CLUSTAL format seed alignment for MF_03168

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KAD2_HUMAN            -------------------------------------------------MAPSVPAAE--
KAD2_PONAB            -------------------------------------------------MAPSVPAAE--
F7CAR4_CALJA          -------------------------------------------------MAPSGPAAE--
F6XQ43_CALJA          -------------------------------------------------MAPSVPAAE--
G1QSG9_NOMLE          -------------------------------------------------MAPSVPAAE--
F7H131_MACMU          -------------------------------------------------MAPSVPAAE--
H2PYL4_PANTR          -------------------------------------------------MAPSVPAAE--
G3QCW6_GORGO          -------------------------------------------------MAPSVPAAE--
G1SG80_RABIT          -------------------------------------------------MAPSVPAGE--
H0WH97_OTOGA          -------------------------------------------------MVPNAPVAE--
I3MQT7_ICTTR          -------------------------------------------------MAPNAPAAE--
KAD2_MOUSE            -------------------------------------------------MAPNVLASE--
KAD2_RAT              -------------------------------------------------MAPNALAPE--
G3SVV8_LOXAF          -------------------------------------------------MAPDVSADELP
KAD2_BOVIN            -------------------------------------------------MAPNVPAAEPV
G1NU41_MYOLU          -------------------------------------------------MAPNVPAAEPA
E2RE39_CANLF          -------------------------------------------------MAPNVPAAEPA
F6XJN4_HORSE          -------------------------------------------------MAPNAPAAEEA
F6VYY4_MONDO          -------------------------------------------------MAPSVPVAPEP
H2RRV5_TAKRU          -------------------------------------------------MAPSTQLKETL
H3D185_TETNG          -------------------------------------------------MAPSTQLKETI
G3NBD5_GASAC          -------------------------------------------------MAPSAQLKEAI
KAD2_DANRE            -------------------------------------------------MAPSTQEDDTV
KAD2_XENTR            -------------------------------------------------MAPREAAPAER
E9GFK4_DAPPU          ----------------------------------------------------MADQKDS-
B7PHX7_IXOSC          -------------------------------------------------MAPLLKPKESE
C3Y4K4_BRAFL          -------------------------------------------------MAPVPKPQPAA
A0A1X7VCJ5_AMPQE      ---------------------------------------------------------MAD
A7T0G9_NEMVE          -------------------------------------------------MRELAKKAEAC
A0A1W2WEA2_CIOIN      -------------------------------------------------MAPKDAVGVDN
B3SA53_TRIAD          -------------------------------------------------MAAAPAPQPEN
KAD2_CAEEL            ------------------------------------------------MGVPKTQQSAQP
A0A2H2IVJ7_CAEJA      ------------------------------------------------MGVPQKQQSAQP
KAD2_CAEBR            --------------------------------------MDKKSDFGQIFLVPKTQPAAQP
H3F5G9_PRIPA          -------------------------------------------------MAPNAAVKTEA
KAD2_AEDAE            -------------------------------------------------MAPNAAAVAPK
KAD2_ANOGA            -------------------------------------------------MAPNAAELKVK
KAD2_DROME            -------------------------------------------------MAPNAAVPVER
KAD2_DROPS            -------------------------------------------------MAPNLAVPVER
E0W486_PEDHC          -----------------------------------------------------MGVPMER
D2Y062_BOMMO          -------------------------------------------------MAPAAAATKLK
A0A158NNX3_ATTCE      -------------------------------------------------MPPQTNVVLKE
KAD2_CANAL            -------------------------------------MSIEDLKNTVTKLQERIQELEKK
KAD2_YARLI            ------------------------------------MSTIEDLKATVERLAARVHELEAS
KAD2_YEAST            ------------------------------------MSS---------------------
