTTEEVKSLCDDLRVLGKQDFK--HLLK
I1LQ27_SOYBN          -----------------------ADSLIKDHDLTSEEVKSLCDDLRVLGKQDFK--HLLK
F6I0L2_VITVI          -----------------------ASLPIKDHALTTEEVKTLCDDLRVLGKQDFK--HLLK
B9HRL4_POPTR          -----------------------VSLPLRDHDLTTEEVKHLCDDLRVLGKQDFK--HLLK
F4JTD2_ARATH          -----------------------ASLPLKEHDLTTEEIKILCDDLPVLGKNDFK--HILK
A9RQI9_PHYPA          -----------------------DCKVIKEHDLTTDEIKILCEDLRVLGKTEFK--QLLK
H3GC19_PHYRM          ------------------------DDVFRDHKDTTDEIVTCLNDLKVLGKGDFK--SLLK
D0MRD5_PHYIT          ------------------------DDVYRDHKDTSIEIVTCLSDLKVLGKSDFK--SLLK
A0EER5_PARTE          -----------------------AKQKYLGLAKPPQDYEILMEDIKVLGKREII--QLLK
Q23MN4_TETTS          -----------------------QLEKYIPMTDPPKDWEIICEDILVIGKREIA--QLIK
SPB1_HUMAN            ------------------------DEELAQHPATTEDIRVCCQDIRVLGRKELR--SLLN
H2QDN5_PANTR          ------------------------DEELAQHPATTEDIRVCCQDIRVLGRKELR--SLLN
G3QV89_GORGO          ------------------------DEELAQHPATTEDIRVCCQDIRVLGRKELR--SLLN
SPB1_PONAB            ------------------------DEELAQHPATTEDIRVCCQDIRVLGRKELR--SLLN
G1QW13_NOMLE          ------------------------DEELAQHPATTEDIRVCCQDIRVLGRKELR--SLLN
F7DBK9_MACMU          ------------------------DEELAQHPATTEDIRVCCQDIRVLGRKELR--LLLN
F7HIR2_CALJA          ------------------------DEELVQHPATTEDIQVCCQDIRVLGRKELR--SLLN
H0XRX1_OTOGA          ------------------------DEELAQHPATTEDIRACCQDIKVLGRKELR--SLLN
I3NA29_ICTTR          ------------------------DEELAQHPATTEDIQACCQDIRVLGRKELR--SLLN
G1PIT9_MYOLU          ------------------------DEELAQHPATTEDIRVCCQDIKVLGRKELR--SLLN
F6SYP9_HORSE          ------------------------DEELAQHPATTEDIRVCCQDIKVLGRKELR--SLLN
F1RSJ8_PIG            ------------------------DEELARHPATTEDVRACCQDIRVLGRKELR--SLLN
E2RHC4_CANLF          ------------------------DEELAQHPATTEDIWACCQDIKVLGRKELRDRSLLN
G1SLJ8_RABIT          ------------------------DEELAQHPATTEDVRACCQDIKVLGRKELR--SLLN
SPB1_MOUSE            ------------------------DEELAQHPATTEDIRVCCQDIKVLGRKELR--SLLN
SPB1_RAT              ------------------------DKELAQHPATTEDIRACCQDIKVLGRKELR--SLLN
H0VJ21_CAVPO          ------------------------DKELAQHPATTEDIQACCQDIKVLGRKELR--SLLN
F1MY97_BOVIN          ------------------------DEELAQHPATTEDIRVCCQDIKVLGRKELR--SLLN
F6UUX8_MONDO          ------------------------DKELEQHPATSEDIKVYCQDIKVLGRKELR--SLLN
G3WIR8_SARHA          ------------------------DKELELHPATNEDVKVYCQDIKVLGRKELR--SLLN
SPB1_CHICK            ------------------------DGELENHSSTTEELRQCCKDIRVLGRKELR--ALLN
H3DDM8_TETNG          ------------------------NKDLESHASTTNEIKECCRDIRVLGRKELR--LLLS
H2V6Z5_TAKRU          ------------------------NKDLESHAATTNEIKECCRDIRVLGRKELR--QLLS
I3IZN4_ORENI          ------------------------NPDLEFHSATSNEIKECCRDIKVLGRKELR--LLLN
A0A0R4IQB8_DANRE      ------------------------DPLLESHPLTSAEIRECCSDVKVLGRKELR--LLLS
H2XWZ3_CIOIN          ------------------------DDDQKVHPLVTDEIKEHVKDIKRLGKKEIK--TLLK
Q7QD87_ANOGA          ------------------------DEAIANHPRTTTELKECCKDIKILGRKDIK--ELLR
W5J3R9_ANODA          ------------------------DADIANHPRTTAELKECCKDIKILGRKDMK--ELLR
Q17ME6_AEDAE          ------------------------DKAISNHPRTTSEIKECCKDIKVLGRKDLR--DLLK
Q9VXK5_DROME          ------------------------DQRIANHKKTTPEILECCKDLKVLGRKDIK--GLVQ
A0A088A7G6_APIME      ------------------------DEIITNHEKTTKEIKECCKDIKVLGKKDLR--NLIN
A0A158NJW7_ATTCE      ------------------------DEIIDKHDKTTKEIRECCKDIKVLGRKDLK--LLLS
E0VIT4_PEDHC          ------------------------DETILNHPKTTKELVECFKDIKVLNRKDVR--LILT
E9G6A2_DAPPU          ------------------------DPEIANHPLTTIEIKECCKDIKVLGRKDLK--ALLG
B7P3V3_IXOSC          ------------------------NQEVLDHPSTTEEIKECCKDIKVLGRGDIK--NLLT
A0A1X7UGH0_AMPQE      ------------------------SEVFNKHPLTTEEIKELCSDIKVLGLKELK--VLIK
G4VQU5_SCHMA          ------------------------VPEIACHPLTTSLIKEDFNDIQVLGKGDIK--NLLK
Q9N5N9_CAEEL          ------------------------DEKWKNHEKTTEEVIEYMNDVKVLGPRELR--VLLR
A8Y2C8_CAEBR          ------------------------DPKWKNHEKTTEEVVEYMKDVKVLGPRELR--VLLR
A0A2H2IUP1_CAEJA      ------------------------DDKWKNHEKTTEEVEEYMRDVKVCGPRELR--VLLR
C4M6R5_ENTHI          -----------------------------EGLPVTEDIKGYGSDIRMLGSAELK--LLLK
E9ADH8_LEIMA          -----------------------ADKEYLTSKSSKKELVYLCGDLQQVGEADLR--RMLR
A4I305_LEIIN          -----------------------ADKEYLKSKSSKKELVYLCGDLQQVGEADLR--RMLR
A4HFX5_LEIBR          -----------------------VDKAYLKSKSSKKELVYLCGDLQQVGEADLR--RMLR
Q586Q7_TRYB2          -----------------------EEKAFLKSKHSKKELVYLCGDLQQVGDADLR--RLVR
K2MLU3_TRYCR          -----------------------EDKVYLKSKHSKKELVYLCGDLQQVGDADLR--RMLR
Q4U8L6_THEAN          ------------NTIGTKSTDEEILEMVKENPLTTEEIKLLCSDLKVAGKSDLQ--SLLK
Q4N1B5_THEPA          ------------NSTTGTIGDDDVLSMVEESPLTTEEIKLLCSDLKVAGKSDLQ--SLLK
B3L783_PLAKH          --------------TSEDPLVRNTYTAIYKNPSTTQEILQLCKDLKVLGKSDLF--QLIK
A5K2F1_PLAVS          --------------TSEDPLVKSTYTAIYKNPSTTQEILQLCKDLKVLGKSDLF--HLIK
Q4Z2U4_PLABA          --------------KSLDLLIKNTYEAIYTNKSTNNEIFNLCKDLKVLGKSDLF--NLIK
Q8IDF8_PLAF7          --------------NNSDPMIKTIYECIYKNECTTKEIFFLCNDLKVLGKSDLY--NLIK
B9QL21_TOXGV          ---------------------VALEEAVRNHRLTTPETLACLADVQVLGKAELA--ALLK
                                                                 *:   .  ..    :: 

SPB1_YEAST            WRKIAREILGIEVKDD--------------------------------------------
SPB1_CANAL            FRKQARDILGIDKDEK--------------------------------------------
SPB1_YARLI            WRLSARDLLQIDKPE---------------------------------------------
SPB1_EMENI            WRLKVREKFGLVVKKG--------------------------------------------
SPB1_ASPFU            WRLKVREKFGLVVKKG--------------------------------------------
A0A0E1RUQ7_COCIM      WRLKVREQFGLAVKKG--------------------------------------------
Q0UCU2_PHANO          WRLKVRDIFGFSAKKKEEEA--------------------------------------EK
I1RTE9_GIBZE          WRLKVREIFGFETKKAL-------------------------------------------
C7YTG2_NECH7          WRLKVREIFGFKTKET--------------------------------------------
SPB1_NEUCR            WRLKVREIFGFPSKKTQ-------------------------------------------
SPB1_SCHPO            WRLKIRDEMGIGKKVE--------------------------------------------
SPB1_CRYNJ            WRLAIRLEIGLDVKADK-------------------------------------------
A8N1R5_COPC7          WRLALREELGLEVTTKQ-------------------------------------------
SPB1_USTMA            WRKEVRLALGIDLPKSK-------------------------------------------
E3KB01_PUCGT          WRTAVRELLGIDSKPVN-------------------------------------------
SPB1_DICDI            WKKAMAAYKEKLDNPDE-------------------------------------------
F0ZY00_DICPU          WRKAMAEYKEKLDNPEE-------------------------------------------
Q0DFV9_ORYSJ          WRIRIRKALS-SSEVTK-------------------------------------------
I1PY11_ORYGL          WRIRIRKALS-SSEVTK-------------------------------------------
C5YVX0_SORBI          WRIRLRKSLSASSQVTP-------------------------------------------
I1HGA5_BRADI          WRIRIRKALSASSQVTP-------------------------------------------
I1LJC4_SOYBN          WRIQIRKALSPTQKPDS-------------------------------------------
I1LQ27_SOYBN          WRIQVRKALSPTQKPDS-------------------------------------------
F6I0L2_VITVI          WRMHVRKALSPVQKATS-------------------------------------------
B9HRL4_POPTR          WRMQIRKALSSSQKASP-------------------------------------------
F4JTD2_ARATH          WRMQIRKALTPEKKEVA-------------------------------------------
A9RQI9_PHYPA          WRLQIRKNLEPTPASDK-------------------------------------------
H3GC19_PHYRM          WRTRMQKYKEELLKAENPEE--------------------------------------ED
D0MRD5_PHYIT          WRTRMLKYKEELLKAKKPEE--------------------------------------EK
A0EER5_PARTE          WRSKIKHFLSKQKKEQKQ-------------LEKQEQQES------------------AE
Q23MN4_TETTS          WRNKILHIQRKNKEQEKKNKLKAITDGDQQGDEKQDQEQSSEMDVEENEEDWEDEKGNSE
SPB1_HUMAN            WRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDE-------------------------E
H2QDN5_PANTR          WRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDE-------------------------E
G3QV89_GORGO          WRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDE-------------------------E
SPB1_PONAB            WRTKLRRYVAKKLKEQAKALDISLSSGEEDEGNE-------------------------E
G1QW13_NOMLE          WRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDE-------------------------E
F7DBK9_MACMU          WRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDE-------------------------E
F7HIR2_CALJA          WRTKLRRYVAKKLKEQAEALDISLSSGEEDEGDE-------------------------K
H0XRX1_OTOGA          WRTKLRRHVAKKLKEQAKALDISLSSGEEEEGDE-------------------------E
I3NA29_ICTTR          WRTKLRRYVAKKLKEQAKALDLSLSSGEEEEGEEE------------------------E
G1PIT9_MYOLU          WRTKLRRYVAKKLKEQAKALDISLSSGEEEE-GDE------------------------E
F6SYP9_HORSE          WRTKLRRYVAKKLKEQAKALDISLSSGEEEEEGNE------------------------E
F1RSJ8_PIG            WRTKLRRHVAKKLKEQAKAMDISLSSGEEEE-GEE------------------------E
E2RHC4_CANLF          WRTKLRRYVAKKLKEQAKALDISLSSGEEEEEEEG------------------------E
G1SLJ8_RABIT          WRTKLRRHVAKKLKEQAKALDISLSSA---------------------------------
SPB1_MOUSE            WRTKLRRYVAKKLKEQAKALDISLSSEEEEEGDE-------------------------E
SPB1_RAT              WRTKLRRYVAKKLKEQAKALDISLSSEE--EGDE-------------------------E
H0VJ21_CAVPO          WRTKLRRYMAKKLKEQAKALDISLSSGEEEGDEE-------------------------E
F1MY97_BOVIN          WRTKLRRYVAKKLKEQAKALDISLSSGEEEEGEE-------------------------E
F6UUX8_MONDO          WRTKLRRFVAKKLKDQAKALDISLSSGEEEEEKEE------------------------E
G3WIR8_SARHA          WRTKLRRFVAKKLKDQAKALDISLSSGEEEEEEEQ------------------------E
SPB1_CHICK            WRTKLRRFLTKKLKEQAKELDINLSSGEEEEGREE------------------------E
H3DDM8_TETNG          WRSKLRRYLSKKLKMEAKGLQDEINLFYSTLFLFI------------------------L
H2V6Z5_TAKRU          WRSKLRRYLSKKLKMEAKSLQDEINLSSDEEKEPD------------------------E
I3IZN4_ORENI          WRSKLRRYLAKKLKDEAKQLDQEISLSSDEERSDS------------------------E
A0A0R4IQB8_DANRE      WRSKLRKFLAKKLRQEAKQLDQEAS-SDDEQSDTD------------------------E
H2XWZ3_CIOIN          WHKKWQKLNAPQVEEVEENEEEEVD-----------------------------------
Q7QD87_ANOGA          WHKLLSPEFTEAGEDKADDKKKKG---------------------------------EGE
W5J3R9_ANODA          WHKLLHPEFAGPKEEDASGKDAKGKDGKKQKKQKDK--------------------KEGD
Q17ME6_AEDAE          WHKMMSSELFPQEEKAEEETKGKGK-------------------------------RVTK
Q9VXK5_DROME          WWKDVRELFVEKETPLVVGNAADEK-----------------------------------
A0A088A7G6_APIME      WWKIIKESLKEKEPIDENTQNLLDE-----------------------------------
A0A158NJW7_ATTCE      WWKALKKTQTETN--GEKNVTKDEI-----------------------------------
E0VIT4_PEDHC          WWKALREEAKLKYMKEMEEKKAKEK-----------------------------------
E9G6A2_DAPPU          WRKAIQKSLDDKAEQLKLEENASIE-----------------------------------
B7P3V3_IXOSC          WRKKLKTWFEEKAKAEGKVDEAEVE-----------------------------------
A0A1X7UGH0_AMPQE      WRAKMKEFLDQVSDSEDESGTKGAG-----------------------------------
G4VQU5_SCHMA          WRMKILSVLKAESKESKDSIEESNLP----------------------------------
Q9N5N9_CAEEL          WRKSMLETLEEQRKAVEGEAKEVEI-----------------------------------
A8Y2C8_CAEBR          WRKSMLETLEAERKAVEGEAQDVEI-----------------------------------
A0A2H2IUP1_CAEJA      WRKLMIDMLNAEKKALEAATEVAEEP----------------------------------
C4M6R5_ENTHI          WRDIIVKKIKKEQEEADKIKAEEEK-----------------------------------
E9ADH8_LEIMA          WREQLLREKIHRIQVDAAGTEEDGDVDSMAGGNGSD--------------------DDDD
A4I305_LEIIN          WREQLLREKTHRIQVDAAGTEEGGDVDSMAGGNGSD--------------------DEDD
A4HFX5_LEIBR          WREQLLREQARHIQADAVGTEEDGDADSMVGGTGSDGCD-----------------DGDD
Q586Q7_TRYB2          WREQLLREQARELKQR-AASDAN------AGDIAEE--------------------DEEE
K2MLU3_TRYCR          WREQLLREQAAMAKEADEEEDAD------DEEMGDD--------------------DDGD
Q4U8L6_THEAN          WRFKLINTIPNLKTKSN-PSDSTKP-----------------------------------
Q4N1B5_THEPA          WRFKLINSIPSLNRKSSEQSESLKP-----------------------------------
B3L783_PLAKH          WRYKVKKGIASVDAEAQ---SSQAVDAEEKTSQELAPVK-------------------ED
A5K2F1_PLAVS          WRYKVRKGVASLGGETQ---LSKTSDAEEEASQGVDPVK-------------------EN
Q4Z2U4_PLABA          WRYKIKKSVMKMLTSNEEKTKQLVNNDDENTNQTTFEIS-------------------KE
Q8IDF8_PLAF7          WRYKIKKSVLNQTSKKN--NLDFDNHDVEQTTQELSDVK-------------------ES
B9QL21_TOXGV          WRFRVKKDVFLALGLRTHAAAEKPP-----------------------------------
                      :                                                           

SPB1_YEAST            ---AKTE----IEVVPLTEEEQIEKDLQGLQEKQR------------------LNVKRER
SPB1_CANAL            ---EEEEENPKIEVEPLTEEQKIDQELQDLINKQK------------------QKAKRLK
SPB1_YARLI            ---AGVE----VEEEELDEDQLIDKELSELGEREK------------------ARKKRER