C0NYE4_AJECG          -------------------------------MAPIKDETIDGLKSIISELESRVVQLEGR
KAD2_COCIM            -------------------------------MAPTKDETVDSLKSIIRDLEARVVQLEQK
KAD2_EMENI            -------------------------------MAPITDDVVAGLKSTIGKLEARIEDLESR
KAD2_ASPFU            -------------------------------MAPITEEVVHGLKDMIEKLENRVQELEAR
KAD2_SCLS1            -------------------------------MAPIGDDATQTLHDLVNKLESRVKELEDK
KAD2_PHANO            -------------------------------MAPTTDPAVNELKSTVHKLEQRIAELEGR
I1S1W3_GIBZE          --------------------------------MGFIEDELKQLKDVISTIDTRIKKLEAR
C7Z1B0_NECH7          --------------------------------MGFVEDELKQLKSVLGSLDTRIKALEAR
KAD2_NEUCR            --------------------------------MGFIDDEVKRLGDVIASLEDRVRSLETR
KAD2_COPC7            ---------------------------------MGASEELEYLKSLVAQLNDKIASLEAK
KAD2_USTMA            MATTTTRGARDSPFPAPSEGEIKKELNMKGDTISGGSTELSYLKSLVSQLNDKIAQLESK
KAD2_CRYNJ            ---------------------------------MSGNSEVEYLKSLVSQLQDKIHHLEKS
KAD2_SCHPO            ------------------------------------------------------------
I1CGD1_RHIO9          -------------------------------MADKQSAILEEIKKNIDSLHAKFEALEKK
I1CJM6_RHIO9          -------------------------------MADKHSTVLEEIKKNIDSLHAKFEALEKK
F4PD49_BATDJ          -----------------------------------------------------MGALQSS
KAD2_DICDI            -------------------------------MEPQFKVKIDN---DSARILKELAEKK--
D3AY59_POLPP          -------------------------------MGGHNDSKTTSPMEEEVELLRKIAAKK--
                                                                                  

KAD2_HUMAN            PEYPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
KAD2_PONAB            PEYPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
F7CAR4_CALJA          PEYPK------------------GIRAMLLGPPGVGKGTQAPKLAENF--CVCHLATGDM
F6XQ43_CALJA          PEYPK------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
G1QSG9_NOMLE          PEYPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
F7H131_MACMU          PEYPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
H2PYL4_PANTR          PEYPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
G3QCW6_GORGO          PEYPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
G1SG80_RABIT          PEHPK------------------GIRAVLLGPPGAGKGTQAPRLAENF--CVCHLATGDM
H0WH97_OTOGA          PEYPK------------------GIRAVLLGPPGAGKGTQAPKLAEKF--CVCHLATGDM
I3MQT7_ICTTR          PECPK------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
KAD2_MOUSE            PEIPK------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
KAD2_RAT              PEHPE------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
G3SVV8_LOXAF          PKCPK------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
KAD2_BOVIN            PESPK------------------GVRAVLLGPPGAGKGTQAPKLAKNF--CVCHLATGDM
G1NU41_MYOLU          PESPK------------------GIRAVLLGPPGAGKGTQAPKLAKNF--CVCHLATGDM
E2RE39_CANLF          PESPK------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
F6XJN4_HORSE          RKSPQ------------------GIRAVLLGPPGAGKGTQAPKLAENF--CVCHLATGDM
F6VYY4_MONDO          KESPPR-----------------GIRAVLLGPPGAGKGTQAPKLAESY--CVCHLATGDM
H2RRV5_TAKRU          ADMHE------------------GLRAILLGPPGAGKGTQAPRLAEKY--CVCHLATGDM
H3D185_TETNG          ADVHE------------------GIRAILLGPPGAGKGTQAPQLAEKY--CVCHLATGDM
G3NBD5_GASAC          ADVQE------------------GIRAILLGPPGAGKGTQAPRLAEEY--CVCHLATGDM
KAD2_DANRE            SGIRK------------------GIRAILLGPPGAGKGTQAPKLAEKY--CVCHLATGDM
KAD2_XENTR            GSVME------------------GIRAILLGPPGAGKGTQAPKLAEKY--CVCHLATGDM
E9GFK4_DAPPU          ---------------V-------GINAILLGPPGSGKGTQAPRLKEKY--CVCHLATGDM
B7PHX7_IXOSC          HLYAGDYVPNEARSRK-------GINAVLLGPPGSGKGTQAPLLKEEY--CVCHLSTGDL
C3Y4K4_BRAFL          E-----------EQSV-------GIRAILLGPPGAGKGTQAPKLAEKY--CVCHLATGDM
A0A1X7VCJ5_AMPQE      SS---------------------GMRLILLGPPGAGKGTQAPKLVEKF--GICHLSTGDM