SPB1_EMENI            -QAKDDEAEEVAEIAPMDDELAIQEELLRLKEKES------------------ARSKKER
SPB1_ASPFU            -QAKADEPEEVAEVAPMDEELAIQEELQRLQEKES------------------AKRKKER
A0A0E1RUQ7_COCIM      -AKKAEESEEVAEIEPMDEELAIQEEMQRLQEHES------------------SRKKKER
Q0UCU2_PHANO          -AKDAEEGDEVAEIEDMDDEMKIQEELERLKEKDS------------------KSKKKQR
I1RTE9_GIBZE          ---NTAETEEVAEVESMDEELKIQQELEDMKDKEN------------------SKRRREK
C7YTG2_NECH7          ---ATEEPEEVAEVESMDEELKIQEELQAMKDKEN------------------KKKKREK
SPB1_NEUCR            ---KAAVDEEVAVVENMDEELRIQEELQRIKEKET------------------SKKKRER
SPB1_SCHPO            ----DEQKTVVEEIPEMDEEERLDQELQDLSEAER------------------VKLKRER
SPB1_CRYNJ            -TQDATEEV---VVEPMDEEEQITEELQKLQQAKL------------------AKTKRER
A8N1R5_COPC7          -TEDATEVID--VTEEVDEEQQLSEELERLNAEAA------------------ARLKRER
SPB1_USTMA            -HQDLAEQTQTVEVEEMDEDDQIDDELARLNEEAA------------------RKARKER
E3KB01_PUCGT          -QAPSEAPVE---VEPLDEEQIMKEELARIQTEKA------------------LENKRER
SPB1_DICDI            --EETEKPEEKKELTAEEMEENLQEEMKEYLALVE------------------KKKRKEK
F0ZY00_DICPU          --EETKEPEPERELTQEEKDALLDTELEQLKENLE------------------KKRRKEK
Q0DFV9_ORYSJ          --KTDDT---AVEVNVKDDDQ-LLQEMEELTSVID------------------RKKKREK
I1PY11_ORYGL          --KTDDT---AVEVNVKDDDQ-LLQEMEELTSVID------------------RKKKREK
C5YVX0_SORBI          --KVNDA---VENTKVTDDDV-LLQEMEELTSVID------------------RNKKREK
I1HGA5_BRADI          --KADGT---TLDAKVKDDDQ-LLQEMEELTSVID------------------RKKRREK
I1LJC4_SOYBN          --TTTEQM-GNEPK-VDEEDR-ILNEMEELTYVMD------------------RKKKRAK
I1LQ27_SOYBN          --TTTELM-DNEPKVVDEEDR-ILNEMEELTYVMD------------------RKKKRAK
F6I0L2_VITVI          --TAAE---DDHEKVVDEDER-MLNEMEELTYAME------------------RKKKRTK
B9HRL4_POPTR          --SIGKG--GEDEKEEDEDDR-LLNEMEDLTNAME------------------RKKKREK
F4JTD2_ARATH          --KPEPDV-GKEDE-ENEDDK-LLNELEELTNTVD------------------RKKKQAK
A9RQI9_PHYPA          --EDDSNE-KKKGSDEDNDDEEELATMEELKEYVE------------------SQKRKER
H3GC19_PHYRM          EKEKPAEKEPERDLTEKEKDALVREELSQLRANVQ------------------AKKKREK
D0MRD5_PHYIT          EEEEKPEKEPERELTEKEKDALVREELSQLRANVQ------------------AKKKREK
A0EER5_PARTE          YEDLDEAEGEGQDDEVNEEEAEEQDDLDKLVDKQK--------------EALEQQYIEEQ
Q23MN4_TETTS          EEEDDDEEEEDDDEEEDEEEEDVDEDVEEGDDEKEDDEEEEQENKEDVDEQLAKEIREDQ
SPB1_HUMAN            DSTAGTTKQPSKEEEEEEEEEQLNQTLAEMKAQEV------------------AELKRKK
H2QDN5_PANTR          DSTAGTTKQPSKEEEEEEEEEQLNQTLAEMKAQEV------------------AELKRKK
G3QV89_GORGO          DSTAGTTKQPSKEEEEEEEEEQLNQTLAEMKAQEV------------------AELKRKK
SPB1_PONAB            DSTAGTTEQPSKEE--EEEE-QLNQTLAEMKAQEV------------------AELKRKK
G1QW13_NOMLE          DSTAGTTKQPSKEE--EEEEEQLNQTLAEMKAQEV------------------AELKRKK
F7DBK9_MACMU          DSTAGITKQPSKEE---EEEEQLNQTLAEMKAQEV------------------AELKRKK
F7HIR2_CALJA          DSIAGTTVQPSEEE----EEEQLNHTLAKIKAQEV------------------AELKRKK
H0XRX1_OTOGA          ES---TTRQPSKEE---EEEEQLNQTLAEMKAQEV------------------AELKRKK
I3NA29_ICTTR          ESTGGTTKQPSKEE---EEEEQLNQTLAEMKAQEV------------------AELRRKK
G1PIT9_MYOLU          DSTAGTPRQLSKEE---EEEEQLNRTLAEMKAQEV------------------AELKRKK
F6SYP9_HORSE          ESTARTVRQPSKEE---EEEEQLNRTLAEMKAQEV------------------AELKRKK
F1RSJ8_PIG            EQAARASQQPSKEE---EEEEQLNRTLAEMKAQEV------------------AELKRKK
E2RHC4_CANLF          ESEAGTGRQPSKEE---EEEEQLNRTLAEMKAQEV------------------AELKRKK
G1SLJ8_RABIT          ---AGITRQPSKEE---EEEEQLNRTLAEMKAQEV------------------AELKRKK
SPB1_MOUSE            EAVAETKQAPEEEEER-EEE-QLNRTLAEMKAQEV------------------AELKRKK
SPB1_RAT              ESAAETKQASEEEEER-EEEEQLNRTLAEMKAQEV------------------AELKRKK
H0VJ21_CAVPO          ESTTETTRQPSKEEE---EEEQLNQTLAEMKAQEV------------------AELKRKK
F1MY97_BOVIN          QAAAGTGPQPSQEEE--EEEEQLNRTLAEMKAQEV------------------AELKRKK
F6UUX8_MONDO          QKEGRGKKTLAAAEDA--EEEELDRALAEMKAQEI------------------AELKRKK
G3WIR8_SARHA          E----GKKTTLAAKD---EEEDLDRALAEMKAQEV------------------AELKRKK
SPB1_CHICK            EK---TSPKAAADEMVKEEEEEVELALAEMKAKEL------------------AELKRKK
H3DDM8_TETNG          TKTVLK----------SAPLSLVERKLAELKATEV------------------AELKRKK
H2V6Z5_TAKRU          NKEGREEDD-------DDDEEEMERKLAQLKAEEV------------------AELKRKK
I3IZN4_ORENI          EEAGKKEDEEEEGE--DNEEEEMVKKLTELKAEEV------------------AELKRKK
A0A0R4IQB8_DANRE      KESKKKKSEEKKEE--EDEDEAMEKKLTELKAEEF------------------AELKRKK
H2XWZ3_CIOIN          ------------------SEEEMERKIQEIQENET------------------RELKKKK
Q7QD87_ANOGA          DGAKDDDDEETDVDEEIVELKQIEKEIATLQKEEE------------------RSSKRMR
W5J3R9_ANODA          DSDEEGDDEEEE-DEDTVELRQLDKELANLKEDQT------------------RESKRMR
Q17ME6_AEDAE          LNEQIEQEEAEGDDEETVELKSMEKEIAELRKEEE------------------QDAKRKR
Q9VXK5_DROME          ------PKPLTQAEIEDMEDAELQTQIETIVEEEK------------------KDLKRKR
A0A088A7G6_APIME      ---TVETAPMSQEELEDIEDEQIRKQIEELKENEA------------------RDLKRKK
A0A158NJW7_ATTCE      ---TVTPTTINLEEQEDLEDEAIQKQIAELQEAEA------------------RELKRKK
E0VIT4_PEDHC          ---KNQPEPTLSDE-EEKELNEIDAHISAVKKEEL------------------QAQKKKK
E9G6A2_DAPPU          ---KPVPMEEDACSDDEEDLSQVERQIKELEDAKV------------------QDAKRKK
B7P3V3_IXOSC          --------EVADDEGSEDEELQLLKHAEEVTAEQA------------------KEEKKKR
A0A1X7UGH0_AMPQE      ----------SDNE---MDLSEVDARVKELAKEEK------------------AELKSIL
G4VQU5_SCHMA          ----------KRDTGEDEEDLEVETEVQRLWDEEE------------------KLKKKKM
Q9N5N9_CAEEL          ------EENLTEEQLEDRAMAEIDELIAKASEDEK------------------AALKKKK
A8Y2C8_CAEBR          ------EEDLTEEQIEDRAMAEIDELIAKASEDEK------------------AALKKKK
A0A2H2IUP1_CAEJA      ------EEELNEDQIEDRAMAEIDDLIAKASEEEI------------------AALKKKK
C4M6R5_ENTHI          ---------MKMEDKILTEQEELQKELEREEEEER------------------EEEIAKN
E9ADH8_LEIMA          -DDGEGKRDYHFDFDSPEGVTQIARELLEIRKKKA------------------KELKKKQ
A4I305_LEIIN          EDDGKGKRDYHFDFDSPEGVTQIARELLEIRKKKA------------------KELKKKQ
A4HFX5_LEIBR          EDDGQRKRDYYFDFDSPEGVTQIARELLEIRKKKA------------------KELKKKQ
Q586Q7_TRYB2          -----EKDDDKFDFDSAEGVAKIARELLELRKKQS------------------KEMKKKQ
K2MLU3_TRYCR          SVGNGSDDEEGIDLDSAEGVAKIARELLELRKRQS------------------KLLKKKQ
Q4U8L6_THEAN          ------GIDGSEPTISDTTVSTTTDPTAMDTVDS-------------TIDSTVIEMDKKI
Q4N1B5_THEPA          ------EDESVAETKSTSNKSTSDKSTSNKSTSSKSTSNESVEIDPEAVDSSVLSLDKKL
B3L783_PLAKH          TPIKETQTSTTKASLQDD---ELSGSSDADSEKDE------------INEFSTQMEKKNK
A5K2F1_PLAVS          LPTEETRTATTKASLQDD---ELSGSSDADSEKDE------------INEFSTQMEKKNK
Q4Z2U4_PLABA          ENPINAETINTKSTVCEDNLEELSNSSNEGSENES------------INEFSKYIEKKEK
Q8IDF8_PLAF7          SQIDDFNTIVDKNISENE----LDNTSDEATEKDEK------DQVDEIEEFSAYIEKKKK
B9QL21_TOXGV          ---AGANDDGEERDRDEADSAEIDEELTRLHASVTR-----------------REAKQQK
                                                                                  

SPB1_YEAST            RRKNEMKQKELQRMQMNMITPTDIGI-EAA----SLGKE-SLFNLKTAEKTGILNDLA--
SPB1_CANAL            KNANELKQKEIIRNQMNMLTDMNIGI-EAA----QIGAD-SLFNLKTAEKTGQLDKLA--
SPB1_YARLI            RRRNEMKQREIQRMQMNMTTPTELGI-EAA----KM--E-SLFNLKQAERTGKLSELQ--
SPB1_EMENI            RKENERKRKEIVRMQMHMTTPMDIGMEQLG----PGGED-ATFSLKRAEKAGAAAAMA--
SPB1_ASPFU            RKENEKKRKEIIRMQMHMTTPMDIGMEQLG----PGGDD-ATFSLKRVERDGARDVIA--
A0A0E1RUQ7_COCIM      RRENERKQKEIVRLQMHMITPTDIGMEQSG----PMGEG-AMFSIKPITREGATRNIT--
Q0UCU2_PHANO          RNENERKQKEIVRMQMNMTTPYEIGMEQAG----PQGDD-AMFALKSVDKAGALSRIA--
I1RTE9_GIBZE          RRENERKQREIVRMQLNMTAPMDIGMEEAG----PIGEG-AMFSLKKVDKTDAMRRLN--
C7YTG2_NECH7          RKENEQKQREIVRMQLNMTAPMDIGMEESG----PIGEG-AIFSLKKVDKTDAMRRLN--
SPB1_NEUCR            RRENEKKQKEIVRMQMNMTAPMDIGVEQEG----PRGEG-AMFRLKTIDQNAALNKIA--
SPB1_SCHPO            RKANQRKQREIVRMQMGMLAPMDIGLEHEA-----MGED-SLFGLATAEKH-GLKELE--
SPB1_CRYNJ            KRANEKKARELLKLQLNMTVPDD--LDQND-LALQ-GEE-EIFDLEEGENEARRRGKNGG
A8N1R5_COPC7          RKANEIRTRTIQRMQLQMTAPLDIGLEQHD-AALNLGQE-DIFDLEHTQKSLRNRQE---
SPB1_USTMA            RRKNELRQKKILKMQLQMTTPMDIGMDVMD-DQLGAGNG-DMFEISSGER----------
E3KB01_PUCGT          RRLNEKRTRDVQRMQLQMTTPMDIGIENTDGEVFGLQNV-DSQDLSSDDD----------
SPB1_DICDI            KRQNELKRKHQRKIELTMHIPGDKIEETTD--------G-DLYSMKGKDEFDEDIVADH-
F0ZY00_DICPU          KKANEKKRLERKRIELTMHIPGDKIEEGAD--------D-DLFVMKGKQDFQDDVVAEH-
Q0DFV9_ORYSJ          KRQSKRRAKDKARKATG-MQIDATGDNYGD--------P-DLFSISAIKGGKELQAIES-
I1PY11_ORYGL          KRQSKRRAKDKARKATG-MQIDATGDNYGD--------P-DLFSISAIKGGKELQAIES-
C5YVX0_SORBI          KRLSKRRAKDKARKATG-MQIDATGDDYGD--------P-DLFSISVIKGGKQLEAVES-
I1HGA5_BRADI          KRLSRRRAKDKARKATG-MQIDATEDGYCD--------P-DLFSIDAIKGGKGLQALES-
I1LJC4_SOYBN          KLLAKRRAKDKARKATG-MQMDAIDDGYVD--------Q-ELFALSSIKGKKDLVAVDN-
I1LQ27_SOYBN          KLLAKRRAKDKARKATG-MQMDAIDDGYVD--------Q-ELFALSSIKGKKDLVAVDN-
F6I0L2_VITVI          KLLAKRQAKDKARKVTG-MQVDALEEGYTD--------H-ELFSLSSIKAKKDLLAVNS-
B9HRL4_POPTR          KLLAKRRAKDKVRKATGGMQIDATADGYTD--------L-ELFSLSSIKGKKDLVAVDA-
F4JTD2_ARATH          KILAKRRAKDKARKATG-PQMDVLEDGFVD--------N-ELFSLNAIKGKKDLMAVDN-
A9RQI9_PHYPA          KKKAKAKEKAKARSATG-MQIDVMEDGVAD--------T-ELFNIKAIKGKKDLARMEV-
H3GC19_PHYRM          KKERERKQKLRIRAALGMNAEGIDVTEVES-------AF-SLKELKLSKEKVDVLENAG-
D0MRD5_PHYIT          KKERERKQKLRIRAALGMNADGIDVTEAES-------AF-SLKELKLSKSKVDELENAG-
A0EER5_PARTE          KKELKEQRKQKQKQAQQEKKLSGRGIGFTP----QEEDQ-ELFQFSKHKNILKLGYVDVE
Q23MN4_TETTS          KKQLKKQRKQKEKLLKGIAKKA-IGVEFAN----DIVDE-ELYNMNQHKEVMNMEYVEMS
SPB1_HUMAN            KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLSTIRGHQ--------
H2QDN5_PANTR          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
G3QV89_GORGO          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
SPB1_PONAB            KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGQQ--------
G1QW13_NOMLE          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
F7DBK9_MACMU          KKLLREQRKQRERVELKMDLPGISIADEGETG---------MFSLRTIRGHQ--------
F7HIR2_CALJA          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
H0XRX1_OTOGA          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
I3NA29_ICTTR          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
G1PIT9_MYOLU          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
F6SYP9_HORSE          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
F1RSJ8_PIG            KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
E2RHC4_CANLF          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
G1SLJ8_RABIT          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
SPB1_MOUSE            KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGQQ--------
SPB1_RAT              KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGQQ--------
H0VJ21_CAVPO          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIQGHQ--------
F1MY97_BOVIN          KKLLREQRKQRERVELKMDLPGVSIADEGETG---------MFSLRTIRGHQ--------
F6UUX8_MONDO          KKLLQEQRKQRERVELKMDLPGVSIADDGETG---------MFSLHTIRGHQ--------
G3WIR8_SARHA          KKLLQEQRKQRERVELKMDLPGVSIADDGETG---------MFSLRTIRGHQ--------
SPB1_CHICK            KKILKEQRKQRERVELKMDLPGVSIADDGDTS---------MFSLQTIQRTQ--------
H3DDM8_TETNG          KKLLKERRKQRERVALKMDLPGVSIADGGDSS---------MFSLSTINKQK--------
H2V6Z5_TAKRU          KKVLKERRKQRERVALKMDLPGVSIADGGDSS---------MFSLSTINKQK--------
I3IZN4_ORENI          RKLLKEQRKQRERVELKMDLPGVSIASTEDSS---------LFSLVSIKKKK--------
A0A0R4IQB8_DANRE      KKLLKERRKQRERVELKMDLPGVSIADAGDSS---------MFSLGSIRKSQ--------
H2XWZ3_CIOIN          KVVTKERQKLRE----RMSNMVTSTNSQEDME---------LFALSKINSAR--------
Q7QD87_ANOGA          KKTNKERAKLNEKLSLKMVIKGDAGPTEQGEDM--------VFSLKDVGTRQ--------
W5J3R9_ANODA          KKANKERAKLNERLSLKMVIKGDEGPTEQSSDV--------TFKLSDVASKQ--------
Q17ME6_AEDAE          KKANKERAKLNEKLSLKMVIKGDEGPTEQADAM--------MFSLNAVRSKK--------
Q9VXK5_DROME          KKTLKTKAKLHEKMNLNMVIKGDDGPVEEMEHE--------IFDLKNIRTSA--------
A0A088A7G6_APIME      KKANKQRQKLNERLNLKMIHKGNEGP-ILEGDD--------MFSLKEIKTHQ--------
A0A158NJW7_ATTCE      KKANKDRQKLNERLNLKMIHKSDEGP-KLERDD--------LFNLNQIQTYQ--------
E0VIT4_PEDHC          KIAEKERKKLQEKMNLKMVLNKYENPGMQDEDA--------IFRLSMIRSGK--------
E9G6A2_DAPPU          KKLMNERRKLQEKMRLKMVIPGDGGPSVLEAKP--------LFALDQIKTDQACIFNRFN
B7P3V3_IXOSC          KKMLKQRKKLRDRMNLQMVLK-DDDPIVERDDD--------LFKLKAIKSKK--------
A0A1X7UGH0_AMPQE      RYKRKQRRKVEERLKSQQEEDDPVTGEVTSGGK------EKLFSLNHIKTSS--------
G4VQU5_SCHMA          KKVRKEKRKLAERYVLKMSHESDYIEQNDDELF------SLAAIKDLVGLEE--------
Q9N5N9_CAEEL          KKMLKAKARVLKRRELKMIIDGDEGPQAEDQE---------VFQLKKIRKAK--------
A8Y2C8_CAEBR          KKMLKAKARVLKRRELKMIIDGDEGPQAEDQE---------VFQLKKIRKAK--------
A0A2H2IUP1_CAEJA      KKMLKAKARVLKRRELKMIIDGDEGPQAIDQE---------VFQLKKIRRAR--------
C4M6R5_ENTHI          KKTAKQKRAEEKKKRKEQRIKEGGMDIANSSGY------DEVDQLFSIDDLK--------