A7T0G9_NEMVE          DR---------------------GVRAILLGPPGSGKGTQVKRRRISI--VVCLLFC-DM
A0A1W2WEA2_CIOIN      --------------RK-------GVRAILLGPPGAGKGTQAPKLAEEF--CACHLSTGDM
B3SA53_TRIAD          DKAEE---------RI-------GVNAILLGPPGAGKGTQALRLASRY--CVCHLSTGDM
KAD2_CAEEL            A-TQSAGPT--ETLAR-------GIRAIFIGPPGSGKGTQAPAFAQKY--FSCHLATGDL
A0A2H2IVJ7_CAEJA      A-TQSSGPS--ETLAR-------GIRAIFIGPPGSGKGTQAPEFAQKY--FSCHLATGDL
KAD2_CAEBR            AVTPSTGPS--ETLAR-------GIRAIFIGPPGSGKGTQAPAFASKY--FSCHLATGDL
H3F5G9_PRIPA          PAVPKPGVT--ETVSR-------GIRAILIGPPGAGKGTQAPLLSEKY--QACHLATGDM
KAD2_AEDAE            PEQEQ---------AT-------GINAILLGPPGSGKGTQAPLLKEKF--CVCHLSTGDM
KAD2_ANOGA            PASD----------ST-------GINAILLGPPGSGKGTQAPLLKEKY--CVCHLSTGDM
KAD2_DROME            YEPE----------NI-------GINAILLGPPGSGKGTQAPLLKEKF--CVCHLSTGDM
KAD2_DROPS            YEPQ----------TI-------GINAILLGPPGSGKGTQAPLLKEKY--CVCHLSTGDM
E0W486_PEDHC          GQTN-------------------GINAILLGPPGSGKGTQAPLLVKKF--CVCHLSTGDM
D2Y062_BOMMO          PDED----------PL-------GIRAVLLGPPGSGKGTQAPRLKEKY--CVCHLSTGDM
A0A158NNX3_ATTCE      KLETP---------SS-------GINAVLLGPPGSGKGTQAPLFKDRY--CVCHLSTGDM
KAD2_CANAL            AGIIP------DVPKS--------VRMVLIGPPGAGKGTQAPNLKEKF--CACHLATGDM
KAD2_YARLI            A----KSKIAPEVPKS--------IRMVLIGPPGAGKGTQAPNLVEKY--CACHLATGDM
KAD2_YEAST            -------------SES--------IRMVLIGPPGAGKGTQAPNLQERF--HAAHLATGDM
C0NYE4_AJECG          LLHGGGSSQPKSITDS--------VRMILMGPPGAGKGTQAPKIKDKF--CVCHLATGDM
KAD2_COCIM            LVHGEGSSKVNSLADG--------MRMVLMGPPGAGKGTQAPKIKEKY--CICHLATGDM
KAD2_EMENI            L---GGEPKPKSIAEH--------MRIILMGPPGAGKGTQAPKIKEKY--CVCHLATGDM
KAD2_ASPFU            L---GGESKPKSIAEQ--------MRIVLMGPPGAGKGTQAPRLKEKY--CVCHLATGDM
KAD2_SCLS1            LAHAAGGSAP-SSSEG--------IRMILMGPPGAGKGTQAPKIKEKF--SCCHLATGDM
KAD2_PHANO            LSGHGGGSSS--AQES--------VRMILMGPPGAGKGTQAPRIKEKF--CACHLATGDM
I1S1W3_GIBZE          A-----TGGPVST-DE--------IRMILIGPPGAGKGTQAPKIKERF--SCCHLATGDM
C7Z1B0_NECH7          A-----TGSPVST-EE--------IRMILIGPPGAGKGTQAPKIKEKF--SCCHLATGDM
KAD2_NEUCR            DF----SGKPVTTAEQ--------LRMVLMGPPGAGKGTQAPKIKEKF--NCCHLATGDM
KAD2_COPC7            AKGPASK---TPAQQL---------RTILIGPPGAGKGTQAPRIRDEF--CVCHLATGDM
KAD2_USTMA            ASSTISSITG--STPS-------GVRMILIGPPGAGKGTQAPKILEKFNNCVCHLATGDM
KAD2_CRYNJ            TSTSVSNTISSVTSALSPSSSIKPPRMVLIGPPGAGKGTQAPNISSKY--CICHLATGDM
KAD2_SCHPO            ------------MAGM---------RLILVGPPGAGKGTQAPNIQKKY--GIAHLATGDM
I1CGD1_RHIO9          V--------EEGLPKKQ-------LRMIIMGPPGAGKGTQAPAIKDKF--CACHLATGDM
I1CJM6_RHIO9          V--------EGGLPKQP-------LRMVIMGPPGAGKGTQAPAIKEKY--CACHLATGDM
F4PD49_BATDJ          V--------SAPKNKE--------LRMVIMGPPGAGKGTQAPLIKDTY--CVCHLATGDM
KAD2_DICDI            ------------RDEG--------LRVVFIGPPGSGKGTQAPLVKEDY--CLCHLSTGDM
D3AY59_POLPP          ------------QAEG--------LRIVFIGPPGSGKGTQAPIIKDEY--CVCHLSTGDI
                                               . :::**** *****.           . *   *:

KAD2_HUMAN            LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PLCKNGFLLDGFPRTVRQA
KAD2_PONAB            LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PLCKNGFLLDGFPRTVRQA
F7CAR4_CALJA          LRAMVASGSELGKKLKATMDAGKLMSDEMVVELIEKNLET-PLCKNGFLLDGFPQTMRQA
F6XQ43_CALJA          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCKNGFLLDGFPRTVRQA
G1QSG9_NOMLE          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PLCKNGFLLDGFPRTVRQA
F7H131_MACMU          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PLCKNGFLLDGFPRTVRQA
H2PYL4_PANTR          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PLCKNGFLLDGFPRTVRQA
G3QCW6_GORGO          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PLCKNGFLLDGFPRTVRQA
G1SG80_RABIT          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCKNGFLLDGFPRTVRQA
H0WH97_OTOGA          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCRNGFLLDGFPRTVRQA
I3MQT7_ICTTR          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCKNGFLLDGFPRTVRQA
KAD2_MOUSE            LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCKNGFLLDGFPRTVRQA
KAD2_RAT              LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCKNGFLLDGFPRTVKQA
G3SVV8_LOXAF          LRAMVASGTELGKKLKATMDAGKLVSDEMVVELIEKNLET-PSCKNGFLLDGFPRTVRQA
KAD2_BOVIN            LRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLET-PPCKNGFLLDGFPRTVRQA
G1NU41_MYOLU          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLDT-PPCKNGFLLDGFPRTVRQA
E2RE39_CANLF          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PQCKNGFLLDGFPRTVRQA
F6XJN4_HORSE          LRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET-PPCKNGFLLDGFPRTVRQA
F6VYY4_MONDO          LRAMVASGSELGQRLKKTMDAGKLVSDDMVVELIEKNLDS-PPCKNGFLLDGFPRTVKQA
H2RRV5_TAKRU          LRAMVASGSELGKRLKATMDSGKLVSDEMVVELIEKNLDS-SACKNGFLLDGFPRTVKQA
H3D185_TETNG          LRAMVASGSELGKRLKATMDAGKLVSDEMVVELIEKNLDS-SACKNGFLLDGFPRTVKQA
G3NBD5_GASAC          LRAMVASGSALGKRLKETMDAGKLVSDEMVVELIEKNLDT-PACRKGFLLDGFPRTVKQA
KAD2_DANRE            LRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDT-PACKNGFLLDGFPRTVKQA
KAD2_XENTR            LRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDT-PPCKKGFLLDGFPRTVKQA
E9GFK4_DAPPU          LRAEVASGSDLGKTLKKTMDEGLLVSDELVVNLIDANLSK-PECKNGFLLDGFPRTVVQA
B7PHX7_IXOSC          LRSEVRSGSALGQELKATMESGALVSDDVVVRLVSKSLDA-PECRNGFLLDGFPRTVVQA
C3Y4K4_BRAFL          LRAVVASGSELGKRLKETMDQGKLVSDEMVVEMIDNNLDK-PECKNGFLLDGFPRTVTQA
A0A1X7VCJ5_AMPQE      LRATVASGSELGKKVKGVMDAGKLVDDGLICEMVDQKLKQ-PECKNGFLLDGFPRTIEQA
A7T0G9_NEMVE          LRAVVASGSALGKKVKSVMDAGQLVSDDLVVELIDDNLTK-PECQNGWLLDGFPRTVAQA
A0A1W2WEA2_CIOIN      LRALVAGGSKLGQKVKDIMNRGALVSDDIVVEMINQNLDK-PECSKGFLLDGFPRTVVQA
B3SA53_TRIAD          LRAVVASGSELGGRVKKIIDEGGLVNDSIVVELINENLDQ-PKCKNGFLLDGFPRNTKQA
KAD2_CAEEL            LRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEK-PECKYGFILDGFPRTSGQA
A0A2H2IVJ7_CAEJA      LRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEK-PECKYGFILDGFPRTSGQA
KAD2_CAEBR            LRAEVASGSEFGKQLKATMDAGKLVSDDVVCKLIEQKLEK-PECKYGFILDGFPRTSGQA
H3F5G9_PRIPA          LRAEVASGSELGQRVKKIMADGQLVTDEIVCEMIEANLNK-PPCAKGFILDGFPRTTVQA
KAD2_AEDAE            LRAEIAAGSKLGAQLKKVMDEGKLVSDDLVVDMIDSNLDK-PECKNGFLLDGFPRTVVQA
KAD2_ANOGA            LRAEIASGSKLGAQLKKVMDEGKLVSDELVVDMIDSNLDK-PECRNGFLLDGFPRTVVQA
KAD2_DROME            LRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDK-PECKNGFLLDGFPRTVVQA
KAD2_DROPS            LRAEISSGSKLGTELKKVMDAGKLVSDELVVDMIDSNLDK-PECKNGFLLDGFPRTVVQA
E0W486_PEDHC          LRAEIATGSSLGKELKKTMDEGKLVSDELVVELIDTNMDK-PECKNGWLLDGFPRTVPQA
D2Y062_BOMMO          LRAEVSSGSDLGRRLKKVMDEGKLVSDEMVVDMIDKNLDQ-PECKNGFLLDGFPRTVPQA
A0A158NNX3_ATTCE      LRAEVNSGSALGVQIKKIMDEGKLVSDDLVVSMIQHNLEK-PECKRGFLLDGFPRSVPQA
KAD2_CANAL            LRAQVAAKTALGVEAKKIMDQGGLVSDEIMVNMIKSELENNQECSKGFILDGFPRTIPQA
KAD2_YARLI            LRSQVQQQTPLGVEAKKIMDAGGLVSDDIMVNMIRSELENNSKCKNGFILDGFPRTIPQA
KAD2_YEAST            LRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQA
C0NYE4_AJECG          LRSQVARKTELGKEAKKIMDQGGLVSDEIMVNMIKHELENNKECQNGFILDGFPRTVAQA
KAD2_COCIM            LRSQVQKQTELGKQAKKIMDQGGLVSDDIMVNMIKHELETNQECRNGFILDGFPRTVKQA
KAD2_EMENI            LRSQVAKKTDLGREAKKIMDQGGLVSDEIMVNMIKSELENNAECKNGFILDGFPRTVAQA
KAD2_ASPFU            LRSQVAKKTELGKEAKKIMDQGGLVSDEIMVNMIKNELDTNSECKNGFILDGFPRTVAQA
KAD2_SCLS1            LRSQVAKKTPLGREAKKIMDQGGLVSDEIVIGMIKAELETNQECKGGFILDGFPRTVVQA
KAD2_PHANO            LRAQVAAKTPLGREAKKIMDAGGLVSDEIMVNMIKTELENNQECAKGFILDGFPRTVTQA
I1S1W3_GIBZE          LRSQVTKKTPLGVEAKKIMDAGGLVSDEIMIGMIKEELNNNKECQGGFILDGFPRTVPQA
C7Z1B0_NECH7          LRSQVAKKTPLGVEAKKIMDQGGLVSDEIMIGMIREELNHNQECQGGFILDGFPRTVPQA
KAD2_NEUCR            LRAQVAKGTALGKQAKKIMNEGGLVSDDIVIGMIKDELENNKECQGGFILDGFPRTVPQA