E9ADH8_LEIMA          KKVVDRKLKQIKGLINYDPNMSAEHMTETDGFAYKGTNTDAFDDDGDAAAGGEDGEADEL
A4I305_LEIIN          KKVVDRKLKQIKGLINYDPNMSVEHMTEADGLTYKGTNTDAFDDDGDAAAGGEDGEADEL
A4HFX5_LEIBR          KKVVDRKLKQIKGLINYDPNMSAEHMTEADGFDYQGTHTDAFDDDGDTAAGDEDGKPDEL
Q586Q7_TRYB2          KKIVDRKLKQIKGLINYDPNTSAEHMTDADGFTHDADGVEG--SDVGEEDSSEDGEDD--
K2MLU3_TRYCR          RKIVDRKLKQIKGLINFDPNTSTEDMTETDGLMRDTEGNMQ--DEGDADDDDLDGNDD--
Q4U8L6_THEAN          KNKIESEKRRLERKQRKMLKKLKIGKNSNSSLITP---DPDLFSLNSSNLQSYPEALPDG
Q4N1B5_THEPA          KSKIIQEKRRLERKQRKMLKKLKPG--TSSTFVGP---DPDLFSLESLNLESLTELSQSH
B3L783_PLAKH          KEQKKKEKKLKKELEKRK-MNKSFKPDYDENEIHFNKNMLKLLDKQSFEDHLNVLSGSK-
A5K2F1_PLAVS          KEQKKKEKKLKKELEKRK-MNKSITPDYDENEIHFNKNMLKLLDEQSFEDHLNILSGSK-
Q4Z2U4_PLABA          KEKKKKEKKLKKELEKKK-INKPLKIDYDENDIHFNKDMLNLLNKQNFKDHLNILNNNK-
Q8IDF8_PLAF7          KEQKKKEKKLKKELEKKKKSNRGHQLDFDENEIHFNKDILKLLNKQKFEDHLKILNNDQ-
B9QL21_TOXGV          RQAQKQKQLEMRKKLTRGAFFDEAEGPLDPDLFQFDRKAIDLLEKKEAKMVDAELLLTG-
                      :     .                                                     

SPB1_YEAST            -----KGKKRMIFTDDELAKDNDIYIDENIMIK-DKDSAADADDLESELNAMYSDYKTRR
SPB1_CANAL            -----KGKKKMIFNDEELAKDNEIHIDEEEINDNDKDSADELDELENQLDDMYHQYQARK
SPB1_YARLI            -----KGKR------SHVSETGDEHVTLEEAERVDYGSDDEANGLEDELESMYTEYLENK
SPB1_EMENI            -----SGKELAVIESE---------SEESESETEYDDSDDEGDRLERELDSLYEQYQERK
SPB1_ASPFU            -----SGK-LAEIESD---------SEDDQTESDYDESDDEGDRLERELDSLYEQYQERR
A0A0E1RUQ7_COCIM      -----SGK-MVDVQSE---------EDEESSATSDVASDDEEDRLERELDAMYEKYQEDR
Q0UCU2_PHANO          -----KGKMATIVERE---------RADESSEEEQ-ETDDEGDYLERDLDEMYGEYVEQR
I1RTE9_GIBZE          -----RGKM-IVPSQAPQKQLD---SGLGSSGETDDESDPEEDRLERELDSMYDHYKERK
C7YTG2_NECH7          -----RGKMAIVAGSTAKKDQD---SGLGSSAETD-ESDAEEDRLERELDSMYDEFRERK
SPB1_NEUCR            -----KGKMAVIKETE--KPKD---YDFGSDGETD-ESDEEADRLEEELDNLYDQYRERK
SPB1_SCHPO            -----NGTLPVTESVD---------EEVSTDNEVEYDSDDERDRLEADLDSMYSDYTKRK
SPB1_CRYNJ            LATLVDDGEGMDLASESEEEEDEDEE-DDEVLDSDEERERKTAALEGELDGLYDSYVERK
A8N1R5_COPC7          ---FITDADGDILVDDDEGLAGPDDDGDDEVLDTEDERERKVAQLEADIDNLYDAYQERL
SPB1_USTMA            -------VSKKALIQQADVSDDESETIVSSQHTDDDDPETRARRLDAEMDALYDEFKQKQ
E3KB01_PUCGT          -------MEDIDGAEGSESPLDTDPEEDEDEEELSED-EAKLQTLEEGLDLAYDEYQENQ
SPB1_DICDI            -SDISSDEFDSDDSDDD--DDDDNNGDSKLIDDDEYLEQQLDEQYKLYQQRIRKKAAKLD
F0ZY00_DICPU          -GDSDSDDSDSDDSEVE--PDR-RTQEEAEMDNDEFMEQQLEDQYKQYILRVSNRAKEFD
Q0DFV9_ORYSJ          -AELNVEDA-QGDSENE--DIQTREYSDEEMD-SDEEQQRYDAQLEEMLDEAYERYVTKK
I1PY11_ORYGL          -AELNVEDA-QGDSENE--DIQTREYSDEEMD-SDEEQQRYDAQLEEMLDEAYERYVTKK
C5YVX0_SORBI          -AELNVEDE-IGDSENE--DTQALEDSDEEID-SDEEQQRYDAQLEEMLDEAYERFVTKK
I1HGA5_BRADI          -TELNVEDS-IGDSEDE--ETQTHEDSDEEMD-SDEEQQRYDAQLEEMLDEAYERFVTKK
I1LJC4_SOYBN          -TEYEGDEGELEDSENEETHES-PEHSSGDLEDSDEERKRYNEQMEDLMDKAYERFVIRK
I1LQ27_SOYBN          -TEYEGDEGEVEDSENEETHEGRPEHSSSDLEDSDEERKRYNEQMEDLMDQAYERFVIRK
F6I0L2_VITVI          -TEYDEGDG-VVDSEDERTREETQEHSASDMD-SDEERRRYDEQMEEMLDQVYEQFVARR
B9HRL4_POPTR          -ADYDHENGGLRDGENEETDEENQEHSPSDVD-SDEERRRFDEQMEEILDQAYERFVTKR
F4JTD2_ARATH          -DEDD--NGNAVDSENEDHGEGASDDSKDSDRDSDEERQKYTEQMEEIFEQAYERYMVKK
A9RQI9_PHYPA          -EDDEDDNDSVDEMLND---GPQQAEDDSDFD-PEQDRQRYDQELDQYFERAYSKYCSTT
H3GC19_PHYRM          ---ADSSSDEELQFETDDE-DEDAGLEDSDAEYDELLEASMEKAYEQFLTRRGDDVKTRK
D0MRD5_PHYIT          ---ADSSSDEELQFETSDEEDEDAGLEDSDAEYDELLEASMEKAYEQFLTRRGDDVKTRK
A0EER5_PARTE          DKQEEKLKK--EKLEFNNQKQLDKNLELIYENKKQKKENALERIRNKKQALESE-QEEVD
Q23MN4_TETTS          DEDNKTKEKIPNKISFKNSKELEQNLEAMYEQKQLRQQISKKKKANKDEAQMDDSKIQVQ
SPB1_HUMAN            ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE-DDGDDTSLDSDLDPEEL
H2QDN5_PANTR          ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE-DDGDDTSLDSDLDPEEL
G3QV89_GORGO          ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE-DDGDDISLDSDLDPEEL
SPB1_PONAB            ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE-DDGDDTSLDSDLDPEEL
G1QW13_NOMLE          ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE-DDGDDTSLDSGLDPEEL
F7DBK9_MACMU          ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE-DDGDDTSADSDLDPEEL
F7HIR2_CALJA          ------LLEEVTQGDMSAADTFLSNLP-----RDDICVSDVE-DDSDDTSLDSDLDPEEL
H0XRX1_OTOGA          ------LLEEVTKGDMSAADTFLSDLP-----RDDIYVSDVE-DD-DDTSLDSDLEPEEL
I3NA29_ICTTR          ------LLEEVTQGDMSAADTFLADLP-----RDDIYVSDAE-DNDDDASLDSDLDSEEL
G1PIT9_MYOLU          ------LLEEVTQGDMSAADMFLSDLP-----RDDIYVSDGE--DDDDTSLDSDLDPEEL
F6SYP9_HORSE          ------LLEKVTAGDMSAADTFLTDLP-----RDDIYVSDVE--DDS-ASLDSDLDPEEL
F1RSJ8_PIG            ------LLEEVTQGDMSAADTFLSDLP-----SDDIYISDAEEDDDDSASLDSDLDPEDL
E2RHC4_CANLF          ------LLEEVTQGDMSAADTFLSDLP-----RDDIYVSDVE---DDDTSLDSDLDPEEL
G1SLJ8_RABIT          ------LLEEVTQGDMSTADTFLSDLP-----RDDIYV---------YASLDSDLDPEEL
SPB1_MOUSE            ------LLEEVTQGDMNAADTFLSDLP-----RDDIYVSDAE--DDDDTSLESDLDPEEL
SPB1_RAT              ------LLEEVTQGDMNAADTFLSDLP-----RDDIYVSDAE--DDDDTSLESDLDPEEL
H0VJ21_CAVPO          ------LLEEVTQGDMNAADRLLSDLP-----RDDIYVSDAE--EDNGSSLDSDLDPEEL
F1MY97_BOVIN          ------LLEEVTQGDMSAADAFLSDLP-----RDDIYVSDGE--DDDDASLGSDLDPEEL
F6UUX8_MONDO          ------LLQEVAQGNMGAADKFLLEEP-----ESDIYLSDEEGEVADDESLASDLDPEEL
G3WIR8_SARHA          ------LLQEVAQGNMGAADKFLLEEP-----ESDIYLSDEENEDADDESLASDLDPEEL
SPB1_CHICK            ------LLNEVARGDMASADALLEMRPG----DDDICVSDAD--DEDDVSLASDLDPEEL
H3DDM8_TETNG          ------VVADISKGDMQAADNLVD--E-----EDDLHISEEEDDEADKMSLASDLDEEDL
H2V6Z5_TAKRU          ------LVADISKGDMQAADNLVD--E-----EDDMHISEEEDEEADKMSLASDLDEEDL
I3IZN4_ORENI          ------VLADISKGDMQTADTLVD--E-----DDDFHLSDEDGDDADKMSLASDLDDEDL
A0A0R4IQB8_DANRE      ------GLHQLAQGDMSAADALLEDDE-----QEDVHLSDEE-QEDERMSLASDLDSDDL
H2XWZ3_CIOIN          ------KMGTV----MENVEEFELEEGS----DEEGSGSSEE------------------
Q7QD87_ANOGA          ---QLESILDQAPDFVVE-DKSDDE----G--AEDGEYVRYDRETKGDLFEDDK-LLSTQ
W5J3R9_ANODA          ---ELERMLDQPPDLPSDGDVSDEEK---V--RRKAKYVRYNRETKGDLYEDDE-LMG-Q
Q17ME6_AEDAE          ---QMDDLLDADPDVLMEQDFHDDDDDGLP--KKKQKFVKYDKETKGDLYEDEK-VLAQK
Q9VXK5_DROME          ---ELDELLDVQPDFAVDESQPEETK---L--PKYKYFDKDEGNINDDLNYDDD-NDEEQ
A0A088A7G6_APIME      ---QLENIMDQDPNILAESDIDSDTEQKKT--KRIIYKKDKGHLDSSGLYYK---SEDSE
A0A158NJW7_ATTCE      ---QLEQVTDQIPDILAESDVDSDEE-VKP--KTIYYEKDIGHLDSKNLYYK---SEESE
E0VIT4_PEDHC          ---ELDKVLDQKPEILPESD-HSDDEQIKP--KKIKYSKENSYLDNSGLYYKKK-GEDDD
E9G6A2_DAPPU          NQTELNQIADQEADELAEEPREKPAP--FP--KKAKYDKETFQLDSKGRYRREEDSDEEL
B7P3V3_IXOSC          ---QLSKVEEADPSVLDPVQPLEEDD-------DVCDSKRKLASYSKDRVNEDWYAEDDV
A0A1X7UGH0_AMPQE      ------QLEEVEGEDIDGDALETDDEE--------TASAQRPLLVEEDYNIREDSSNEEE
G4VQU5_SCHMA          ---SNKLLGDTSNTGVDDLAREQIDAALKAKRKRLADERCSAVEGKKRVHFERRSGNQSD
Q9N5N9_CAEEL          ------ELAEITKD-TQAPDFDMMED---------------------------GDSDEEE
A8Y2C8_CAEBR          ------ELAEITKE-TQAPDFENVEGKGRRKSSLKIPEIPAENLAKIPISCTFSDSDDEE
A0A2H2IUP1_CAEJA      ------ELAEVTKENTEAPDYTLDDD--------------------------------EE
C4M6R5_ENTHI          ------SQQDLDNFFNMTNPVELEEEEEQRKKEEEENEKRAEQERLEQMTYDQRLDEQFE
E9ADH8_LEIMA          DHFTVEQLGLIPEKELAHIMDKTWIEPEDRGNDPLNPVMSVNLAAQDDWDLG-DKKDGDE
A4I305_LEIIN          DHFTVEQLGLIPEKELAHIMDKTWTEPEDRGNDPLNPVMSVNLASQDDWDLG-DKKDGDE
A4HFX5_LEIBR          DHFTVEQLGLIPEKELAHIMDTTWTGPEDCGNDPLNPVMSVNLAAQDDWDLG-EKENSDG
Q586Q7_TRYB2          EGFTVGKLAAVDEADVANILDKHWEEPDERLNDPLNPVMNANLNLEKDWDVGSDEKEGGD
K2MLU3_TRYCR          EGFTVEKLATVDEARLAKMFDKHVEELDERPNDPLNPVMNANLNAEKDWDLG-QESDGNS
Q4U8L6_THEAN          SESEETDIESKETDPESE-ETDVESQLPADIESE--DTVIDSQLTDIESDIATEIESEDT
Q4N1B5_THEPA          SNVESPAHSDRGSDLQSDLQSDVQSDIGSDVQSDIGSDVQSDIGSDVQSDIGSDAQSDTE
B3L783_PLAKH          ---NNDRLEINQENDSSSEKEDNEELNDIN--ESPMDRIEYLVNLDYEKQKMKEKKMNEE
A5K2F1_PLAVS          ---HNDRLEINQENDSSSEKEDNAQPNDAGG-ESQMDRIEYLVNLDYERQKMKEKKMNEE
Q4Z2U4_PLABA          ---NNNNLHISEDDFSASDEENRENFEDQNNDNDELERLEYLVDLDYKQQKIKENKKKNE
Q8IDF8_PLAF7          ---KDD-LEIDHYEDTSSETEKLEHLNQLK--NSDLDKLEYLVDLDYEKQKMKEKKLNEE
B9QL21_TOXGV          -GEDDDGNRRGRHADGGEGEAVVAGSESEAEEEGSLEELDDVDRMEVELTLAHRLKKQRE
                                                                                  

SPB1_YEAST            SERDAKFRAKQARGGDNEEE-----WTGFNEGSLEKK----------------EEEGKDY
SPB1_CANAL            AERDANYRAKQARGDADDEA-----WNGIEED--NDD----------------VESGKDY
SPB1_YARLI            AARTAKSVVQRKKANVETEE-----WFGISDK--KDG----------------DESDGEM
SPB1_EMENI            EDKDSKLRAKKARKDYEADE-----WEGFSDSDK--------------------------
SPB1_ASPFU            EDRDSKVRAKKARKDYEAEE-----WDGFSDSDK--------------------------
A0A0E1RUQ7_COCIM      EERDSKLRAKKARKGLETEE-----WEGFSDSDK--------------------------
Q0UCU2_PHANO          SARDAKYRAKRAKNEGDDGE-----WNGFSDDGKEAS----------------SDEELVQ
I1RTE9_GIBZE          SEIDAKYRAKKARKEHGDDE-----WEGLSGEEADE-----------------KNDSSDL
C7YTG2_NECH7          SEADAKYRAKKARKEHGDDE-----WEGVSADEAQEE----------------QDDSSEL
SPB1_NEUCR            AAADAKYRAKKARKENGDDE-----WEGVSGDEEKGS----------------DDDDDEE
SPB1_SCHPO            AESDVKYRVKKARGDLDDEE-----WNGIDNGTES-------------------------
SPB1_CRYNJ            KERDAKWKVKQDRLKDKNFD----AWHGIQEKSDEEG----------------SDDDDGQ
A8N1R5_COPC7          RERDLKFKAKEARRKNAERE----EWNGIAEK----G----------------SDDED-S
SPB1_USTMA            SERDAKFRAKQARLQDAKND----SWHGIKDDEENDE----------------DDDEANL
E3KB01_PUCGT          LRKDAKRKAREEARRSRHNEDQESEWAGCNDQDDQVD----------------EEDDEIG
SPB1_DICDI            DVKVKKDKIGQDG-YNEDDE------EFVEE-----------------------QEESNP
F0ZY00_DICPU          -VKVKKDKLSQDAEFDDQDD------DEMEQ-----------------------EEEDHP
Q0DFV9_ORYSJ          GGEVKQERKRAKRVNTDADE------ELLEG----------------------GEDDGDD
I1PY11_ORYGL          GGEVKQERKRAKRVNTDADE------ELLEG----------------------GEDDGDD
C5YVX0_SORBI          GGEIKQERKRAKRINPDADA------DLLEG----------------------GEDDGD-
I1HGA5_BRADI          GGEVKQERKRAKRINTDADA------ELLEG----------------------GEDDGDD
I1LJC4_SOYBN          EGSAKQ-RKRIKKSYDAKD-------QLLEG-----------------------GEDDDI
I1LQ27_SOYBN          EGSAKQ-RKRIKKSYDAKA-------QLLEG-----------------------GEDDDI
F6I0L2_VITVI          EGSTKQ-RKRARKKHSEDD-------LLELGFSLLAM----------------QDGDDDI
B9HRL4_POPTR          EGSTKQ-RKRAKQAYAE---------QLLEG-----------------------DGDNDI
F4JTD2_ARATH          EGSAKQ-RKRARQAHAE---------KLEEG------------------------DGDEE
A9RQI9_PHYPA          DGSTKR-RRRAKLGEAG---------DLWED----------------------NEVTGQD
H3GC19_PHYRM          AVKRTKIAKRALAGEALVQDSEMFDGDMQKYQKMINP----------------DESSDDS
D0MRD5_PHYIT          AVKRTKVAKRALAGEALVQDSEMFDGDMKQYQKMINP----------------DESSDES
A0EER5_PARTE          ADELACKPIKRVKKQEDHLKVSDLKSKFFDKEGFQK-----------------LKEQLKT
Q23MN4_TETTS          SLNENKFKNPHLKENEEMLESGIKRRKWFDKGVFNDD----------------FSDDSSM
SPB1_HUMAN            AGVRGHQGLRDQKRMRL------TEVQDDKEEEEEE--------------------NPLL
H2QDN5_PANTR          AGVRGHQGLRDQKRMRL------TEVQDDKEEEEEE--------------------NPLL
G3QV89_GORGO          AGVRGHQGLRDQKRMRL------TEVQDDKEEEEEE--------------------NPLL
SPB1_PONAB            AGVRGHQGLRDQKRVRL------TEVQDDKEEEEEEE-------------------NPLL
G1QW13_NOMLE          AGVRGHQGLRDQKRVQL------TEVEDDKEEEEE---------------------NPLL
F7DBK9_MACMU          AGVRGHQDLRDQKRVRF------TEVEDDKEEEEEE--------------------NPLL
F7HIR2_CALJA          AGVREHRCLRDRKCVRF------AEAEDDQEEENE---------------------NPLL
H0XRX1_OTOGA          AGVRGHQGLKDQRRVQY------TEVDDKEEEEEE---------------------NPLL
I3NA29_ICTTR          AGVSRHPVLKDQKSVRF------TQVDKEEEVEEE---------------------NPLL
G1PIT9_MYOLU          AGVRDPQSLKDQKCVRF------AKAEDDKGEEDEEE-------------------NPLL
F6SYP9_HORSE          AGVGRPQRLRDQKRVQF------AKVEDDEKEEEEEE-------------------NPLL
F1RSJ8_PIG            AGVREPQGLKDQKRVRL------AEADDEK--EEEGE-------------------NPLL
E2RHC4_CANLF          AGVGGSRHLKDQKRVRF------GDDDDKEEEEEE---------------------NPLL
G1SLJ8_RABIT          AGVRGPPGLKEQKRVQF------AEVEDDKEEEGE---------------------NPLL
SPB1_MOUSE            AGVRTHSDLKEQKYLRF------TQVDDNKEEEGE---------------------NPLL
SPB1_RAT              AGVRTHSDQKEQKSLQF------AQVDDSKEEEGE---------------------NPLL
H0VJ21_CAVPO          AGVGGHQSLKDQKCVRF------AQLED----------------------------NPLL
F1MY97_BOVIN          AGVKEPQSLKDRKWNRK------NQSKNLTTKLLR---------------------DSSF
F6UUX8_MONDO          AGVKGYKAPPSRKRVKF------AEQQQQEEEEEE---------------------NPLL
G3WIR8_SARHA          EGVKGYGAP-SRKRVKF------AEEQSQEEEEQD---------------------NPLL
SPB1_CHICK            VEIEARQRRLERERREQGVKRVKPKVEEEEEEEEEEE-------------------NPLL
H3DDM8_TETNG          EEVQRREKELEKKT-LKKKV--HFTEEKDKEEDEEPE-------------------SGLL
H2V6Z5_TAKRU          QEVLQREKELEKETSKKKKV--QFTEEEGKEEDEEPE-------------------SGLL