KAD2_COPC7            LRDQVEKKTPLGIAAKKIMDAGGLVSDDIMVNMIKDQLENNEACKNGFVLDGFPRTVPQA
KAD2_USTMA            LREQVSKQTELGKMAKKIMDQGGLVSDEIMVSMIKDQLETNPSCKGGFILDGFPRTTPQA
KAD2_CRYNJ            LREQVARQTELGKAAKQIMDQGGLVSDEIMVGMIKQELEKNAECKNGFILDGFPRTVPQA
KAD2_SCHPO            LRSQVARQTELGKEAKKIMDQGGLVSDDIVTGMIKDEILNNPECKNGFILDGFPRTVVQA
I1CGD1_RHIO9          LRAAVSAKTPLGLAAKKIMDEGGLVSDEIVVGMIEENLDKNPECKNGFILDGFPRTVVQA
I1CJM6_RHIO9          LRAAVASKTPLGLAAKKIMDEGGLVSDEIVVGMIEENLDKNPECKNGFILDGFPRTVVQA
F4PD49_BATDJ          LREAVQAGSELGKQAKKIMDAGGLVSDDIMVGLIKSNIDNNPECKRGFILDGFPRTVPQA
KAD2_DICDI            LRAAIEQGTETGKQAKTIMDQGGLVPDEVMVNMIKENIQT-PECKKGFILDGFPRTVPQA
D3AY59_POLPP          LRAAIEAGTDAGKKAKVVMDQGGLVPDDLVVDMIKDNLEK-PACANGFILDGFPRTVVQA
                      **  :   :  *   *  :  * *: * ::  ::  .:     *  *::*****:.  **

KAD2_HUMAN            EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
KAD2_PONAB            EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
F7CAR4_CALJA          EMLDDLMEKRKERLDSVIEFSIPDS-LLIQRITGRLIHPKNGRSYHEEFNPPKEPMKDDI
F6XQ43_CALJA          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
G1QSG9_NOMLE          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
F7H131_MACMU          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
H2PYL4_PANTR          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
G3QCW6_GORGO          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPNSGRSYHEEFNPPKEPMKDDI
G1SG80_RABIT          EMLDNLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPTSGRSYHEEFNPPKEPMKDDI
H0WH97_OTOGA          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPKSGRSYHEEFNPPREPMKDDI
I3MQT7_ICTTR          EMLDDLMEKRKEKLDSVIEFRIPDS-LLIRRITGRLIHPRSGRSYHEEFNPPKQPMKDDI
KAD2_MOUSE            EMLDDLMEKRKEKLDSVIEFSIQDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDI
KAD2_RAT              EMLDDLMDKRKEKLDSVIEFSIQDS-LLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDI
G3SVV8_LOXAF          EMLDDLMEKRKEKLDSVIEFSIQDS-LLIRRITGRLIHPTSGRSYHEEFSPPKEPMKDDI
KAD2_BOVIN            EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDI
G1NU41_MYOLU          EMLDDLMEKRKEKLDSVIEFRIPDS-LLIRRITGRLIHPLSGRSYHEEFNPPKEPMKDDI
E2RE39_CANLF          EMLDDLMEKRKEKLDSVIEFSIPDS-LLIRRITGRLIHPLSGRSYHEEFNPPKEPMKDDI
F6XJN4_HORSE          EMLDDLMEKRKEKLDSVIEFSVPDS-LLIRRITGRLIHPLSGRSYHEEFNPPKEPMKDDI
F6VYY4_MONDO          EMLDELMDKRNEKLDSVIEFSIADS-LLIRRITGRLIHPASGRSYHEEFNPPKQHMKDDV
H2RRV5_TAKRU          EMLDSLLDKRKEKLDSVIEFVIDDS-LLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDV
H3D185_TETNG          EMLDSLMDKRKETLDSVIEFVIDDS-LLVRRICGRLIHQPSGRSYHEEFNPPKEPMRDDV
G3NBD5_GASAC          QMLDNLLDKRHENLDSVIEFAVDDS-LLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDL
KAD2_DANRE            EMLDDLMEKRSEKLDSVIEFSVDDS-LLVRRICGRLIHQPSGRSYHEEFHPPKEHMKDDV
KAD2_XENTR            EMLDELLEKRQEKLDSVIEFKVDDS-LLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDV
E9GFK4_DAPPU          EKLDGLLSERKKKLDSVIEFGIDDS-LLVRRICGRMIHSASGRSYHEEFHPPKEPMIDDV
B7PHX7_IXOSC          EKLDEMLEKRRTPLDSVAEFSIDDS-LLIRRITGRLTHLPSGRSYHEEFNPPKQPMTDDV
C3Y4K4_BRAFL          KKLDDLLDTRESKLDSVVEFGIDDS-LLVRRICGRLIHKPSGRSYHEEFNPPKVDMTDDV
A0A1X7VCJ5_AMPQE      KMLTDLLKKNGIQLNAVVEFCVTDDQILIDRITGRLLHVPSGRTYHKVNAPPKVPMKDDV
A7T0G9_NEMVE          EKLDGLLEKRNAQLDAVVEFNIADS-LLVKRITGRLLHKSSGRTYHTEFNPPKEHMKDDI
A0A1W2WEA2_CIOIN      EKLDELLEKRNSELDSVIEFGIDDS-LLVSRICGRLLHKPSGRTYHTEFNPPKKSMTDDI
B3SA53_TRIAD          DMLDELLDKRQQKLDSVVEFKIEDS-LLVRRITGRLLHPPSGRVYHEEFNPPKVPLKDDV
KAD2_CAEEL            EKLDEILERRKTPLDTVVEFNIADD-LLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDL
A0A2H2IVJ7_CAEJA      EKLDEILERRKTPLDTVVEFNIADD-LLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDL
KAD2_CAEBR            EKLDEILERRKTPLDTVVEFNIADD-LLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDL
H3F5G9_PRIPA          EKLDALLEKRKTPLDSVIELKIDDE-LLVRRITGRLFHIASGRSYHVEFNPPKLPMIDDI
KAD2_AEDAE            EKLDDLLEKRKTGLDAVVEFGIDDS-LLVRRITGRLIHQASGRSYHEEFAPPKVAMTDDV
KAD2_ANOGA            EKLDNLLEKRNTGLDAVIEFGIDDS-LLVRRITGRLIHQASGRSYHEEFAPPKVPMRDDE
KAD2_DROME            EKLDTLLDKRKTNLDAVIEFAIDDS-LLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDV
KAD2_DROPS            EKLDSLLDKRKANLDAVIEFAIDDS-LLVRRITGRLIHQASGRSYHEEFAPPKVTMKDDI
E0W486_PEDHC          EKLDALLEKKKKNLDAVIEFSIPDD-SLVRRITGRLIHPPSGRSYHEEFHPPLVAMKDDL
D2Y062_BOMMO          EKLDDLLAKRKTALDAVIEFGIEDS-LLVRRITGRLIHPPSGRSYHEEFHPPKKPMTDDV
A0A158NNX3_ATTCE      EKLDEMLNTRKTKLDAVIEFGIEDK-LLIRRITGRLIHLASGRSYHEEFAPPKVPMKDDV
KAD2_CANAL            EKLDSMLESRKTPLEKAVELKIDDE-LLVARITGRLVHPASGRSYHKLFNPPKKDMTDDV
KAD2_YARLI            EKLDEMLAEKKQPLEKAVELKIPDD-LLVARITGRLVHPASGRSYHKVFNPPKKEMIDDI
KAD2_YEAST            EKLDQMLKEQGTPLEKAIELKVDDE-LLVARITGRLIHPASGRSYHKIFNPPKEDMKDDV
C0NYE4_AJECG          ERLDGMLNSRGQKLQHAVELQIDDS-LLVARITGRLVHPASGRSYHKIFNPPKEAMKDDV
KAD2_COCIM            EKLDEMLNARHQKLQHAVELRIDDE-LLVSRITGRLIHPASGRSYHKIFNPPKVPMTDDI
KAD2_EMENI            ERLDEMLVARNQKLQHAIELKIDDA-LLVARITGRLVHPASGRSYHKIFNPPKEAMKDDI
KAD2_ASPFU            ERLDDMLEARNQKLQHAIELQIDDA-LLVARITGRLVHPASGRSYHKIFNPPKNDMKDDV
KAD2_SCLS1            ERLDAMLSARNQKLQHAVELQIDDS-LLVSRITGRLVHPASGRSYHRVFNPPKAEMKDDI
KAD2_PHANO            EKLDGMLEATQKPLQHAVELQIDDQ-LLVSRITGRLVHPASGRSYHKIFNPPKAPMTDDA
I1S1W3_GIBZE          EGLDAMLAERKQKLQHAVELQIDDS-LLVARITGRLVHPASGRSYHTTFNPPKEYMKDDI
C7Z1B0_NECH7          EGLDAMLQERNQKLQHAVELKIDDS-LLVARITGRLVHPASGRSYHTTFNPPKSYMKDDI
KAD2_NEUCR            EGLDAMLRERNLPLQHAVELKIDDS-LLVARITGRLVHPASGRSYHRIFNPPKDDMKDDI
KAD2_COPC7            QKLDGMLAERKEKLDSVVQLLIDDQ-LLISRITGRLIHPASGRSYHKIFNPPKKAGIDDL
KAD2_USTMA            EKLDGMLKQKNQKLDHAVELKINDN-LLISRITGRLVHPASGRSYHKEFSPPKKPMTDDV
KAD2_CRYNJ            SKLDAMLAERKQAIDHAIELKIPDV-LLISRITGRLVHPASGRSYHKEFNPPKKPMTDDI
KAD2_SCHPO            EKLTALLDELKLDLNTVLELQVDDE-LLVRRITGRLVHPGSGRSYHLEFNPPKVPMKDDV
I1CGD1_RHIO9          EKLDEMLDARKKPLNSVVELVIDDN-LLVSRITGRLIHPSSGRTYHREFNPPKVPMKDDV
I1CJM6_RHIO9          EKLDEMLEARKKPLNSVVELVIDDN-LLVSRITGRLIHPESGRTYHREFNPPKVDMKDDV
F4PD49_BATDJ          EKLDSMLEAKGKGLDSAVELVIDDS-LLVSRITGRLIHPASGRSYHREFHPPKVAGKDDV
KAD2_DICDI            EKLDKMLAEDNKKIDHVLDFAIDDS-LLVKRITGRLVHPSSGRSYHREFFPPKVDMIDDI
D3AY59_POLPP          EKLDAMLEQDKKKIDHVLDFSIDDS-LLVRRITGRLVHPASGRSYHKEFFPPKEEMKDDI
                      . *  ::      :: . :: : *   *: ** **: *  .** **    **     ** 

KAD2_HUMAN            TGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF
KAD2_PONAB            TGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF
F7CAR4_CALJA          TGEPLIHRSYDNEEALKICLQAYHTQTTPLIEYYRKRGIHSAIDAYQTPDVMFACILAAF
F6XQ43_CALJA          TGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFACILAAF
G1QSG9_NOMLE          TGEPLIHRSDDNEKTLKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF
F7H131_MACMU          TGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF
H2PYL4_PANTR          TGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF
G3QCW6_GORGO          TGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF
G1SG80_RABIT          TGEPLIRRSDDNEKALKIRLEAYHTQTTPLVEYYRKRGIHAAVDASQTPDVVFACILAAF
H0WH97_OTOGA          TGEPLIRRSDDNEKALKIRLEAYHTQTTPLVEYYRKRGIHSAINASQTPDVVFASILAAF
I3MQT7_ICTTR          TGEPLIRRSDDNEKALKIRLEAYHSQTTPLVEYYRKRGIHSAINASQTPDVVFASILAAF
KAD2_MOUSE            TGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAF
KAD2_RAT              TGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAF
G3SVV8_LOXAF          TGEPLIRRSDDNEKALKIRLEAYHTQTTPLVDYYRKRGIHCAIDASQTPDIVFTSILAAF
KAD2_BOVIN            TGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAF
G1NU41_MYOLU          TGEPLIRRSDDNEKALKIRLEGYHTQTTPLVEYYRKRGIHAAIDASQTPDVVFASILAAF