I3IZN4_ORENI          EEVERRQKELEKKA-PKKKV--KFTNQEEEEEDEEQD-------------------GGLV
A0A0R4IQB8_DANRE      QEIQQKEEQMLKNK-PKKKK--KVSFEQQDDGDEDNK-------------------NELL
H2XWZ3_CIOIN          ------------------------EEEEEEDEGDNEG-------------------NPLI
Q7QD87_ANOGA          RADSDSEIDSDFDEKGLAMESDDE-ELSFE-EDEDM-----------KDPSDDEDRNPLI
W5J3R9_ANODA          GSASESEPDSDFDKKGLALNSDDEGELSFE-EDEDR-----------VDPSDDEDRNPLI
Q17ME6_AEDAE          SDDEDS--DADLDREGLGLDDTEELQFENDDEAEED-----------VDSDNPDAQNPLI
Q9VXK5_DROME          SEASDDE-DQINDKQGLGLSDDDN-----DEGNAKG-----------KNKRKKRSENPLI
A0A088A7G6_APIME      PDDSDDVSDNDSDSNKSDLGLN-ESDDEN-IKNIKK-----------KNNTEEDLENPLL
A0A158NJW7_ATTCE      ESDTDASDD---ESEKSGLGLD-ESEDDT-TNKYQK-----------KQQFTDLESNPLL
E0VIT4_PEDHC          DDDNDGEEEEMSIDSDEGLGLQSESDDDDDDDGGQK-----------KKKGIKKNENPLL
E9G6A2_DAPPU          IFDSDDEYESDVPQDSLGLDNATDESDGESKKQPKKVRFTEAIKAATKAVAVDERKHPLL
B7P3V3_IXOSC          SSETNENADSDDEEHEELLEFESDKEESGDEEENLD---------------DEDEENPLL
A0A1X7UGH0_AMPQE      ENEEGEIEYEESDDDDN------DEDMELDNEDKS---------------------NPLV
G4VQU5_SCHMA          EDLSDNEPFGEIYAHNERDDLYLSSEESSEGESGKEN---------------GEDRNSTL
Q9N5N9_CAEEL          GLGEGEWETHGEE-----------GENSDEDENE-----------------------LIH
A8Y2C8_CAEBR          GLGDGEWETHEQEVG---------GEDSDEDENE-----------------------LIH
A0A2H2IUP1_CAEJA      GLGEGEWETLEGEEVDE-------REDSDEDENE-----------------------LIH
C4M6R5_ENTHI          REYKEFLERRGKVKVLAKVGEMKRSVMVQSSLNDGD----------------------II
E9ADH8_LEIMA          SEAEGDADGVLHSTQLVEGEEHFMDVDNYGNYVPAQRSTRVTLYEAGLEGYEDSNDAEAA
A4I305_LEIIN          SEAEGDDDGVPHSAQLVEGEEHFMDVDNYGNYVPAQRSTRVTLYEAGLEGYEDSNDAEAA
A4HFX5_LEIBR          SEAEGADDGMPHSKQLVEGEEYFMDVDNYGNYVPAQRSTRVTLYEAGLEGHEDSNDAEAT
Q586Q7_TRYB2          DEQYDGSGRLVRSIQLVEGEEDGVDVDNYGNYIPAKRSARVALYEEGLSKPGAEEDESEG
K2MLU3_TRYCR          DASEGGNG----PLQLVEGEEDGVDVDNYGNYIPAKRSARVALYDAGLGE---EEDDEED
Q4U8L6_THEAN          VVE--SDELEDYE--MKRLMNMEIDLEVRHSIDKINEQ------------------NTKH
Q4N1B5_THEPA          PSDEPSDELDDLEDEMSRLMKMEVDLEVRHSLDKLNAQE-----------------NPKH
B3L783_PLAKH          KSNEKLTRRKRAMDYKNEELMKIQKIMELKNEELMMK----------------RKLHEYL
A5K2F1_PLAVS          KNNEKLTRRKRAMDYKNEELMKIQKIMELKNEELMMK----------------RKLHEYL
Q4Z2U4_PLABA          NKDEKSTRRKRAMDYKNEELMKIQKIMELKNEELMMK----------------KKLNEYL
Q8IDF8_PLAF7          KSNEKLSRRKRAMDFKNEELMKIQKMMELKNEQLLME----------------KKLREYL
B9QL21_TOXGV          AEALAAGPKKKETRREKVTGEWVNELQAFRSAMQRRAG---------------EALAERR
                                                                                  

SPB1_YEAST            IEDNDDEGVEGDSDDDEAIT----------------------------------------
SPB1_CANAL            EMES-----ESDDDDDEHIR----------------------------------------
SPB1_YARLI            SADDVDMATIDDGEDEDD------------------------------------------
SPB1_EMENI            -EGSDD-EEDEAKPNV--------------------------------------------
SPB1_ASPFU            -EDDEESEEDGASQAVVK------------------------------------------
A0A0E1RUQ7_COCIM      -ESDRLTDDDEDAPQAQP------------------------------------------
Q0UCU2_PHANO          DEDSDWSDDEEDGPKGLI------------------------------------------
I1RTE9_GIBZE          EEDDSSDDDDEDAAPSQG------------------------------------------
C7YTG2_NECH7          DEDDDSSDDD-DEGPSSG------------------------------------------
SPB1_NEUCR            LEVDSSDDDSDSEDGESGKK----------------------------------------
SPB1_SCHPO            -DDSQIAETNFATPDKDR------------------------------------------
SPB1_CRYNJ            DDDEEGGWDVIAQKKAKYGEGDSSDSDSD-----AEPETEVPKKIKK----VSFEKPARS
A8N1R5_COPC7          DEDSEGGYDLVQQRKLEDGTSSSDDSDSDE----DEDVVPKSKKMKR----PQKGDESSA
SPB1_USTMA            SDESEGGYDLVQRRKEQEETFDTDDEEDEEDERLEREATQHSKKRKRDLAAPTADSFEMD
E3KB01_PUCGT          SGDD---IEVVRQKRAKLQKGRQENDDDSDSE--GEDVTLQAARIVASRKTQRSTIKPLP
SPB1_DICDI            LLVGNKRKEPDAQAVSSLFFD---------------------------------------
F0ZY00_DICPU          LYVG---KAKPIEKDADMFFD---------------------------------------
Q0DFV9_ORYSJ          VDMDQGSDEEQDQE--TNPLL---------------------------------------
I1PY11_ORYGL          VDMDQGSDEEQDQE--TNPLL---------------------------------------
C5YVX0_SORBI          VEMDQDFDEDQDQE--TNPLL---------------------------------------
I1HGA5_BRADI          VDMDQVSDEDQDQDEDTNPLL---------------------------------------
I1LJC4_SOYBN          VQSKYDSDED-QGDQEANPLM---------------------------------------
I1LQ27_SOYBN          VQSKYDSDED-QGDQEANPLM---------------------------------------
F6I0L2_VITVI          IHSDHDSDNDNQADLEANPLM---------------------------------------
B9HRL4_POPTR          VHSDYDSDKE-TGDHEANPLM---------------------------------------
F4JTD2_ARATH          MKIDYDSDMN-EEKDEANPLV---------------------------------------
A9RQI9_PHYPA          DESDGDDVIENADEDEANPLV---------------------------------------
H3GC19_PHYRM          SDDDDDLNVSLKVPEKSSAAMSRWFSDNK------------------------LFDGIDE
D0MRD5_PHYIT          DDDEDDLNVSLKVPEKSSAAVNRWFSDNK------------------------LFDGIDD
A0EER5_PARTE          QKEDVFDNPLKNQNITQLDKK---------------------------------------
Q23MN4_TETTS          QSEDAGELDVPDDSEIDNDSL---------------------------------------
SPB1_HUMAN            VPLEEKAVLQEE--QANLWFS---------------------------------------
H2QDN5_PANTR          VPLEEKAVLQEE--QANLWFS---------------------------------------
G3QV89_GORGO          VPLEEKAVIQEE--QANLWFS---------------------------------------
SPB1_PONAB            VPLEEKAVLQEE--QANLWFS---------------------------------------
G1QW13_NOMLE          VPLEEKAVLQEE--QANLWFS---------------------------------------
F7DBK9_MACMU          VPLEEKAILQEE--QANLWFS---------------------------------------
F7HIR2_CALJA          VPLEEKAVLQEE--QANLWFS---------------------------------------
H0XRX1_OTOGA          VPLEEKAVLQEE--QATLWFS---------------------------------------
I3NA29_ICTTR          VPLEEKTVLQEE--QANLWFS---------------------------------------
G1PIT9_MYOLU          VPLEEKGVLQEE--QASLWFS---------------------------------------
F6SYP9_HORSE          VPLEEKAVLQEE--QANLWFS---------------------------------------
F1RSJ8_PIG            VPLEEKAVLQEE--QASLWFS---------------------------------------
E2RHC4_CANLF          VPLEEKTVLLEE--QASLWFS---------------------------------------
G1SLJ8_RABIT          VSLEEKTVLQEE--QANLWFS---------------------------------------
SPB1_MOUSE            VPLEEKAVLQEE--QASLWFS---------------------------------------
SPB1_RAT              VPLEEKAVLQEE--QASLWFS---------------------------------------
H0VJ21_CAVPO          IPLEEKTVLQEE--QANLWFS---------------------------------------
F1MY97_BOVIN          EKISHLACYQRE--QASLWFS---------------------------------------
F6UUX8_MONDO          VPLEERTVLQEE--QTNLWFS---------------------------------------
G3WIR8_SARHA          VPLEEKAVLQEE--QTNLWFS---------------------------------------
SPB1_CHICK            VPLEEKSVLQER--QTSLWFG---------------------------------------
H3DDM8_TETNG          VELEGKDEKRER--ETNLWFS---------------------------------------
H2V6Z5_TAKRU          VELEGKDEKKQR--ETNLWFS---------------------------------------
I3IZN4_ORENI          VELEGKDEKMER--QADLWFS---------------------------------------
A0A0R4IQB8_DANRE      VELEGKDERKER--ETSMWFS---------------------------------------
H2XWZ3_CIOIN          HSLEDK-VEDDY--QTKLWFG---------------------------------------
Q7QD87_ANOGA          TDLDYRSKVDKRLHRAQLWYE---------------------------------------
W5J3R9_ANODA          TDLDNRSKTDKQLQRAKMWYE---------------------------------------
Q17ME6_AEDAE          TDLDYRDKEEKRRQKAQLWFE---------------------------------------
Q9VXK5_DROME          KSNDFRDKNTKREQRVQLWYE---------------------------------------
A0A088A7G6_APIME      TDLDHRDKKTKRIHKAELWFE---------------------------------------
A0A158NJW7_ATTCE      TDLDFRDKETKRAHKAALWFE---------------------------------------
E0VIT4_PEDHC          TDLDYRKSKEKKLTKAALWFE---------------------------------------
E9G6A2_DAPPU          TDLEDDDSALKKKKKADKWFM---------------------------------------
B7P3V3_IXOSC          VDAAYGSTKKKRLEMSKLWFE---------------------------------------
A0A1X7UGH0_AMPQE      VSLEDKKKGKSQ--KTVRWFS---------------------------------------
G4VQU5_SCHMA          SSEDESSEIDEDPNITSLSNL---------------------------------------
Q9N5N9_CAEEL          TEKSGMSKMEKRNARTESWFE---------------------------------------
A8Y2C8_CAEBR          TVNSGLSKKEKKNVRTESWFE---------------------------------------
A0A2H2IUP1_CAEJA      TANSGLSKKEKKNVRTESWFE---------------------------------------
C4M6R5_ENTHI          RQADQKPREEVIEEIDDVVHQ---------------------------------------
E9ADH8_LEIMA          DETPVSKKKRAKTEKDAAQLDEAGKSSK----------------------------WERH
A4I305_LEIIN          DETPASKKKRAKAEKDAAQLEEAGKSSK----------------------------WERH
A4HFX5_LEIBR          DETPASKKKRVKAEKDAAQLEEAGKSSK----------------------------WQRH
Q586Q7_TRYB2          EDEGEDDATRHKRERHQTTLDAAGKQSK----------------------------WLRH
K2MLU3_TRYCR          THNEEDAALQKRKARDQQDLEDAGKQSK----------------------------WLRH
Q4U8L6_THEAN          VKLSRKQKAKLEQSNELKNFINK-------------------------------------
Q4N1B5_THEPA          VKLSKKQKHKLEQSNELKQFINK-------------------------------------
B3L783_PLAKH          SDDEDDTDDDDDDEEEG----------------------------ATDEGSDTSKGCPHP
A5K2F1_PLAVS          SDDEETEEDATDDED------------------------------STDEGSDAAKGRPPH
Q4Z2U4_PLABA          SDDEATESNASDSFD-----------------------------------EDNMKG--ND
Q8IDF8_PLAF7          SDEDDDEDDDDDDDDDDDDDDKEQ---------------------EPKQQSDKHGDHQYD
B9QL21_TOXGV          RAEEEEDDEEENEEDAEDASK---------------------------------------
                                                                                  

SPB1_YEAST            ------NLISKLKGQEGDHKLSSKARMIF-NDPIFN--NVEPDLP---------------
SPB1_CANAL            ------LIAEKK----SNGSLSRTARNFFASDSIFN--ELSDDVI---------------
SPB1_YARLI            ----------------GKTARTLNNGNMFFSNPIFD--NLVNAAV---------------
SPB1_EMENI            --------PVVPT----NGALSNNAALFF-DQDIFQ--GLDDVED---------------
SPB1_ASPFU            --------PAPPN----SGTLSSKAAMFF-DQDIFQ--GLGDVDD---------------
A0A0E1RUQ7_COCIM      --------GILRNGQ--ANGLSNKAALFF-DQDLFQ--GLGNEDD---------------
Q0UCU2_PHANO          --------TDLDNEAPSNRPLTKRAERFF-DQDIFK--GIDGLDD---------------
I1RTE9_GIBZE          ------LIRDLD-SSKGANGLSKRATNFF-NQDVFQ--GITGIVP---------------
C7YTG2_NECH7          ------LIRDLD-SSQGANGLSKKATAFF-NQDIFQ--GLTGIVP---------------
SPB1_NEUCR            ------LITDLDGQPEEKDGLSKRAKNFF-SQGIFA--EIPGLLE---------------
SPB1_SCHPO            ------LTTSLLDKGSTKDGLSRKARMFF-DQDIFD--GIEDADA---------------
SPB1_CRYNJ            EKSSG--LMTSL-REPELRAQRSKQAQLWFDQPVFK--EVGDLAA---------------
A8N1R5_COPC7          PKSKKRKLSPGP-GTSTAIPAPSAASSLWFKQDVFA--GVDGLDV---------------
SPB1_USTMA            AKPPKRSLVHSLVSDADVSAQQSREASIWFDNPLFKDLELDEQDA---------------
E3KB01_PUCGT          AKKPK-LLVDFEEETDNTVEAQASAADLWFDQPVFK--AVGGVDG---------------
SPB1_DICDI            -----------NELFGGVEYRNPGDSESEPEQDGDDDQDDENNKP---------------
F0ZY00_DICPU          -----------NDLFGGVEYRTEDDEPSEDEQ----EEEDEDSKP---------------
Q0DFV9_ORYSJ          -----------LSLDA-EKPTKEQMMEQWFSQDVFTEAGTG-------------------
I1PY11_ORYGL          -----------LSLDA-EKPTKEQMMEQWFSQDVFTEAGTG-------------------
C5YVX0_SORBI          -----------LSLDE-QRPTKEQIVKQWYSQDVFTEAVTG-------------------
I1HGA5_BRADI          -----------LSLDT-EKPTKEQIVKQWYSQDVFTEAGAGG------------------
I1LJC4_SOYBN          -----------VPLNDGAELTQEEVMNKWFSQDVFAEAAEEG------------------
I1LQ27_SOYBN          -----------VPLNDEAELTQEEIMNKWFSQDVFAEAAEEG------------------
F6I0L2_VITVI          -----------VPLHGEEMPTQREITDKWFSQDIFAEAAEEG------------------
B9HRL4_POPTR          -----------VPFNDGEVPTEEEITRKWFDQDIFAKAAEDGDL----------------
F4JTD2_ARATH          -----------VPLDDGVVQTKEEISNQWFSQNIFAEAVEEG------------------
A9RQI9_PHYPA          -----------VPLAEAPKLSTDHLSKQWFSQDVFDGVGEGEELS---------------
H3GC19_PHYRM          KEDISLPEMPKTDKEIRHEKRVAALERKERRAKKKLKKEEKEYEL---------------
D0MRD5_PHYIT          KEELSLPEMPKTDKEIRHTKRKAAIERKERREKKKLKKEEKEYEL---------------
A0EER5_PARTE          -------KKEKTDKEQAADKFKNDSDSDELEEKVMDPKQLKNLQK---------------
Q23MN4_TETTS          -------YDE-EDKSKNKGFINPLKKSHLSSRQNGDDDDDEEFNF---------------
SPB1_HUMAN            ---------KGSFAGIED--DADEALEISQAQLLFENRRKGRQQQ---------------
H2QDN5_PANTR          ---------KGSFAGIED--DADEALEISQAQLLFENRRKGRQQQ---------------
G3QV89_GORGO          ---------KGSFAGIED--DADEALEISQAQLLFENRRKGRQQQ---------------
SPB1_PONAB            ---------KGSFAGIED--DADEALEISQAQLLFESQRKGRQQ----------------
G1QW13_NOMLE          ---------KGSFAEIQD--DADEALEISQAQLLFESQRKGRQQ----------------
F7DBK9_MACMU          ---------KGSFVGIED--DADEALEISQAQLLFESRRKGQQQQ---------------
F7HIR2_CALJA          ---------KGSFAGIED--DADEALEISQAQLLFESRRKGQQQ----------------
H0XRX1_OTOGA          ---------KEGFSGIED--HTDEALEISQAQLLYESRRKGQQQQ---------------
I3NA29_ICTTR          ---------KDGFSGIED--DADEALEISQAQLLYESRRKGQQQR---------------
G1PIT9_MYOLU          ---------KDGFSGIED--DADEALEIRQAQLLYESRRKGQSQ----------------
F6SYP9_HORSE          ---------KDGFSGIED--DADEALEISQAQLLYESRRKGQ------------------
F1RSJ8_PIG            ---------KDGFSGIED--DADEALEISQAQLLYESRRKGQQ-----------------
E2RHC4_CANLF          ---------KDGFSGIED--DADEALEISQAQLLYESRRKGQQQ----------------
G1SLJ8_RABIT          ---------KDGFSGIED--DADEALEIGQAQLLNESRRKAQQQ----------------
SPB1_MOUSE            ---------KDGFSGIED--DADEALEISQAQLLYKSRQKEQQP----------------
SPB1_RAT              ---------KDGFSGIDD--DADEALEISQAQLLYKSRQKEQQP----------------
H0VJ21_CAVPO          ---------KDGFSWIDD--DADEALEISQAQLLYKSRQKEQEL----------------
F1MY97_BOVIN          ---------KDGFSGIED--DADEALEISQAQLLFESRRKGQQP----------------
F6UUX8_MONDO          ---------KGGFAGIED--DDDQALEISQAQLLYESHYKEKQK----------------
G3WIR8_SARHA          ---------KGGFAGIED--DEDQALEISQAQLLYESRCKEKQK----------------
SPB1_CHICK            ---------KDAFAGIED--DADEDLELGQSQMLAERQRESQTG----------------
H3DDM8_TETNG          ---------KGIFCEIDL--ENDAENELQQSEWLQNSQKGRG------------------
H2V6Z5_TAKRU          ---------KGIFSEIDL--EKDAENELQQSEWLQNNQRGTGSR----------------
I3IZN4_ORENI          ---------KGIFSEIGL--EGDAESELKQTEWLRTKQSGKG------------------
A0A0R4IQB8_DANRE      ---------KDIFAELDLNDDTDAMNELKQTQILQTG-----------------------
H2XWZ3_CIOIN          ---------KEEFENIAD--DLDELEEIESARKIYENRVE--------------------
Q7QD87_ANOGA          ---------QEAFKKHNLQPNDEEVVDYDLDKMIEAYKKAGVTV----------------
W5J3R9_ANODA          ---------QEAFQKHNLDENDQE-LDYDVDQLIAAYKKSGVKV----------------
Q17ME6_AEDAE          ---------KDTFK--NVLAGEDQAVDYDLDRLTEMYRKSGAKI----------------
Q9VXK5_DROME          ---------KDVLQ--NIQSDDDE-ETYDLNNLAKEFKAKGVAV----------------
A0A088A7G6_APIME      ---------KDIFK--NLEDEKDE--DFELDKMVEEYRKKGGHI----------------
A0A158NJW7_ATTCE      ---------KDVFK--NLENEDDA--DYELDKMIEQYKKKGGHV----------------
E0VIT4_PEDHC          ---------KESLK--NVETEADE--DYDLDLLTQSLKKKGKKV----------------
E9G6A2_DAPPU          ---------KSAFQ--DIDDEEDE--DIELDSMVREHPLQRRGA----------------
B7P3V3_IXOSC          ---------KDVFA--DIDDEKEL---LELEILADESRKNKKEK----------------
A0A1X7UGH0_AMPQE      ---------NPLFEGVLS---GEKDEEEEVAAAMERYKQKGGKI----------------
G4VQU5_SCHMA          ---------ASLKSHSNDRRVKSKRQMILPPGLVLSTSEQDKRNP---------------
Q9N5N9_CAEEL          ---------KEEISGLVS--DEDDDDEMNAIEKHIGKNRSKKTEN---------------
A8Y2C8_CAEBR          ---------KEEIAGLIS--DEDDDDEMNAIEKHIGKKK-KETKK---------------
A0A2H2IUP1_CAEJA      ---------KEEIAGLIS--DEDDDDEMNAIEKHLNKKK----KN---------------
C4M6R5_ENTHI          ---------KGILSSEGKNNKEDLWWSRNGMDDISVQMGILEEVL---------------
E9ADH8_LEIMA          QLNIEKVLNDTFPKPKDHDRAKNKKQQRTLEEERIIMSAPTEMAD---------PDKRKH
A4I305_LEIIN          QLNIEKVLNDTFPKPKDHDRAKNKKRQRTLEEERIIMSVPTEMAD---------PDKRKH
A4HFX5_LEIBR          QLNIEKVLNDTFPKPKDHNRAKNKKRQRFLEEERITMSAPTEMAD---------PDKRKR
Q586Q7_TRYB2          HVNIEKVLRDTFPMPRSDSGNRRKKS-KRLEEDRVEMSAPGPLRD-DTAGSSTSTRKKMR
K2MLU3_TRYCR          HVNIEKVLNQTFPKPRDN--NRRKK--RLLEEDRVELTATSPLHDGDLNGRADATRKRMR
Q4U8L6_THEAN          ------LQYEAQIHHMNQSDHSDTEPDVNYEQGDSNSDQGDSDIETP-------------
Q4N1B5_THEPA          ------LQYEAEVTHTNEQFTDSTQSDEESDADFDNSEPLDGDFD---------------
B3L783_PLAKH          GKRGKGEMKNDEKNAYAEALKQNEHIHKMVDKIIRLRKDVKR----EEEKSNVNRFFDQK
A5K2F1_PLAVS          GKRGKDEMMNDEKNAYAEAIQQNQHIHKMVDKIIRLRKDVKR----EEEKSNVNRFFDQK
Q4Z2U4_PLABA          NVETDQDIQN---NKYEDVLNQNKHIKKIVDKIIMIRKNLKEREPEDESQTGTSRFFDQK
Q8IDF8_PLAF7          NKKSNSDNDVDSLETTQDIFKENKHIKSMVDKIIRLRRSVKN----EEEKSNVNHFFDQN
B9QL21_TOXGV          ---------EVFEDEAPAGLRKATAADRWFGQPIFAGLESPGVQD---------------
                                                                                  

SPB1_YEAST            -VNTVNDGIMSSESVGDISKLNKKRKHEEMHQKQDEADSSDESS---------------S
SPB1_CANAL            -LEEIENKTKGS------NGKMVESIQEQVANDNNENDDGD-ND---------------E
SPB1_YARLI            -AKTEAKPKALD--LLEPGAKDLIELEKAKKRKYAKKNGLEYSD---------------S
SPB1_EMENI            -EEDEAEGTNNMTVANEREEQQEEEEEEQPKSEAAPEKK---------------------
SPB1_ASPFU            -VED------------EDSAIEMQEDDKSAKKGSALEKK---------------------
A0A0E1RUQ7_COCIM      -EEDEEGEEAERKQNPSEQDEETDDDNDSEDYETTDNESK--------------------
Q0UCU2_PHANO          -LEEDDDSGIDVEDAMEVDVKEVPAPIAETALPTRPAKKA--------------------
I1RTE9_GIBZE          -E-EEEESAEDSADEEINRDAAAVVAQQSKARKVETPAAKPVEI---------------N
C7YTG2_NECH7          -EPEEEVNAEDSADEEMDRAAEAAAAQQAKNRKTKTLAKQ-------------------E
SPB1_NEUCR            -EPESEE--EEAQEAELVEAVEDLKVTKKEKKEAKETKAK--------------------
SPB1_SCHPO            -DVEIMS---------MNRAAIKKREAELASQNNDDGSKG--------------------
SPB1_CRYNJ            -LDGDDEEEEEEDESEEEESDDEDVDMEDASESSSTLEGD--------------------
A8N1R5_COPC7          -SDEEDSAMEDGSEDGDSGSDGDAMSVDEESWDSESGSDD--------------------
SPB1_USTMA            -QEALEDDQDDEDAWEEEQDDEDDAEESDSEVEGEQEVED--------------------
E3KB01_PUCGT          -LIPDDSEGSDDGQDESRANDESICFDDDEDRNYLEAPGT--------------------
SPB1_DICDI            -IDISKLKKQKPQAAQPITKKQKTTNSAEFGKQKSKYQKNPTLD---------------D
F0ZY00_DICPU          -IDISKLKLQKAQPVATKSKKQKTTKGGSE-KGGKKHQKMPSGE---------------E
Q0DFV9_ORYSJ          -------VVEQSDSEDEREQ----LTRI-------AKKKADSGK---------------K
I1PY11_ORYGL          -------VVEQSDSEDEREQ----LTRI-------AKKKADSGK---------------K
C5YVX0_SORBI          -------VTEQSDTEDERES----LQR---------NKKMDTGK---------------K
I1HGA5_BRADI          -------LTEQSDSENEREKPRKNLKKMDSGKEMRAKAQMDSGK---------------K
I1LJC4_SOYBN          -------DFEKDESKDEMDIDEP-KEKISIAKKVKENKTAAPAV---------------V
I1LQ27_SOYBN          -------DFKKDESKDEMDIDEP-KEKISIAKKVKENKTAAPAV---------------A
F6I0L2_VITVI          -------DLGKHESEDEMEVDRQ-EKTLSIPKKAKENKARKPSE---------------I
B9HRL4_POPTR          -ETAEARNLEKYESEDEMLVDGQ-EKEIATPKKSAKNAAGS-------------------
F4JTD2_ARATH          -------DLGKDDSEDEIANKKK-SKNLSKPDKSKQKASKASVL---------------S
A9RQI9_PHYPA          -DDEEAIAKMRKKRKAETDAEVDADGDEDMGVGASELPAANHSA---------------N
H3GC19_PHYRM          -EFGTEFDVAAPADSDDEAAMAAEAAEESDDETSAEKKALIRSG---------------M
D0MRD5_PHYIT          -EFGTEFDVAAPANSDDEAAMAAEAQEESDDEATAEKKALIRSG---------------M
A0EER5_PARTE          -QIQDDLNQLDDNKDVDLLRRVDKKEMEYQKKLNAKITQDPLPG---------------E
Q23MN4_TETTS          -GSEDEQDDDQNNGYIDMYDDTIYIGKRPKSAHDDIDPNEKVPG---------------E
SPB1_HUMAN            -QKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSGTEAATGLE---------------G
H2QDN5_PANTR          -QKQQLPQTPPSCLKTEIMSPLYQDEAPKETEASSGTEAATGLE---------------G
G3QV89_GORGO          -QKQQLPQTPPSCLKTETMSPVYQDEAPKGTEASLGTEAATGLE---------------G
SPB1_PONAB            ----QLPQTLPSCLKTEIMSPLYQDEAPKGTEASSGTEAATGLK---------------G
G1QW13_NOMLE          ----QPPQTPPSCLKTEIMSPLYQDEAPKGTEASSGTEAATGLE---------------G
F7DBK9_MACMU          -P-QQLPQTLPSCLKTEIMSPLCRDEAPKGTEASSGTEAATGPE---------------G
F7HIR2_CALJA          ----PQPLTPPSSLKTERMSPLCQDETPKGTEASSGTEAATSPE---------------G
H0XRX1_OTOGA          -Q-QPLPSPPPSSLRTEKKSPHCDNEASKGTEASSGTEAATGPG---------------G
I3NA29_ICTTR          ----NQQLQPPS---PSRKSPQCQDEIPKRIEAPSGTKSATHPG---------------G
G1PIT9_MYOLU          -----LPPPPSSSLKTERKPSQCPDEALKETEAPPGTEAATGPG---------------G
F6SYP9_HORSE          -------PPSPSSLKTERKPPQCRDEAAKGAEAPSGTEAATGPG---------------E
F1RSJ8_PIG            ------PLPAPSSVKTERKPPPCQGEAPEGAGAPSGTEAATGPG---------------G
E2RHC4_CANLF          ------LPPPSSSLKSEKKTSHCQDEDPKGAEAPVEAKTVPRTG----------------
G1SLJ8_RABIT          ----PAPPPAPSSLKSQRQS-RCREEASEVRTAPLETDAAPGPG---------------G
SPB1_MOUSE            ----TDPPPPPTNLKTEKKSPQGQNEVPKETEAILGTEAVTDPG---------------G
SPB1_RAT              ----TDPPPPPTNLKTEKKSSQCQNEVPKETEAI------TDTG---------------G
H0VJ21_CAVPO          ----SKSLSP-SSLKTERKFPQNMNETPNEEAPS----STGATA---------------G
F1MY97_BOVIN          ------PPPPPSNEETKSKPPPCQGEAPKEVGAPKGSEVAPGPG---------------E
F6UUX8_MONDO          ------LQLKPMNSRSEELPPQHQAQSTST-GEPATKANATTSA---------------G
G3WIR8_SARHA          ------DQQKPTISRKEKMPFQSQTQFINTEGKLAAEAKAAATS---------------A
SPB1_CHICK            ---------------KTKKKGQKKKVPQESTAAEPQDAADTGAD---------------T
H3DDM8_TETNG          ---------TFLTVKGKKRKAEIVEKKVE--AAPAEEEQAETSQ---------------K
H2V6Z5_TAKRU          --------PVPASRKGKKRKAEKVVEEEEEKAAPAEEGHAEASQ---------------E
I3IZN4_ORENI          -----------KKRKAEEDIEEEEEEQQE--AALPEEEKAGPSL---------------E
A0A0R4IQB8_DANRE      --------------RGKKRKAQQEEEAEP---KKPEQKVATPSQ---------------E
H2XWZ3_CIOIN          ---------------KKKKEVEEKTEVQKKIEAYNSD-----------------------
Q7QD87_ANOGA          --------------LGTEG-ADKGKESEPLGKKARRRSKHDVNK---------------L
W5J3R9_ANODA          --------------LGDD--KDAGGEQLPLGKKARRRARHDVS-----------------
Q17ME6_AEDAE          --------------VGDD------DKDRPLGKKARQRAKHDVAK----------------
Q9VXK5_DROME          --------------LGESTLTPDANEEVVQGKKAKRRARHETAT----------------
A0A088A7G6_APIME      --------------IGEDI-SADSDKENKIKN---HKNIKDDDE---------------N
A0A158NJW7_ATTCE      --------------LGEEK-KMQIKVDEEKKR---KRKISE-------------------
E0VIT4_PEDHC          --------------IGEDK-ENEIPNVKKKGNGLKSESVDEYDS---------------D
E9G6A2_DAPPU          --------------VTTEDFTDDEADEDSDEEVHVSDKVGKKPP---------------P
B7P3V3_IXOSC          --------------LSKKADKKPQREAAKKVTKKVTFADGLDNK---------------E
A0A1X7UGH0_AMPQE      --------------ISKEEEQGSNDEDENDENNVEDLAISPTAV---------------Q
G4VQU5_SCHMA          -LLVDLDDSEEIVKKKRKIDSWFGSDEIQEILAPLKEDENISMV---------------M
Q9N5N9_CAEEL          -YENTVSFDDSKGKKKGKKGGKGGEDDGFNTNDADEQASESES----------------S
A8Y2C8_CAEBR          -YENTVSFDD--GNKKKKKGKNGADDDGFNTKDGEDVEMASDSE---------------S
A0A2H2IUP1_CAEJA      -YENTVSFED---AKKKKKKNADEEDDGFDTKDGEESDKEEGS-----------------
C4M6R5_ENTHI          -K------------KDQAKEEKLKGEVKNEIDDKYEEEVQGEDQ---------------V
E9ADH8_LEIMA          VRTRFENKDNDDD-SDDSVSELSAELSDGDLDDYEINRGREDSR---------------R
A4I305_LEIIN          VRTRFEDKDDDDS-SDDSVSELSAELSDGDLDDYEINRGREDSR---------------R
A4HFX5_LEIBR          VRTRFEDDDNDD--SDASASELSEELSDGDLDDYEINRGREDSR---------------R
Q586Q7_TRYB2          FDARVDDDDDD----MNSVSDLSDGRFSDDRSDLEVNVGRVDSR---------------R
K2MLU3_TRYCR          FDDRAEDDDDDEDDDDQSLSSLSEGRFSDDNRDLDVSEGRMDSR---------------R
Q4U8L6_THEAN          -HRDIKQDDLNGNLDEDLISKRWFDNDIFKLNLHTNHSTKQPKP---------------P
Q4N1B5_THEPA          ----------NSEALDDLVTKRWFDNDIF--TLQTNNQGKYGKP---------------P
B3L783_PLAKH          IFSTIFNEMDGELNDSGIVQEGPKGSGTPKGGDEDEDDNDGDDDDMDADTVDETGDEEKF
A5K2F1_PLAVS          IFSTILNEMDGELDDSAAVQEGPKGRRARKGGDEDEDDDMGGDE--DDDVGDDASDDEKF
Q4Z2U4_PLABA          IFSNIFNQLNND--------------------EEGEDEN----------------SENDI
Q8IDF8_PLAF7          IFSNIFSQLDEEDIDAEFDSHIKNKKNVQKKDDSDKDGSISND------------DNESI
B9QL21_TOXGV          ----ESDAECSPIGRSAGDVASDEQRLSDSEASSGDDEVETEATSDVMRELADEELPAVP
                                                                                  

SPB1_YEAST            DDSDFEIVANDNASEEFDSD---YDSEEEKNQTKKEKHSRDI------------------
SPB1_CANAL            EESDFEIVPNQKSDDDDDDESMNSDDDEVSTTTKSTTHQQKV------------------
SPB1_YARLI            EDEEDDIVMETQKQDD-------SDIEYVHGESDSD-DEPNI------------------
SPB1_EMENI            -----KKVKETANS--KPSEDSSDDEYEDTDEPRKKNGQLDI------------------
SPB1_ASPFU            -----APKEAKKKA--QAPEDFSDSDPEEPDDPRKKNGQLDI------------------
A0A0E1RUQ7_COCIM      MSVDSLPATKKQSG--RSSKPNAEGFEEQKDDPRTKEGKLDI------------------
Q0UCU2_PHANO          SFAPAAADPDSSDDEDKIEEVKRDETQWEQDDMPMKNGKPDI------------------
I1RTE9_GIBZE          DTTVDSDSDMEGNENGFEVVKRTEEDDWDK-DQRRADGRLDI------------------
C7YTG2_NECH7          ETALDSDSEMEDAGDGFEVVKRDEEDDWDQ-EKRKDDGRLDI------------------
SPB1_NEUCR            ---SKKAAEESDDDDDFEVVKNNEDDDWENVEKKKKNGRPDI------------------
SPB1_SCHPO            ------DQSEDSNDHIEVVPVASAHDEDDDWNSDSDNDENNV------------------
SPB1_CRYNJ            ----DDFEIVPQAPEDDGP---EWDVDDEDQDEVKKKVIQDK------------------
A8N1R5_COPC7          ----DDFEIVPQDHSDDDT---MWDVEDDDEDEAKREKIKKH------------------
SPB1_USTMA            ----DDFEVVPQDQEEHAIPDEEWDLNGEDEEAGKQKRIKDH------------------
E3KB01_PUCGT          ----EDSDSEMEADDPTGG---VWDDELPDPDEKNAEIIREK------------------
SPB1_DICDI            KDDQDDDDDKGNSIKGFEEVPVQEEVEYESDSDE--------------------------
F0ZY00_DICPU          SDDEDIVQEMD-----MEEVPMEEDVEYSSDSDE--------------------------
Q0DFV9_ORYSJ          EKSAKAKHLQQDDFEIVPAEPVRTEDDSSSSSDESD-ELDEDL-----------------
I1PY11_ORYGL          EKPAKAKRLQQDDFEIVPAEPVRTEDDSSSSSDESD-ELDEDL-----------------