E2RE39_CANLF          TGEPLVRRSDDNEKALKIRLEAYHTQTTPLVDYYRKRGIHSVIDATQTPDVVFASILAAF
F6XJN4_HORSE          TGEPLIRRSDDNEKALKVRLEAYHTQTTPLVEYYRKRGIHSAIDASQTPDVVFASILAAF
F6VYY4_MONDO          TGEPLIRRSDDNETALKTRLKAYHSQTTPLVKYYSKRGIHSAVDASQSPDVVFAYILAAF
H2RRV5_TAKRU          TGEPLIRRSDDNETTLRSRLDAYHRQTVPLVKYYSALGLHRAIDASKSPTVVLASIIAAF
H3D185_TETNG          TGEPLIRRSDDNETTLRSRLDAYHRQTVPLVKYYSAQGLHRAIDASKKPAVVLASIVAAF
G3NBD5_GASAC          TGEPLIRRSDDNEATLHSRLDSYHRQTAPLVTYYRARGLHTAVNAAQSPDVVFASILAAF
KAD2_DANRE            TGEPLIRRSDDNETTLRSRLESYHRQTSPLVQYYSARGLHTAIDASQSTDLVFASILAAF
KAD2_XENTR            TGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHTAVDAAQSPDVVFASILAAF
E9GFK4_DAPPU          TGEPLIRRSDDNAETLTKRLVSYHQQTSPLVEYYSKKGIHTRVDASLSSHEVFRNIEKIF
B7PHX7_IXOSC          TGEPLVRRSDDNVDALKKRLEVYHKQTSPLVGYYQKRGLHTRIDASLPPKAVFENIRKTF
C3Y4K4_BRAFL          TGEPLIRRSDDNAETLTKRLEAYHTQTKPLVDYYQKRNLHAKVDAAQSPDIVFASIQAIF
A0A1X7VCJ5_AMPQE      TGEDLIHRSDDNEETLKKRLESYHTQTKPLVEYYKEQGLHRCIDANQINDKVWQDLLNAI
A7T0G9_NEMVE          TGEPLERRSDDNEATLTKRLQAYHSQTTPLIDYYTKRGIHHKIDASKPPDTVYSSVLKAF
A0A1W2WEA2_CIOIN      TGEPLIRRADDNESALKTRLAGYHKMTVPLVDYYAKKQLHTRVDASQSPDVVFKSIRATF
B3SA53_TRIAD          TGEPLIKRSDDNETTLMKRLNTYHTVTLPLVDYYKQRGVYSFVNAAMSPDTVFTTIRNIF
KAD2_CAEEL            TGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGVHVAVDAAKPMTDVKAHIDQVF
A0A2H2IVJ7_CAEJA      TGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYQKHGVHVKVDAAKPVADVKAHIDSVF
KAD2_CAEBR            TGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYQKHGVHVKVDAAKPMADVKAHIDSVF
H3F5G9_PRIPA          TGEALVKRSDDNETALRKRLEQYHKMTFPLVEFYGKHHLHHEIDASKSMASVSQQIDAIF
KAD2_AEDAE            TGEPLMRRSDDNAAALVKRLEAYHKQTKPLADYYALRGLHFRVDAAQSASRVFENIDSIF
KAD2_ANOGA            TGEPLMRRSDDNAQALVKRLESYHRQTKPLADYYALRGLHFRVDAAKSASDVFANIDSIF
KAD2_DROME            TGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIF
KAD2_DROPS            TGEPLMRRSDDNAEALKKRLESYHKQTRPLVDYYGLRGLHYKVDAARKSSDVFSTIESIF
E0W486_PEDHC          TGEPLVKRSDDNVDALKKRLEAYHKQTKPLVDYYTIKGVHYKVDASKPAGDVFSEIDSIF
D2Y062_BOMMO          TGEALIKRSDDNVEALKKRLATYHAQTVPLVDYYMRKGLHWRVDASKAADDVFNKIDNIF
A0A158NNX3_ATTCE      TGEPLIKRSDDNEEALKKRLATYHTQTAPLVDYYALQGIHYYINAAQSAEKVFKDIDQIF
KAD2_CANAL            TGEPLVQRSDDNEDALKKRLVTYHKQTEPIVAYYQKTGIWSGVDASQKPTKVWSDILKCL
KAD2_YARLI            TGEALVQRSDDNADALKKRLVSFHKQTEPIVGYYQKTGIWKGVDAAQDPKKVWGDILKCL
KAD2_YEAST            TGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKL
C0NYE4_AJECG          TGEPLIQRSDDNADALKKRLKTYHSQTEPVVGYYKTTGIWKGIDASQEPGQVWKSLLQVF
KAD2_COCIM            TGEPLIQRSDDNVEALKKRLVTYHSQTAPVVGYYKSTGIWKGIDASQEPGQVWKSLLQVF
KAD2_EMENI            TGEPLVQRSDDNAEALKKRLVTYHAQTAPVCDYYKKTGIWRGIDASQEPGQVWKSLLGVF
KAD2_ASPFU            TGEPLIQRSDDNAETLKKRLSTYHAQTAPVVEYYKKTGIWRGIDASQEPGQVWKSLLGVF
KAD2_SCLS1            TGEPLVSRSDDNAEALKKRLVTYHDQTAPVVGYYQKTGIWSGIDASQEPGAVWKSLLGVF
KAD2_PHANO            TGEPLIQRSDDNEETLKKRLSTYHAQTSPVVAYYQKTGIWKPVDASQDPGQVWKSLLKIF
I1S1W3_GIBZE          TGEPLIQRSDDNADALKKRLVTYHKQTKPVVGYYQKTGIWSGLDASQEPGQVWKNMLKVL
C7Z1B0_NECH7          TGEPLIQRSDDNAEALKKRLVTYHKQTEPVVGYYQKTGIWHGVDASQEPGQVWKSMLNIL
KAD2_NEUCR            TGEPLVQRSDDNAEALRKRLETYHKQTAPVVGYYQNTGIWKAIDASQEPAQVWKSLLAIF
KAD2_COPC7            TGEPLIQRSDDNAETLTRRLKTYHTQTGPVVDYYKAKGLWHGVDAAQSPSVVWDSMRGIF
KAD2_USTMA            TGEPLIQRSDDNAETLKKRLATYHAQTAAVTDYYRKQGIWAPVDASQSPKVVWQSIQAIF
KAD2_CRYNJ            TGEPLIQRSDDNVGTLRKRLDTYHAQTGPVVDYYKGTGVWTPVDAAQSPKLVWASISSIL
KAD2_SCHPO            TGEPLIQRSDDNADALRKRLVTYHEQTTPVVEFYKKKGKWAAVDAAQKPEQVWEQIVAIL
I1CGD1_RHIO9          TGEPLIQRSDDNVESLKKRLDAFHKQTVPVVEYYKKKGIWYGVDASQSPKSVWASLGAIF
I1CJM6_RHIO9          TGEPLIQRSDDNVESLKKRLDAFHKQTVPVVDYYKKKGIWYGVDASQSPKSVWASLGAIF
F4PD49_BATDJ          TGEPLIQRTDDNAATLTKRLESYHKLTAPVADYYKRRGIWHGVDAAQSTKLVWASLEAIF
KAD2_DICDI            TGEPLIQRSDDNEEVLKKRLESFHKNTTPVLGYYQNKGILSTIDASKSAPFVSHTIKSIF