C5YVX0_SORBI          EKVAKAQRLQQEDFEIVPAEPVRNEEDSSSSSDESD-QSEDDL-----------------
I1HGA5_BRADI          EKLAKAQRSQEDEFEIVRAEPVRTEEDSSSSSDDSDDEPEEDL-----------------
I1LJC4_SOYBN          AHPQPQPSKAADDFEIVPAPDTDSSDDSSSDE-WEE------------------------
I1LQ27_SOYBN          THPQPQPSKAGDDFEIVPAPDTDSSDDSSSDE-WEE------------------------
F6I0L2_VITVI          NPPQIEASKAEEDFEIVPAPSTDSSDDSSSDESDDE------------------------
B9HRL4_POPTR          DRTQPPSSTAENDFEIVPAPATDSSDDSSSDESEDD------------------------
F4JTD2_ARATH          DQSLPNSSKKEDEFEVVPAPATDSDSDSSSED----------------------------
A9RQI9_PHYPA          GAASLAPAVGKGDFEIAPQEGNSSSDSDSDSE----------------------------
H3GC19_PHYRM          GAALKSDQSTSDKYEVVAAGDEPDENALPAMDDRKYDSDHEDY-----------------
D0MRD5_PHYIT          GAALKTDK-DSDKFEVVAAGEEPDENALPIMDDRKYDSDHEEY-----------------
A0EER5_PARTE          DEKVKQFELNLPISDMEKRRRQLKKIAAREEKKAKQASDKDPNH------KELEIVPEKR
Q23MN4_TETTS          LSDDDAYIIQVPKSDMEKRRRAMKRAEKKKLKKEENPQVKD---------DGFEIVPKQ-
SPB1_HUMAN            EEKDG--ISDSDSSTSSE---EEESWEPLRGKKRSRGPKS------DDDGFEIVPIEDPA
H2QDN5_PANTR          EEKDG--ISDSDSSTSSE---EEESWEPLRVKKRSRGPKS------DDDGFEIVPIEDPA
G3QV89_GORGO          EEKDG--ISDSDSSSSSE---EEESWEPLRGKKRSRGPKS------DDDGFEIVPIEDPA
SPB1_PONAB            EEKDG--ISDSDSSSSSE---EEESWEPVRGKKRSRGPKS------DDDGFEIVPIEDPA
G1QW13_NOMLE          EEKDG--VSDSDSSSSSE---EEESWEPLRGKKRSRGPKS------DDDGFEIVPIEDPA
F7DBK9_MACMU          EEEDG--ISDSDSSSSSE---DEESREPLRGKKRSRGPKS------DDNGFEIVPIEDPA
F7HIR2_CALJA          EEKDG--SSDSDSSSSSE---DEESWEPLRGK-RSHGRKS------NDGGFEIVPIEDPV
H0XRX1_OTOGA          EERDG--TSDSGDSSSSE---DEERWEAPRGKKRNRGPKT------DDDGFEIVPIEDPV
I3NA29_ICTTR          EERDG--SSESD-SSSSE---DEESWESSHGKKRSRRSKS------DNDGFEVVPIEDPV
G1PIT9_MYOLU          GEKDD--SSDSDSSSSED---EESSWEPRHGKKRGRGPKS------EDDGFEIVPIEDPV
F6SYP9_HORSE          EKRDG--SSDSDSSSSED---EES-WKPHRSKKRSRRPESQ-----DDDGFEIVPIEDPV
F1RSJ8_PIG            EARDS--SSDSDSSSSED---EDT-WKPR-SQKRRRGPEAG-----DDDGFEIVPIEDPA
E2RHC4_CANLF          REGDD--SSDSDDSSSSD---GERSWEPKHGKKRSHGLKS------DDDGFEIVPIEDPV
G1SLJ8_RABIT          GDDS----SDSDSSSSEDEVSPHHSWEPSRGKKRRRGPKS------DDAGFEVVPIEDPA
SPB1_MOUSE            EERG--NSSDSDSSSSED----EDSWKVSRGVKRGRGSKA------DEDGFEVVPIQDPV
SPB1_RAT              EDR---DSSDSDSSSSED----EDDWKVSRGKKRSRGSKA------DEDGFEVVPIEDPV
H0VJ21_CAVPO          PERVGSDSSDSESSSSED----EESRGPSRGKKRCRGPKS------DDNGFEIVPIENPV
F1MY97_BOVIN          EERDG--SSDSDSSSEDE-----ESWKSQRGKKRGRGPKSE-----DDDGFEVVPIEDPV
F6UUX8_MONDO          ----ETSSSDSDSSS-ED---ERTLSKGPRGKKRGHLMEP-------DDGFVVVPIEDPV
G3WIR8_SARHA          KEEEDDSSSDSDSSSSED---ERKLSKNPQGKKRGRSLEP-------DDGFVVVPIEDPV
SPB1_CHICK            AEAEAEQSSDDDSSSDEE------GPPTPVGRKRGLVEPC---------GFEVVPIEDPV
H3DDM8_TETNG          AADDS--DSDSDDSSDDE------KMKLAGGANGISGEAG------DDEDFKVVPVESIS
H2V6Z5_TAKRU          AADAS--DSDSDDSSDDE------KMKQAKGTNGMPGEAG------DDEDFKVVPVESIS
I3IZN4_ORENI          AGEES--DSDSDDSSDDET--EITRMKQARGAGGVSVEVE------DDNDFQVVPVESTS
A0A0R4IQB8_DANRE      VKEAE--DSDSDDSSDDER--EIAQMKQASAAVGTNGAEE------NDN-IQVIPVEKTN
H2XWZ3_CIOIN          -------SSDSDSDYDVE-----ETLNEAKPVTTTKGKKQ--------------------
Q7QD87_ANOGA          DGDESSDSSSSSE---DEDEPQNAQAVGTMVHKTIEKVGGD-----SEGGFEIVSSEKVR
W5J3R9_ANODA          NGHVSSDDSSSDDETGEDAGAEDALANGKPHHKTVEKVAG------ADGGFEIVSAEATR
Q17ME6_AEDAE          ------EDSSSDD-----SDSEAEVEDQSYEHKTVEKIGG-------KDGFEVVSTE--K
Q9VXK5_DROME          ------KDSSSES-----SESEDDANEDSDGEQPAAGTNA--------------------
A0A088A7G6_APIME      NNDLNNDDSDSDY------DVNKMMKKSKK-NEISDKNNS-----------QTINSKLKK
A0A158NJW7_ATTCE      -----NDDTNSDY------DVEEMMAPNKKLKKIGGKNGF-----------EIVPQETDK
E0VIT4_PEDHC          SDDEEEDENDDDD------DTSDEETEGKRSKKKKKEGKSG----------EGGSTKQDK
E9G6A2_DAPPU          NKFDSDQDSDNDS-----SDDDDSDDSDESNLANGEDLDE-----------GLPAAGGQV
B7P3V3_IXOSC          RPLEEAVDTKAGAG-----KRNKFKQSDSESSSEDEELNK-------------KSRPAPK
A0A1X7UGH0_AMPQE      HSGFD------------------DDSDTSEDEEDVAPKKV--------------------
G4VQU5_SCHMA          SSKKSKSNHSSNTVVKEKKREKKIVNDEVINLQDNCVSSSSEIPIPKVSSEKLEKSLHRI
Q9N5N9_CAEEL          DAEMDEVAKEKLSRFDAQIDLDDDDEEERYEDEGRRAAKR-------KCDKKIIGEDLKP
A8Y2C8_CAEBR          DAEMDDAAKEKLSRFDAQIDLDDD-EEERYEDEGTRATKR-------KADKKIIGEDMKP
A0A2H2IUP1_CAEJA      DAELDEDAKEKMSRFDAQIDLDDD-EEERYVDEGSRAAKR-------KADKEIVGEDLKV
C4M6R5_ENTHI          IKEESDKEENEVVVSEDGESDEYEEAEDSNKDNESSEEDD---------------ELNWG
E9ADH8_LEIMA          KRKLIPDIGKVTTQELIRQQRKQTLCDNKEVRKQNKRNKNNANSGRNSSGKQDTEFEEIP
A4I305_LEIIN          KRKLIPDIGKVTTQELIRQQRKQTLHDNKEVRKQNKRNKNNTNSGKNSSGKQDTEFEEIP
A4HFX5_LEIBR          KRKLVPDIGKATTQELVRQQRKQALQDNKEVRKQNKRNKNNTNSGKHVSGKEDTEFEEIP
Q586Q7_TRYB2          KRAIVPDIGKLTTQELVRQQRKQTLKENAEKRRQ--RGNSGN-------SKD-TEFEEVP
K2MLU3_TRYCR          KRATVPDMGKLTTQELVRQQRKQTLKENAATRKQNVRNKSSA-------RKDETGFEEIP
Q4U8L6_THEAN          KQ-----VEHPKLSKLSEQ-PELPNKSKENMDIKIVPAISNS---------------EKE
Q4N1B5_THEPA          KQDRVENSDKPKLSNPSEERLKLSNPSEENVEMRVVPAISNS---------------ERE
B3L783_PLAKH          NEVDERQLPKIPLPNKLARKERNKQLREKYGNNEVKMKNTTFSIVKTDEDGQSNVGAYFS
A5K2F1_PLAVS          NEVDERQLPNIPLPNKLARKERKKKLRVKYGNNEVKMKNTTFSIVKTDESGQGNVGAYFS
Q4Z2U4_PLABA          KEINAKSLPKIPLPAKLAKKEKNKKLREKYGNNETKIKNASFSIVKTDTNNSENVNEYFS
Q8IDF8_PLAF7          KEIDEHNLPKIPLPDKLAKKEKKKKLKEKYGNNEVKMKNSSFSIVKTDENAQ-NLNNYFS
B9QL21_TOXGV          LSEKQKQKKRRATQAEKERNRQQRRQATDGIVGPDFDDDDDKTGLRGKTRIEEVPPPPAF
                                                                                  

SPB1_YEAST            ----DIATVEAMTLAHQLALGQKNKHDLVDEGFNRYTFRD-TENLPDWFLEDEKEHSKI-
SPB1_CANAL            ----DLATVEAMTLAHQVALGQKNKYDLIDEGINRYSFRD-KDNLPDWFIDDEKKHSKL-
SPB1_YARLI            ----DLVTDQAMTMAHQLATGQTNKHKLQDDGYNRYSFRD-LDGLPQWFQDDENKHNKL-
SPB1_EMENI            ----DIITAEAMALAQQMATGEKKSQDVFDDGFNRYAFRD-VDGLPEWFLDDENKHSKP-
SPB1_ASPFU            ----DIITAEAMALAQQMATGEKKSQDIIDDGFNRYTFRD-VDGLPEWFLDDENKHSKP-
A0A0E1RUQ7_COCIM      ----DIITAEAMALAQQMATGEKTSADVVDDGFNKYAFRD-IDGLPEWFLDDENKHSKP-
Q0UCU2_PHANO          ----DIITAEAMTLAHQMATGKKTKHDLLDDSFNRYSLRD-VDGLPDWFLDDENRHSKM-
I1RTE9_GIBZE          ----DIITAEAMTLAHQLATGQKTTHDAIDDGFNKYAFRD-RDGLPDWFVEDETKHDRL-
C7YTG2_NECH7          ----DIITAEAMTLAHQLATGQKTTHDAIDDGFNKWAFRD-RDGLPEWFIDDESRHDKL-
SPB1_NEUCR            ----DIITAEAMTLAHQLATGEKTSYDVIDDGYTKHAFKD-RDGLPDWFLDDESKHDKP-
SPB1_SCHPO            ----EIVTAEAMTLAQDIASRRKSKADLIDEGYNRWSFQS-KEGLPDWFLDEETTVNKP-
SPB1_CRYNJ            ----GLLTAEAVSLATALVNRKTTADKLIDQGFNRLSAHN-KDGLPTWFLDDESQFYKP-
A8N1R5_COPC7          ----GLATAEAVTLAQQLVNRQKTKTELINDGFNRYSLNA-KDGLPSWFVEEEAKHYKP-
SPB1_USTMA            ----GLATAEAVALAQALVNRQITKEDLMDQGFSKHNFVD-KDGLPTWFLDDEQKHYKA-
E3KB01_PUCGT          ----GLLTPQAIQLALDLVNRKKTKDQLVDSGFKRDAFFDDKNELPTWFLDDEMRHFRE-
SPB1_DICDI            ----DIDDKIKTKALGEFLIRKKSRQDLIDDSFNKYAFNDT--GLPNWFTDDENRHNKA-
F0ZY00_DICPU          ----EIDDKIKTKALGEFLLRKKSRNDLVDDSFHRFAFNDNRDGMPQWFIDDENRHHKP-
Q0DFV9_ORYSJ          ----DDDTKAEVLAYARKMLRKKQREQILDDAYNKYMFDDE--GLPKWFAEDEKRHNQP-
I1PY11_ORYGL          ----DDDTKAEVLAYAKKMLRKKQREQILDDAYNKYMFDDE--GLPKWFAEDEKRHNQP-
C5YVX0_SORBI          ----DDYRKAEVLAYAKKMLRKKQREQILDDAYNKHMFDDE--GLPNWFVEDEKRHRQP-
I1HGA5_BRADI          ----DDDTKAEVLAYAHKMLRKKQREQILDDAYNKYMFDDV--GLPKWFVEDEKRHTQP-
I1LJC4_SOYBN          ----DTEAKAEILAYAKKMMRKKQREQMLDDAYNKYMFDDE--GLPKWFLDEERRHRQP-
I1LQ27_SOYBN          ----DIEAKAEILAYAKKMMRKKQREHLLDDAYNKYMFDDE--GLPKWFLDEERRHRQP-
F6I0L2_VITVI          ----DIHAKAEILACAKKMLRKKERERILDDAYNKYMFHDK--GLPQWFADEEARHCQT-
B9HRL4_POPTR          ----DVDSKAEILACAKKMLRKKRREQMLDDSYNKYMFDDE--GLPGWFVEEEKRHCQP-
F4JTD2_ARATH          ----DVHTKAEILACAKKMLRKKQREQMLDDAYNKHMFVDE--GLPKWFVDDEKQHRQP-
A9RQI9_PHYPA          ----DDNGKAEILAYAKKMLKKKNRESILDDAYNRYTFNDE--DMPRWFADDEKKHNRP-
H3GC19_PHYRM          ----DAEDRAKTLALASMMVQKSKAKDLIDASYNRYAWND-SEAIPDWFADDEEKHYRP-
D0MRD5_PHYIT          ----DAEDRAKTLALASMMIHKSKAKDMIDASYNRYAWND-SEALPDWFADDEDKHYRP-
A0EER5_PARTE          IEDYDIDQLASNLALAKKMMRKKTREQIIENSFGRDKWED-QD-LPQWFVDDEERHVFK-
Q23MN4_TETTS          -EDYDIDNLAETLALAKKMQRKRAREDIIDSTYSRYAFED-QDNLPTWFIEDEKQHNFK-
SPB1_HUMAN            KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIR-
H2QDN5_PANTR          KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIR-
G3QV89_GORGO          KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIR-
SPB1_PONAB            KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIR-
G1QW13_NOMLE          KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGQLPEWFVQEEKQHRIR-
F7DBK9_MACMU          KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIR-
F7HIR2_CALJA          KH--RILDPEGLALGAVIASSKKAKRELIDNSFNRYTFNEDEGELPEWFVQEEKQHRIR-
H0XRX1_OTOGA          KH--QILDAEGLALGAVIASSKKAKRDLIDNSFNRYSFNEEEGELPEWFVQEEKQHRIR-
I3NA29_ICTTR          KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEEELPEWFVQEEKQHRIR-
G1PIT9_MYOLU          KH--RILDPEGLALGAIIASSKKAKRDLIDNSFSRYTFNEDEGELPEWFVQEEKQHRIR-
F6SYP9_HORSE          KH--RILDPEGLALGAIIASSKKAKRDLIDNSFNRYAFNEDEGELPEWFVQEEKQHRIR-
F1RSJ8_PIG            RH--RILDPEGLALGAIIASSKKAKRDLIDDSFSRYTFNEDEGELPEWFVQEEKQHRIR-
E2RHC4_CANLF          KH--QILDPEGLALGAIIASSKKAKRDLIDDSFSRYTFNEEEGELPEWFVQEEKQHRIR-
G1SLJ8_RABIT          KR--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEEELPEWFVQEEKQHRIR-
SPB1_MOUSE            KY--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYAFNEEEGELPEWFAQEEKQHRIR-
SPB1_RAT              KY--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYAFNEEEEELPEWFVQEEKQHRIR-
H0VJ21_CAVPO          KH--RILDPEGLALGAVIASSKKAKRDLIDNSFNRYAFNEDEGELPDWFVQEEKQHRIR-
F1MY97_BOVIN          KH--RILDPEGLALGALIASSKKAKRDLIDDSFSRYTFNEDEGELPDWFVQEEKQHRIR-
F6UUX8_MONDO          KR--RILDPEGLALGAMIASSRKARRDLIDDSFSRYTYNEEEEDLPEWFVQEEKQYRIR-
G3WIR8_SARHA          KR--QILDPEGLALGAMIASSRKARRDLVDDSFSRYTYNEEEGDLPEWFVQEEKQHRIR-
SPB1_CHICK            KKA-RVLDAEGLALGSVIATSKKAKRDLIDDSFNRYSFNEEEGELPEWFTEEEKQHRRK-
H3DDM8_TETNG          KKM-RILDAEGLALGSQIATSKKRARDLMDGSFHRFSSSEQPWEVPEWFLQDEQKHRKK-
H2V6Z5_TAKRU          KKA-RILDAEGLALGCQIATSKKRARDLMDGSFHRFASSEQPWDVPEWFLQDEQKHRRK-
I3IZN4_ORENI          KKA-RILSPEGLALGAQIATSKKRARDLVDSSFHRFATSDEPWEVPEWFLDDERKHRKR-
A0A0R4IQB8_DANRE      KRA-RVLDAEGLALGAQIATSKKRERDLIDGSFHRFANSEDMTEVPAWFVDDEKKHRKR-
H2XWZ3_CIOIN          -KT-QKLDAEALALGTVIATSNKRKRDVIDDSFNRYTFNDEECALPDWFLEDEKKRVVKN
Q7QD87_ANOGA          KPKKIKLSEEELALGQMIISGKKTRRDIIDAAFNRYMFNDT--NLPDWFVADELKTMQR-
W5J3R9_ANODA          KPKKIKLNEQELALGQMLVSGKKMRRDIIDAAWNRYMFNDS--HLPSWFVEDEMKTMRR-
Q17ME6_AEDAE          REKKVKLNEQELALGQLLVSGKKTKRDLIDAAWNRYMFNDS--NLPEWFVKDEEKTMKK-
Q9VXK5_DROME          --KKVRLSENEMALGALLTRSKKTRRDLIDAAWNRYAFNDE--NVPVWFKLDEDEHMTK-
A0A088A7G6_APIME      R---KHLSEEDLALGSLLIQSKKTRRDLIDSAWNRYAFNDE--KLPDWFMQDEEKHMKN-
A0A158NJW7_ATTCE      KSKXKKLTPENLALGSLLIQSKKSRKDLIDSAWNRYAFNDE--KLPDWFVKDEEKHMKK-
E0VIT4_PEDHC          K---RKLDEEGLALGSMMIQSKKKKRDLIDGAWNRYAFNDD--NLPEWFVTDEKVHMHQ-
E9G6A2_DAPPU          RGKKRSLTAEALALGSMIIQSRKARRDISDDGWNRYAFNDE--NLPDWFEADERRHSHK-
B7P3V3_IXOSC          KAKRVKLDPEALALGSMMIHSQKARRDIIDSGYNRYTFNDE--NLPKWFTEEEKKHTRK-
A0A1X7UGH0_AMPQE      ----RKLDPAGLAIGALLVQSRKKRQDLIESGYNRWTSDDP--NLPDWFREDESSHCQK-
G4VQU5_SCHMA          RRLNRPLTAEERAIATRLIHSAKSRRELLESGYNRYQFFEKSSDLPDWFIEDEKKHMRK-
Q9N5N9_CAEEL          VAKKRKLTPEQLAIGEQMIYSAKAARNLEDEAWNRYANNDE--DLPDWFADDEKKHYFK-
A8Y2C8_CAEBR          VEKKRRLTPEQLAIGEQMIYSSKSARELEENAWNRYANNDE--DLPDWFVEDEKKHYFK-
A0A2H2IUP1_CAEJA      VAKKRRLTPEQLAIGEQMIYSAKASRDIEDDAWNRYANNDE--GLPDWFVDDEKKHYFK-
C4M6R5_ENTHI          PHMGKEKLSQALIVAGRIVKDPKQKKRLLEQHISRWTLPEDE-DTPAWFRHEEEEHNKL-
E9ADH8_LEIMA          IAMTDPDIRARTLAIAQKMLDPKARREILDASVNRYVFNDD-DDLPDWFVKDEQRNCRV-
A4I305_LEIIN          IAMTDPDIRARTLAIAQKMLDPKARREILDASVNRYVFNDD-DDLPDWFVKDEQRNCRV-
A4HFX5_LEIBR          IAMTDPDIRARTLAIAQKMLDPKARRDILDASVNRYVFNDD-DDLPDWFVKDEQRNCRV-
Q586Q7_TRYB2          VALTDPEVRARTLAIATKMLDPRGRREILDASINRYTFNDD-EDLPDWFLKDEQRNCRV-
K2MLU3_TRYCR          VALTDPQIRARTLAIATKMLDPKSRRDILDASINRYTFNDD-DDLPDWFIKDEQRNCKV-
Q4U8L6_THEAN          EIMGDVNKLAEIQALGSLMINKKTRMALIDGAYNKRTFTDE--DLPSWFVEDENKHNKP-
Q4N1B5_THEPA          ELLGDPEKLAEFQALGSLMINKKTRMALIDGAYNKRTFTDE--DLPSWFVEDENKHNKP-
B3L783_PLAKH          NLIKDEDELAFIKCIGEKLIHKKSRMDLIDDSFNRHSYLDDEDMLPEWFVEEEKKFRRP-
A5K2F1_PLAVS          NLIKDEDELAFIKCIGEKLIHKKSRMDLIDDSFNRHSYLEDEDMLPEWFVEEEKKFRRP-
Q4Z2U4_PLABA          NLIKDDDELAFIKYVGEKLIHKKSRMDLIDDSFNRHSYLEDENTLPDWFVEDEKKYRKP-
Q8IDF8_PLAF7          NLVKDEDELAFIKCIGEKLIHKKSRMDLIDDSFNRYSYMEDESNLPDWFLEEEKKYRRP-
B9QL21_TOXGV          QRPTDPEEIAHIQALGSLMVQKSTRMDLLDGAYNRYAFKDD--ALPEWFAEDEEAHTRP-
                                                   :    :          * **  :*       

SPB1_YEAST            --NKPITKEAAMAIKEKIKAMNARPIKKVAEAKARKRMRAVARLEKIKKKAGLINDDSDK
SPB1_CANAL            --IKPITKEAAIAIKEKQKQLNARPIKKVLEAQSRKKLRALKRLEKIKKKSDLINEDSGK
SPB1_YARLI            --NKPITKEAVEALKQKMKTLNARPIKKVLEAKGRKKMRALRRLEQMKKKSELINEDGAR
SPB1_EMENI            --NRPITKAAAAAIQEKWRAINARPIKKVMEAKGRKKFKAAQRIEKLRKKSALLADDETM
SPB1_ASPFU            --QRPITKAAAAAIKEKLRAINARPIKKVMEAKGRKKMKAAQRLEKLRKKSALLADDEAL
A0A0E1RUQ7_COCIM      --LRPITAAAAAAIREKMRAINARPIKKVREAKGRKKFKEAQRLEKLKKKSALLAEDEGV
Q0UCU2_PHANO          --QRPVTAAAASAIKEKLRALNARPIKKVREAQARKKFKAAQRLEKLKKKSALLADEEGM
I1RTE9_GIBZE          --QKPITKAAAQAIKEKMRAFNARPIKKVREAKARKKFKAAQQLEKLKKKSDMLNNDENM
C7YTG2_NECH7          --QKPITKAAAQAIKEKMRAFNARPIKKVREAKARKKFKAAQRLEKLKKKSDMLNNDENM
SPB1_NEUCR            --HKPITKAAAQAIKEKLRAYNARPIKKVAEAKARKKFKQAQRLEKLKKKADMLAGDDGM
SPB1_SCHPO            --NKPITKEAVLALREKMKALNARPIKKVLEAQGRKKMRTIKRLQRVAKKAEGISESGDM
SPB1_CRYNJ            --NIPITKEAVDALRARQRALDARPIKKVAEAKGRKKMKAVARMEKAKKKADGVMESEEM
A8N1R5_COPC7          --NIPITKEAVAALREKQRALDARPIKKIAEAKARKKLKAQQRLERAMKKAEGVISTTDM
SPB1_USTMA            --NIPITKEAIQALRERQRALDARPIKKVAEAKARKKMRTLRRLEKAQKKAETINENEDI
E3KB01_PUCGT          --HVPVTKEAVKILRDKMRALNARPIKKIAEAKGRKKLRTLRRLEKAQSKANTVNETNDL
SPB1_DICDI            --QTPLTKEMVDEIRRKIKEIDDRPIKKIAEAKARKKYRLGKKMEKTRDKASSIVDNPEM
F0ZY00_DICPU          --QTPLTKDMVDEIKRKIKEIDSRPIKKIAEAKARKKMRLGKKMEKVKEKSSSIMDNADM
Q0DFV9_ORYSJ          --MKPVTKEEVAAMRAQFKEIDARPAKKVAEAKARKKRVAMKKLDKARQKADAIADQNDI
I1PY11_ORYGL          --MKPVTKEEVAAMRAQFKEIDARPAKKVAEAKARKKRVAMKKLDKARQKADAIADQNDI
C5YVX0_SORBI          --MKPVTREEVAAMRAQFKEIDARPSKKVAEAKARKKRVAMKKLDKARQKADAIADQNDI
I1HGA5_BRADI          --MKPITREEVAAMKAQFREIDARPSKKVAEAKARKKRVAMKKLEKARQKADIVADQSDI
I1LJC4_SOYBN          --IKPITKEEIAAMKAQFKEIDARPAKKVAEAKARKKRVAMRKLEKVRKKANAISDQTEI
I1LQ27_SOYBN          --IKPITKEEIAAMKAQFKEIDARPAKKVAEAKARKKRVAMRKLEKVRKKANAISDQTEI
F6I0L2_VITVI          --IKPVTKEEIAAMRAQFKEIDARPAKKVAEAKARKKRAAMRKLEKVRKKANTISDQTDI
B9HRL4_POPTR          --IKPVTKEEIAAMRAQFKEINARPAKKVAEAKARKKRVAARKLEKVRKKANDISKQTEI
F4JTD2_ARATH          --MKPVTKDEVNAMKAQFKEINARPAKKVAEAKARKKRAAQKRLEKVRKKANTISDTADI
A9RQI9_PHYPA          --EKPITKEEVEAMKAQFREINARPVKKVAEAKARKKRRVLKKLEQARQKATAIADQEDI
H3GC19_PHYRM          --QIPIPKNVLAQMKERFMEMATKPVKKVAEARGRKHRLQMKKLKSAKKQATDIANLPDM
D0MRD5_PHYIT          --QIPIPKNVLAQMKERFMEMATKPVKKVAEARGRKQRMQLKKLKAAKKKATDIANLPDM
A0EER5_PARTE          --MEPITKEEFQQEKQRLYEINSRVPKKIMEAKIRKWKKAQKKLKTAAKKAQTVFDTDGI
Q23MN4_TETTS          --HLPITKEEIQAEKERLMAINRRAPKKIIEAKIRNYKRMEKKMKKAKNKANQIMETEGI
SPB1_HUMAN            --QLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDI
H2QDN5_PANTR          --QLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDI
G3QV89_GORGO          --QLPVGKKEVEYYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDI
SPB1_PONAB            --QLPIGKKEMEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDI
G1QW13_NOMLE          --QLPIGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDI
F7DBK9_MACMU          --QLPIGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDI
F7HIR2_CALJA          --QLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTRKKAEAVVNTVDI
H0XRX1_OTOGA          --QLPIDKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTRKKAEAVVNTVDI
I3NA29_ICTTR          --QLPIDKKEVEYYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
G1PIT9_MYOLU          --QLPIDKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
F6SYP9_HORSE          --QLPIDKKEVERYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
F1RSJ8_PIG            --QLPLDKKEVEYYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
E2RHC4_CANLF          --QLPIDKKDIEHYRRRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
G1SLJ8_RABIT          --QLPIDKKDVEHYRKRWKEINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
SPB1_MOUSE            --QLPVDKKEVEHYRKRWREINARPIKKVAEAKARKKRRVLKKLEQTKKKAEAVVNTVDI
SPB1_RAT              --QLPLDKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
H0VJ21_CAVPO          --QLPLDKKEVEHYRKRWKEINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
F1MY97_BOVIN          --QLPVDKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDI
F6UUX8_MONDO          --PLPLDKKTVEEYRKRWREINARPIKKVAEAKARKKRRMLKKMEQTKRKAEAVVNTVDI
G3WIR8_SARHA          --PLPLDKKTVEEYRKRWREINARPIKKVAEAKARKKRRMLKKMEQTKRKAEAVVNTVDI
SPB1_CHICK            --QIPLDKQTVEEYRQRWRQINARPIKKVAEAKARKKRRMLKKMEQMKKKAEAVVSTVDI
H3DDM8_TETNG          --PVPVTREMVEEYKEKWKEINARPIKRVAEAKARKKRRMLKKMEQAKKKAEAVVNTVDI
H2V6Z5_TAKRU          --PVPVTREMVEEYKEKWKEINARPIKRVAEAKARKKRRMLKKMEQAKKKAEAVVNTVDI
I3IZN4_ORENI          --PVPVTKEMVEEYKQKWKEINARPIKRVAEAKARKKRRTLKKMEQAKKKAEAVVNTVDI
A0A0R4IQB8_DANRE      --PVPVTKDMVEEYKQKWKEINARPIRRVAEAKARKKRRTLKKMEQAKKKAEAVVNTVDI
H2XWZ3_CIOIN          HLRHHVSKDMMDFYGSKDKGINVRTIKKVVEAKARKKRKATKKMEKARKQAEGISDTADM
Q7QD87_ANOGA          --HLPVPEDVVEKYRKSKDEFNVRTIKKVMEAKARKKRHATKRLEKIKKKAETIMENVDN
W5J3R9_ANODA          --DLPVPEDAVDRYRKTKDEFNVRTIKKVMEAKARKKRHATKRLEKIKKKAESIMENVDN
Q17ME6_AEDAE          --QAPVPHEVAETYKKNLEEMNVRSIKKVMEAKARKKKHATKRLEKIKKKAETIMENVDN
Q9VXK5_DROME          --PTPVPKELTAEYQRKLQEVNVRPIKKVMEAKARKHRRATKRLAKAKKMAEKIMENSDA
A0A088A7G6_APIME      --VIPVPNELVNEYKKRVEDLNIRPIKKVIEAKARKKRRALRKLEKAKKKVESIMDNTDI
A0A158NJW7_ATTCE      --EVPVPKELADDYKKRMEDLNVRPIKKVMEAKARKKKRAIRKLEKAKKKVEALMDNVDI
E0VIT4_PEDHC          --NIPVPTEMVQEYRNKLKEINVRPIKKIVEAKARKKRRMMKSLQRANKKMEKIMDDVDI
E9G6A2_DAPPU          --ELPITKEVVQQYKDKMKEINVRPIKKVVEAKARKKRRTMRRMEKARKKADTISETMGM
B7P3V3_IXOSC          --HMPVTAEMVAEYKAQLKAVNARPIKKVAEAKARKKQRAARRLEKARKRAEAITEKLDM
A0A1X7UGH0_AMPQE      --QLPITKDMVDEYRKRLKEINARPIKKIAEAKARKKQRAARKLTKAREKARVICDTPDV
G4VQU5_SCHMA          ------PIIVKKEEIPVDVPTMGRSLSKAEQAKARKKARLAKRLKRIRQKAEGISD--EI
Q9N5N9_CAEEL          --QTPVTKEQVALYRERMREFNARPSKKVAEAKARKQKKMQRKLESAKKKAEGILENDQM
A8Y2C8_CAEBR          --QTPVTKEQVALYRERMREFNARPSKKVAEARARKQKKMQRKLESAKKKAEGILENDQM
A0A2H2IUP1_CAEJA      --QTPVTKEQVTLYRERMREFNARPTKKVAEARARKQRKMQRKLATAKKKAEGILENDMM
C4M6R5_ENTHI          --TLPETKEEVAAMRRRLREIDSAPIKKAWEAEARKKKKLQTRMRALEQQASKIEGDGEM
E9ADH8_LEIMA          --VLPVTAEEIEEQRRRFRELNARPSRKVMEAMGRKRRKAQRMLRSLIDKGK---ADPRA
A4I305_LEIIN          --VLPVTAEEIEEQRRRFQELNARPSRKVMEAMGRKRRKAQRMLRSLIDKGK---ADPRA
A4HFX5_LEIBR          --VLPVTAEEIEEQRRRFQELNARPSRKVMEAMGRKRRKAQRMLRGLIDKGK---ADPRA
Q586Q7_TRYB2          --VLPVTAEEVEAQRARFREMNARPGKKVMEAVQRKRRRAQRMLRGLIERGK---VDPRT
K2MLU3_TRYCR          --VLPVTAEEIEVQRQRFREMNARPGKKVMEAVQRKRRRAQRMLRSMIEKGK---TDPRA
Q4U8L6_THEAN          --QYPVTKELMKKYKAKLLELKNRPIKKVLEAKHRKALRAKKKLKSILPKIEAISNDRES
Q4N1B5_THEPA          --QYPVTKELVKKYKQKLLELKNRPIKKVLEAKHRKAQRAKKRLRSILPKIEAISNDRES
B3L783_PLAKH          --VIPIDKSILNQYKSSINKITKMPIKKVIEAKMRNKKREIAKMKKLEAKIGKIEKEEED
A5K2F1_PLAVS          --VIPIDKSILNQYKSSINKITKMPIKKVIEAKMRNKKREIAKMKKLEAKIGKIEKDEED
Q4Z2U4_PLABA          --VIPIDKTVLDQYKNKINRITKMPIKKVIEAKMRNKKREITKMKKLEAKIGKIEKDEDD
Q8IDF8_PLAF7          --VIPIDKKILDEYKGKINKITKMPIKKVIEAKMRNRKREITKMKKLEAKIGKIEKNEDD
B9QL21_TOXGV          --ELPVTKELMREYRQKLLDISRRPIRKVREARARKKMREQRRLQKVKSQVAAVAESTEF
                                                 :  :*  *:       :                

SPB1_YEAST            TEKDKAEEISRLMRKVTKKPKTKPK-VTLVVASG---RNKGLAGRPKGVKGKYKMVDGVM
SPB1_CANAL            SERDKADEISKLMKKLNKKQKQKPK-TTVVVARG---SNRGLSGRPKGVKGKYKMVDGVM
SPB1_YARLI            SEKEKADDISKLMRKLAKPQKSKKKTVTVVYAGG---KNKGIAGRPRGVTGKYKMVDGTM
SPB1_EMENI            SERDKAQAIARMMSRAAK-KKP-KQNVKLVVAKG---GNRGISGRPKGVKGKYKIVDARM
SPB1_ASPFU            SERDKSQAIAKLMSKAVK-KKP-KQQVKLVVARG---ANRGISGRPRGVKGKYKIVDSRM
A0A0E1RUQ7_COCIM      SERDKAQTIARMMARATK-KKP-KQNVKLVVAKG---GNRGISGRPRGVKGKYKIVDARL
Q0UCU2_PHANO          TEKEKAQSIARLMSRAAK-KKP-KQKVSVVVARG---GNKGIKNRPKGTKGKYKMVDARL
I1RTE9_GIBZE          TEKEKAESIGRLMARAQK-KKPVKQAAKLVVARG---LNRGIKGRPKGVKGRYRIVDPRM
C7YTG2_NECH7          TEKEKSDSISRLMAKAAR-KKP-KQAAKLVVARG---LNRGIKGRPKGVKGRYRIVDPRM
SPB1_NEUCR            SEKEKAASISKLMASVAK-KTR-RAPIKVVKAAG---SNKGLQGRPKGVKGRYKMVDPRM
SPB1_SCHPO            TESEKAKEISRLVSRATK-SKP-KAKPTLVVAKG---PNKGLKSRPKGVKGKYKMVDSRM
SPB1_CRYNJ            GDGEKARQVRRMLARAAKGKEK-AKEKKIVVAKG---VNKGVKGRPTGVKGKYKIVDARM
A8N1R5_COPC7          TEREKAQQIEKLMRKGTSKKKE-KKEVKVVVARG---ATKGVKGRPKGVKGRYIMVDRRG
SPB1_USTMA            SEKEKSNTINKLLAKSVKGAQK-KKEVQLVVAKG---VNRGLKGRPKGTKGRYKMVDPRM
E3KB01_PUCGT          TEKEKSLEIEKLMSRMHKSPKT-KSDIKIVVAKG---ANRGQKGRPRGVKGRYKMVDARG
SPB1_DICDI            SNREKSKAIEKLYSGTDKKNMKPKKIIMIAKKS----------KTAGGGTGKYKIVDKRM
F0ZY00_DICPU          SNKEKSRAIEKLYAGTDKKNQKPKKIIMIAKKS----------KTGGGGTGKYKIVDKRM
Q0DFV9_ORYSJ          NEQSKRKMIDRIYKKAIP-K-KPQKEYVVAKKG----------VQVRAGKGK-ILVDKRM
I1PY11_ORYGL          NEQSKRKMIDRIYKKAIP-K-KPQKEYVVAKKG----------VQVRAGKGK-ILVDKRM
C5YVX0_SORBI          NERSKRKMIDQIYRKAMP-K-RPQKEYVVAKKG----------VQVRAGKGK-VLVDPRM
I1HGA5_BRADI          NEKSKAKMIDKIYKKAVT-TQKPKKEYVVAKKG----------VQVRAGKGK-VLVDPRM
I1LJC4_SOYBN          SDSSKRKQIEQLYKRAV--PKRPKKEYVVAKKG----------VQVRAGKGK-VLVDRRM
I1LQ27_SOYBN          SDRSKRKQIEQLYKRAV--PKRPKKEYVVAKKG----------VQVRAGKGK-VLVDRRM
F6I0L2_VITVI          SDRSKGRLIEQLYKKAA--PKRPQKEYVVAKKG----------VQVRAGKGK-VLVDRRM
B9HRL4_POPTR          SDHSKGRLIEQLYKKAA--PKRPKKEYVVAKKG----------VTVKVGKGK-VLVDRRM
F4JTD2_ARATH          SDRSKDKMIDKLYKKAAE-PRKPRKELVVSKKG----------VGVKVGKGQ-KRVDRRM
A9RQI9_PHYPA          SNKSKQKSMERVYKKALAAPKRGKTEVVVAKKG----------VGARGGKGR-IVVDRRL
H3GC19_PHYRM          STREKLKAIDRAMRGANVKKES---KVYVVSTRG---GTKTAGGKKAGKGK-VKLVDPRM
D0MRD5_PHYIT          STREKLKAIDRAMKGARLKKES---KVYVVSNRG---GSRTADGKKIGKGKKVKIVDPRM
A0EER5_PARTE          NQKTKMQQVRRIYNKEKANIQKEQERKVIVARKG---Q----ASGKFKSSRKVLTVDKRL
Q23MN4_TETTS          SEQMKIKQVKSLYAKEKRGLK--QEKKYIVGKKG---T----APGKN--SRFVKHVDNRL
SPB1_HUMAN            SEREKVAQLRSLYKKAGLGKEKRH-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
H2QDN5_PANTR          SEREKLEQERSLYKKAGLGKEKRH-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
G3QV89_GORGO          SEREKVAQLRSLYKKAGLGKEKRH-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
SPB1_PONAB            SEREKVAQLRSLYKKAGLGKEKRH-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
G1QW13_NOMLE          SEREKVAQLRSLYKKAGLGKEKRH-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
F7DBK9_MACMU          SEREKVAQLRSLYKKAGFGKEKHH-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
F7HIR2_CALJA          SEREKVAQLRSLYKKAGLGKEKCH-VTYVVAKKG---VGRKVRRPAGVRGHFKVDWSSRM
H0XRX1_OTOGA          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
I3NA29_ICTTR          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
G1PIT9_MYOLU          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
F6SYP9_HORSE          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
F1RSJ8_PIG            SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
E2RHC4_CANLF          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
G1SLJ8_RABIT          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
SPB1_MOUSE            SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVKGHFKV-VDSRM
SPB1_RAT              SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
H0VJ21_CAVPO          SEREKVAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
F1MY97_BOVIN          SEREKVAQLRSLYRKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVRGHFKV-VDSRM
F6UUX8_MONDO          SEREKMAQLRSLYKKAGLGKEKRQ-VTYVVAKKG---VGRKVRRPAGVKGHFKV-VDTRM
G3WIR8_SARHA          SEREKMAQLRSLYKKAGFGKEKRQ-VTYVVAKKG---VGRKVRRPAGVKGHFKV-VDTRM
SPB1_CHICK            SEREKVAQLRRIYKKAGLGKEKRQ-VTYLVAKKG---VGPRVRRPPGVKGQFKV-VDSRL
H3DDM8_TETNG          SEREKMAQLKSIYKKAGVGKEKRE-VTYVVTKKG---AGRKVRRPPGVKGAFKV-VDSRL
H2V6Z5_TAKRU          SEREKMAQLKSIYKKAGVGKEKRE-VTYVVTKKG---AGRKVRRPPGVKGAFKV-VDSRL
I3IZN4_ORENI          SEREKMAQLKSIYKKAGLGKEKRE-VTYVVSKKG---AGKKVRRPPGVKGVFKV-VDGRM
A0A0R4IQB8_DANRE      SEREKMAQLKSIYKKAGVGKEKRE-VTYVVAKKG---VGRRVRRPAGVKGAFKV-VDGRM
H2XWZ3_CIOIN          STKEKAAHIKNIYKKAGLLKKKKENTTYVFAKRG---TGKRVRRPPGVSGKFKV-VDKRM
Q7QD87_ANOGA          TNQEKIRLLKKLYKKADAK---KKDVTYVVAKKTG-VSGKKVRRPKGVEGRFKV-VDPRM
W5J3R9_ANODA          TNQEKIRLLKKLYKKADAK---KKEVTYVVAKKSG-TSGKKVRRPKGVEGRFKV-VDPRM
Q17ME6_AEDAE          TNQEKIRLLKKLYKKTDAK---KKDITYVVAKKSG-TSGKKVRRPKGVEGRFKV-VDPRM
Q9VXK5_DROME          TNHEKSKQLKKVYKKAQEK---KKEVTYVVAKKQ--TAARRARRPAGVKGRYKV-VDPRE
A0A088A7G6_APIME      SNKEKAKQIQTLYKKAYKE--PKKDVTYVVMKKH--MTQKKTKRPPGVKGRYKL-VDPRM
A0A158NJW7_ATTCE      SDREKARQVKALYKKARQE--PKKEVTYIVAKKH--TTQKRAVRPPGVKGRYKV-VDPRM
E0VIT4_PEDHC          SDREKVRNIQKIYKKAKEKGKDKKKVTYIVAKRV--NAGKRYKKPRGVKGPYKV-VDPRM
E9G6A2_DAPPU          SDYDKAQQIRHIHKKAKQE--KKKEVTYVVAKKH--QAGKKAHRPAGVKGQFKV-VDRRM
B7P3V3_IXOSC          TDAEKAQQVRAIYKKVLGD-KGKNKVTYLVAKKA---TGRKVRRPPGVKGRFKV-VDPRM
A0A1X7UGH0_AMPQE      TDQEKVRQIKGIYKKAGLTSNKKRDVQYVVAKRG---LGKRVKRPAGVSGRFKV-VDPRM