D3AY59_POLPP          TGEPLIQRSDDNEAVLTKRLATFHANTTPVLSYYKKQGILSTIDASKSASFVSNHIKAIF
                      *** *  *: **   *   *  :*  * .:  :*        ::*      :   :   :

KAD2_HUMAN            SKA--------TCKDLVMFI----------------
KAD2_PONAB            SKA--------TCKDLVMFI----------------
F7CAR4_CALJA          SKA--------TSYEAVSFI----------------
F6XQ43_CALJA          SKA--------TS-----------------------
G1QSG9_NOMLE          SKA--------TS-----------------------
F7H131_MACMU          SKA--------TS-----------------------
H2PYL4_PANTR          SKA--------TS-----------------------
G3QCW6_GORGO          SKA--------TCKDLVMFI----------------
G1SG80_RABIT          SKA--------TCKDLVMFI----------------
H0WH97_OTOGA          SKA--------TCKDLVMFI----------------
I3MQT7_ICTTR          SKA--------TCKDLVMFI----------------
KAD2_MOUSE            SKA--------TCKDLVMFI----------------
KAD2_RAT              SKA--------TCKDLVMFV----------------
G3SVV8_LOXAF          SKA--------TCKDFVMFI----------------
KAD2_BOVIN            SKA--------TCKDLVMFI----------------
G1NU41_MYOLU          SKA--------TCKDLVMFI----------------
E2RE39_CANLF          SKA--------TCKDLVMFI----------------
F6XJN4_HORSE          SKA--------TS-----------------------
F6VYY4_MONDO          SKA--------TCGASEKQSM---------------
H2RRV5_TAKRU          SAVKETSASTATCKDQVFFI----------------
H3D185_TETNG          SAAKETSAHAATCKDQVFFI----------------
G3NBD5_GASAC          SAATEVPARAVASG----------------------
KAD2_DANRE            SAA--------TCKDLVYFV----------------
KAD2_XENTR            SKA--------RCKDLVLFV----------------
E9GFK4_DAPPU          SGA--------KSKDKVMFI----------------
B7PHX7_IXOSC          EAA--------KSKDYVLFL----------------
C3Y4K4_BRAFL          AQA--------TSKDKVLFM----------------
A0A1X7VCJ5_AMPQE      STK---------------------------------
A7T0G9_NEMVE          DDAVAR-----QSKSL--------------------
A0A1W2WEA2_CIOIN      LKC--------L------------------------
B3SA53_TRIAD          EHS--------KRSQRTASL----------------
KAD2_CAEEL            AKFTQK-----KERVSFV------------------
A0A2H2IVJ7_CAEJA      A-----------------------------------
KAD2_CAEBR            AKFTQK-----KV-----------------------
H3F5G9_PRIPA          SKYTKP-----HQKDRVAHI----------------
KAD2_AEDAE            TSQR-------KARMGL-------------------
KAD2_ANOGA            TKQR-------AHRLGF-------------------
KAD2_DROME            QRKR-------PAQIQL-------------------
KAD2_DROPS            QRQR-------TAQPQS-------------------
E0W486_PEDHC          QKSN-------TQRQKVRAAI---------------
D2Y062_BOMMO          KSRI-------FSRARSAL-----------------
A0A158NNX3_ATTCE      LKST-------KKKGFFSRFF---------------
KAD2_CANAL            GQN---------------------------------
KAD2_YARLI            GQ----------------------------------
KAD2_YEAST            GKD---------------------------------
C0NYE4_AJECG          DADKAASS--SGILGKIGLSK---------------
KAD2_COCIM            EKK---------------------------------
KAD2_EMENI            NNKN--------------------------------
KAD2_ASPFU            QK----------------------------------
KAD2_SCLS1            DKQKAPSG--SLLSKITGRS----------------
KAD2_PHANO            DDKAYVAGRSGSLLNKIGLKN---------------
I1S1W3_GIBZE          NEKRGQN-----------------------------
C7Z1B0_NECH7          NEKRA-------------------------------
KAD2_NEUCR            EGDKAKASSAGSGIMSKIASAAKSS-----------
KAD2_COPC7            AGRK--------------------------------
KAD2_USTMA            DNKQ-------PQPSN--------------------
KAD2_CRYNJ            ESKKN-------------------------------
KAD2_SCHPO            EKAE--------------------------------
I1CGD1_RHIO9          DKTL--------------------------------
I1CJM6_RHIO9          DKTL--------------------------------
F4PD49_BATDJ          AKTT--------------------------------
KAD2_DICDI            LSTLHFPHNASIFKTFHQKMKMQVHSTETPLAAEIL
D3AY59_POLPP          YGSLHFPINSPFLRKQTTTTTTSNLAHATASN----