G4VQU5_SCHMA          PETEKWQQIKQLYKKAGLLKRKRRPLHVVVNTKA----GSRSGGTKPQKGAKIKIVDKRM
Q9N5N9_CAEEL          EHSEKVREMKKVYANATRKEKKKVELVRMTKGKK--------GKTGRPNGQYKL-VDSRM
A8Y2C8_CAEBR          EHSEKVREMKKVYANATRKEKKKVELVRMTKGKK--------GKTARPGGQYKL-VDSRM
A0A2H2IUP1_CAEJA      EHSEKVREMKKVYAKANRKESKKVELVRMTKGKK--------GNTARPQGRYKL-VDNRM
C4M6R5_ENTHI          NSKEQLRILTKKAKKLNKKFSTHEGVRFVSSKTG--------KTVGGSSGRMKL-VDPRM
E9ADH8_LEIMA          REKAENLSVRKLMRSQVVKGQG-KKRHKYLDRQ----------------------LMGRM
A4I305_LEIIN          REKAENLSVRKLMRSQVVKGQG-KKRHKYLDRQ----------------------LMGRM
A4HFX5_LEIBR          REKASNLSVRKLMRSQVVKGQG-KKKHKYLDRQ----------------------LMGRM
Q586Q7_TRYB2          REKANNLSVRKLMRSQAVKGNGGRRKNGPLDRK----------------------KMGEL
K2MLU3_TRYCR          REKANNASVRKLMRSQAVKGDAKRKKKGPLDRKK-------------------WAKCGVR
Q4U8L6_THEAN          TENPNKLLRGLKKIQSTKRQKVYVISRRSNFNKLT-KGGKQKSNKSKGSRKVLKHVDRRM
Q4N1B5_THEPA          TENPKKLLRGLKKIQSTRRQKVYVISRRANVGKLS-KQSKSGKSSGKGARKVLKHVDRRM
B3L783_PLAKH          PFLKHKAITNILKKNKSEKKREKSYVVCTGKGSK-----VSKKKNKKGGRTMVKYVDKRL
A5K2F1_PLAVS          PFLKHKAITNILKKNKSEKKREKSYVVCTGKGSR-----VSNKKNKKGGRTMVKYVDKRL
Q4Z2U4_PLABA          PFLKQRAIANVLKKNKSEKKREKSYVVCTGKGSK-----MAKK-NKKGGKTMVKFVDKRL
Q8IDF8_PLAF7          PFLKQKAITNLLKKNKSDKKRDKSYIVCTGKGSK-----MAKKKKNKKGKTMVKYVDKRL
B9QL21_TOXGV          TEASKARAIDKIARKARHAEEKRGKDYVVTRRVGGGKLAQKKAGKKGGGNNRVKLVDRRL
                                                                                  

SPB1_YEAST            KNEQRALRRIAKKHHKKK------------------------------------------
SPB1_CANAL            KNEQRALKRIAKKYKK--------------------------------------------
SPB1_YARLI            KKEQRAIRRIKKKMGKK-------------------------------------------
SPB1_EMENI            KKDVRAQKRLAKKKQK--------------------------------------------
SPB1_ASPFU            KKDIRAQKRLAKKKK---------------------------------------------
A0A0E1RUQ7_COCIM      KKDVRAQKRLAKKRNK--------------------------------------------
Q0UCU2_PHANO          KKDVRGEKRAAKKRK---------------------------------------------
I1RTE9_GIBZE          KKELRAQKRISKKKK---------------------------------------------
C7YTG2_NECH7          KKELRAQKRIAKRK----------------------------------------------
SPB1_NEUCR            KKELRAMKRISKKK----------------------------------------------
SPB1_SCHPO            KKDLRAQKRLAKKGRR--------------------------------------------
SPB1_CRYNJ            RKEVRALKRIKKAGSKRR------------------------------------------
A8N1R5_COPC7          KKELRAKKRREKAQKKRR------------------------------------------
SPB1_USTMA            KKELRAFKRKAKRDGKKLGSSNSKPRVPKGYGPRN-------------------------
E3KB01_PUCGT          RKELRAQKRQERASSKRKRK----------------------------------------
SPB1_DICDI            KKDLRAQKNKLKTVGRSK-------------DSSKKSKP------SGGKNKK--------
F0ZY00_DICPU          KKDLRAMKQKQKTVGRSA-------------ASKKANK------------KK--------
Q0DFV9_ORYSJ          KKDKRASKVK-----GGK--------GAKG-KGKKGGGQ--KGGMRGKAGRKAQN-----
I1PY11_ORYGL          KKDKRASKVK-----GGK--------GAKG-KGKKGGGQ--KGGMRGKAGRKAQN-----
C5YVX0_SORBI          KKDKRASGT------GKK--------GKKGGKGAKGKGG--LKGMRGKAGKKAGKAPR--
I1HGA5_BRADI          KKDKRTSGLGKKGKGGKG--------GAKGGKGKKGAAGQRKGGGRGKGGKKAGKSPH--
I1LJC4_SOYBN          KKDARKHGMGKAGKGGSK----TKGKAPKG-KGSSK-----ASAKKGKQRTK--------
I1LQ27_SOYBN          KKDARKHGSGKGGKGGSK----TKGKAPKG-KGGSSKAS--ASAKKGKQRTK--------
F6I0L2_VITVI          KKDARSRGMSKQGKGPSKKGGFRKGKNANGQKGNKGSAK--ASAKSGKGGRKGNRMNMHD
B9HRL4_POPTR          KKDAR--GMGKPGKGGLK-----KGKNAKG-QRGKGPAK--TSAK-GNKGKKGKKMGMHE
F4JTD2_ARATH          KSDDRKRGGGKPGRNGQK---------GTGKAGQKGKRP--AGKPRGRKPG---------
A9RQI9_PHYPA          RKDSRAKNTGKPGKGFKG--------RGGGANGAKAKANKGKGPSRGGKGRKPQKG----
H3GC19_PHYRM          KNDKRNADIRAKRGKKRKR-----------------------------------------
D0MRD5_PHYIT          KSDKRNAEIRAKRGKKRKR-----------------------------------------
A0EER5_PARTE          KKDKRAMKAKARVGKGKKRRQVSRRKGKKQKS----------------------------
Q23MN4_TETTS          KKD-RKALSRLYTNKGSRKRQVKRHKGKKQKS----------------------------
SPB1_HUMAN            KKDQRAQQRKEQKKK--------HKRK---------------------------------
H2QDN5_PANTR          KKDQRAQQRKEQKKK--------HKRK---------------------------------
G3QV89_GORGO          KKDQRAQQRKEQKKK--------HKRK---------------------------------
SPB1_PONAB            KKDQRAQQRKEQKKK--------HKRK---------------------------------
G1QW13_NOMLE          RKDQRAQQRKERKKK--------HKRK---------------------------------
F7DBK9_MACMU          KKDQRAQQRKEQKKK--------HKRK---------------------------------
F7HIR2_CALJA          KKDQRAQQRKEQKKK--------HKRK---------------------------------
H0XRX1_OTOGA          KKDQRAQQRKEQKKK--------HRRK---------------------------------
I3NA29_ICTTR          KKDQRAQQRKDQKKK--------QKRK---------------------------------
G1PIT9_MYOLU          KKDQRAQQRKEQKKK--------NRRK---------------------------------
F6SYP9_HORSE          KKDQRAQQRKEQKQKQK------HRRK---------------------------------
F1RSJ8_PIG            KKDQRAQQRKEQKKK--------HKRK---------------------------------
E2RHC4_CANLF          KKDQRAQQRKEQKKK--------HRRK---------------------------------
G1SLJ8_RABIT          KKDQRAQQRKEQRKK--------HKRK---------------------------------
SPB1_MOUSE            KKDQRAQQRKEQKKK--------HKRK---------------------------------
SPB1_RAT              KKDQRAQ-RKEQKRN--------HRRK---------------------------------
H0VJ21_CAVPO          KKDQRAQQRKEQKKK--------HKRK---------------------------------
F1MY97_BOVIN          KKDQRAQQRKEQKKK--------HKRK---------------------------------
F6UUX8_MONDO          KKDLRAQQRKEQQHKGHK----GRRRK---------------------------------
G3WIR8_SARHA          KKDLRAQQRKEQRHKG--------RRK---------------------------------
SPB1_CHICK            KKDVRAQKRKEQKKR----------RK---------------------------------
H3DDM8_TETNG          KKDMRGIKRKEQRAKGGK----G-------------------------------------
H2V6Z5_TAKRU          KKDMRGMQRKDQRAKGGK----G-------------------------------------
I3IZN4_ORENI          KKDLRGMQRKEQHAKGGK----GKRGKGRQAKGGKGGVKSGKGRK---------------
A0A0R4IQB8_DANRE      KKDTRAAQRKDERGRGKG----GRGSKGGCGSK---------------------------
H2XWZ3_CIOIN          KKDLRPQGKNSKQSK--------GKSG---------------------------------
Q7QD87_ANOGA          KKDRRAEMAKDKRSKKHG----KGRGKPAAGGRARAEAAMPRQRLGAVVRSKVIFWWVNS
W5J3R9_ANODA          KKDRRSEMAKEKRTKKFG----GGKGK-GKGGKAAAGGRKAKVGKGKK------------
Q17ME6_AEDAE          KKDRRAMDAKERRSAKKG----GKKGGKAKPGKGGKGKKK--------------------
Q9VXK5_DROME          KKDKRSMDAKKRREK-------GSKGRKGKGRK---------------------------
A0A088A7G6_APIME      KKDLRATKAKEKTKKRGK----KNHGKPSQGKPKNHKGKKLK------------------
A0A158NJW7_ATTCE      KKDLRAAKAKEKTKGRGKKTRGNNRGKKLRVQPKNMKRKSK-------------------
E0VIT4_PEDHC          KKDARRQKNNLKGK---------------SGKKKNKR-----------------------
E9G6A2_DAPPU          KKDDKKRKATERRK-----------GKKARTPKK--------------------------
B7P3V3_IXOSC          KKDLRKKKAAMKKK----------------------------------------------
A0A1X7UGH0_AMPQE      KKDNRRQKAQYKKQRKH-------------------------------------------
G4VQU5_SCHMA          KADLRGQQKAKDGKKHGK-----RKNKVGRPGRPKSRGIGKRR-----------------
Q9N5N9_CAEEL          KKDLRAAKAKEKTKGRGGKRGIPKKTGGGGGGRGRGGGGRGGGRR---------------
A8Y2C8_CAEBR          KKDLRAAKAKEKTKGRGRGRGGGAKKAGG--GRGGGRGGRGGRR----------------
A0A2H2IUP1_CAEJA      KKDLRAAKNKEKTKGRGK-----SGKAGG--GRGGRGGGRRGGRR---------------
C4M6R5_ENTHI          KKELRAKKRIEKGKAKKG-----GKGKKSFAKRR--------------------------
E9ADH8_LEIMA          RREKQKLKRRK-------------------------------------------------
A4I305_LEIIN          RREKQKLKRRK-------------------------------------------------
A4HFX5_LEIBR          RREKQKLKRRK-------------------------------------------------
Q586Q7_TRYB2          RRDKQRAKRRK-------------------------------------------------
K2MLU3_TRYCR          NKDLNAAVNYY-------------------------------------------------
Q4U8L6_THEAN          KQDNRRSKIKPKRKSRKIRPH---------------------------------------
Q4N1B5_THEPA          KQDNRRAKIKPKRKSRKIRPH---------------------------------------
B3L783_PLAKH          KKDKKAKKRVEKKKKNISRRKYSKSRPFKFKQKN--------------------------
A5K2F1_PLAVS          KKDKKAKKRVEKKKKNISRRKYSKSRPFKFKQKV--------------------------
Q4Z2U4_PLABA          KKDKKAKKRIEKKKKNISRVKYSKSRPFKFKKNF--------------------------
Q8IDF8_PLAF7          KKDKKAKKRIEKKKKNISRTKYSKSKPFKFRRKI--------------------------
B9QL21_TOXGV          KKDKRAMKAAMKKKGGQRRGLKKKSRKS--------------------------------
                      . : .                                                       

SPB1_YEAST            --------------------------
SPB1_CANAL            --------------------------
SPB1_YARLI            --------------------------
SPB1_EMENI            --------------------------
SPB1_ASPFU            --------------------------
A0A0E1RUQ7_COCIM      --------------------------
Q0UCU2_PHANO          --------------------------
I1RTE9_GIBZE          --------------------------
C7YTG2_NECH7          --------------------------
SPB1_NEUCR            --------------------------
SPB1_SCHPO            --------------------------
SPB1_CRYNJ            --------------------------
A8N1R5_COPC7          --------------------------
SPB1_USTMA            --------------------------
E3KB01_PUCGT          --------------------------
SPB1_DICDI            --------------------------
F0ZY00_DICPU          --------------------------
Q0DFV9_ORYSJ          --------------------------
I1PY11_ORYGL          --------------------------
C5YVX0_SORBI          --------------------------
I1HGA5_BRADI          --------------------------
I1LJC4_SOYBN          --------------------------
I1LQ27_SOYBN          --------------------------
F6I0L2_VITVI          --------------------------
B9HRL4_POPTR          --------------------------
F4JTD2_ARATH          --------------------------
A9RQI9_PHYPA          --------------------------
H3GC19_PHYRM          --------------------------
D0MRD5_PHYIT          --------------------------
A0EER5_PARTE          --------------------------
Q23MN4_TETTS          --------------------------
SPB1_HUMAN            --------------------------
H2QDN5_PANTR          --------------------------
G3QV89_GORGO          --------------------------
SPB1_PONAB            --------------------------
G1QW13_NOMLE          --------------------------
F7DBK9_MACMU          --------------------------
F7HIR2_CALJA          --------------------------
H0XRX1_OTOGA          --------------------------
I3NA29_ICTTR          --------------------------
G1PIT9_MYOLU          --------------------------
F6SYP9_HORSE          --------------------------
F1RSJ8_PIG            --------------------------
E2RHC4_CANLF          --------------------------
G1SLJ8_RABIT          --------------------------
SPB1_MOUSE            --------------------------
SPB1_RAT              --------------------------
H0VJ21_CAVPO          --------------------------
F1MY97_BOVIN          --------------------------
F6UUX8_MONDO          --------------------------
G3WIR8_SARHA          --------------------------
SPB1_CHICK            --------------------------
H3DDM8_TETNG          --------------------------
H2V6Z5_TAKRU          --------------------------
I3IZN4_ORENI          --------------------------
A0A0R4IQB8_DANRE      --------------------------
H2XWZ3_CIOIN          --------------------------
Q7QD87_ANOGA          IASAERVHTGIARAKIENKTHRYKHL
W5J3R9_ANODA          --------------------------
Q17ME6_AEDAE          --------------------------
Q9VXK5_DROME          --------------------------
A0A088A7G6_APIME      --------------------------
A0A158NJW7_ATTCE      --------------------------
E0VIT4_PEDHC          --------------------------
E9G6A2_DAPPU          --------------------------
B7P3V3_IXOSC          --------------------------
A0A1X7UGH0_AMPQE      --------------------------
G4VQU5_SCHMA          --------------------------
Q9N5N9_CAEEL          --------------------------
A8Y2C8_CAEBR          --------------------------
A0A2H2IUP1_CAEJA      --------------------------
C4M6R5_ENTHI          --------------------------
E9ADH8_LEIMA          --------------------------
A4I305_LEIIN          --------------------------
A4HFX5_LEIBR          --------------------------
Q586Q7_TRYB2          --------------------------
K2MLU3_TRYCR          --------------------------
Q4U8L6_THEAN          --------------------------
Q4N1B5_THEPA          --------------------------
B3L783_PLAKH          --------------------------
A5K2F1_PLAVS          --------------------------
Q4Z2U4_PLABA          --------------------------
Q8IDF8_PLAF7          --------------------------
B9QL21_TOXGV          --------------------------