CLUSTAL format seed alignment for MF_03169

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F6PR96_CIOIN          --------MRLTLLRKAIHAIIMGPPGSGKGTVSARIIRDF-DMQHLSSGDMLRAEIAEQ
H2YJ95_CIOSA          --------MRLTLLRRAVHAIIMGPPGSGKGTVSSRIIRDF-DMQHLSSGDLLRAEIAEE
C3YCI9_BRAFL          ------------MFSKLLRAIIMGPPGSGKGTISGRIVHDF-GMKHLSSGDLLRIQIMNS
E9FWU3_DAPPU          --------MSALRSSPIFRAIILGAPASGKGTISSRIVRDF-KLKHLSGGDLLRSQIGAK
F7AWU9_HORSE          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
B1NI70_PIG            ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
E2RFY9_CANLF          ------------MASKLLRAVILGPPGSGKGTVCQRIAQSF-GLQHLSSGHFLRENIRAN
KAD4_BOVIN            ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
G3T167_LOXAF          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
KAD4_PONAB            ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
F7GT48_CALJA          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
G3SGF3_GORGO          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAS
KAD4_HUMAN            ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAS
H2PZ67_PANTR          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAS
KAD4_MOUSE            ------------MASKLLRAVILGPPGSGKGTVCERIAQNF-GLQHLSSGHLLRENLKTG
KAD4_RAT              ------------MASKLLRAVILGPPGSGKGTVCERIAQNF-GLQHLSSGHLLRENLKTN
G1SYD2_RABIT          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAS
G1PE25_MYOLU          ------------MASKLLRAVILGPPGSGKGTVCQRIAQNF-GLQHLSSGHFLRENIKAN
F7DL73_XENTR          ------------MASKLLRAVILGPPGSGKGTVCQRIAKNF-GLQHLSSGDFLRQNIRAS
H2ZV67_LATCH          -------------MAQLLRAVILGPPGSGKGTISQRIAKSF-GLKHLSSGDFLRENIKRN
H0ZIA7_TAEGU          ------------MASKLLRAVVLGPPGSGKGTVCERIARRF-GLQHLSSGQFLRESLGGG
I3JQB8_ORENI          -------------MAKLFRAAIMGPPGSGKGTISKRIAQSF-GLQYLSSGHFLREGIAAK
H2M295_ORYLA          -------------MAKLFRAAILGPPGSGKGTISKRIAQSF-GLQYVSSGDYLRAGIPAN
H2VE60_TAKRU          -------------MAKLFRAVIMGPPGSGKGTISKRIAQSF-GLEYLSSGHFLRDSVAAN
Q6NUY0_DANRE          -------------MSKLFRAVIMGPPGSGKGTISERIAHNF-GLKHLSSGDFVRENISSK
KAD3_BOVIN            ---------MG-ASARLLRAAIMGAPGSGKGTVSSRITKHF-ELKHLSSGDLLRDNMLRG
F1SK45_PIG            ---------MG-ASARLLRAAIMGAPGSGKGTVSSRITKHF-ELKHLSSGDLLRDNMLRG
G1RC81_NOMLE          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITTHF-ELKHLSSGDLLRDNMLRG
KAD3_PONAB            ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITTHF-ELKHLSSGDLLRDNMLRG
G3S5H3_GORGO          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITTHF-ELKHLSSGDLLRDNMLRG
KAD3_HUMAN            ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITTHF-ELKHLSSGDLLRDNMLRG
F7H3S6_MACMU          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITTHF-QLKHLSSGDLLRDNMLRG
F6WDZ4_CALJA          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITKHF-ELKHLSSGDLLRDNMLRG
H0WWD5_OTOGA          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITKHF-QLKHLSSGDLLRDNMLRG
H0VKB1_CAVPO          ---------MGDVRADCCGAVIMGAPGSGKGTVSSRIVQHF-ELKHLSSGDLLRQNMLQG
I3LVU6_ICTTR          ---------MG-ASARLVRAVIMGAPGSGKGTVSSRITKHF-ELKHLSSGDLLRQNMLQG
KAD3_MOUSE            ---------MG-ASGRLLRAVIMGAPGSGKGTVSSRITKHF-ELKHLSSGDLLRQNMLQG
KAD3_RAT              ---------MG-ASGRLLRAVIMGAPGSGKGTGSSRITKHF-ELKHLSSGDLLRQNMLQG
G1T188_RABIT          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRIIKHF-ELKHLSSGDLLRQNMLRG
E2RH37_CANLF          ---------MG-ASARLLRAVIMGAPGSGKGTVSSRITKHF-ALKHLSSGDLLRDNMLRG
E2QZU8_CANLF          ---------MG-ASVRLLRAVLMGPPGSGKRTVALRITKGF-QLKTFSSGDLLRDNLLRD
F6TLA1_MONDO          ---------MGSAGRVLLRAVIMGPPGSGKGTVSSRIIKHF-DLKHLSSGDLLRDNMNKG
F7DCB5_ORNAN          ---------MN--SGRKFSYSQLGAPGALKPLLKLRQGLGI-ELKLNSLSELLKELFFPS
B5FYH4_TAEGU          -----------MAVPPLLRAVIMGPPGSGKGTVSARIIKHF-GVKHLSSGDLLRDNMQKK
G1KC24_ANOCA          ---------MAAARLRLLRAVIMGPPGSGKGTISGRIVQHF-ALKHLSSGDLLRENMNRK
F7DZ02_XENTR          -----------MVTRMLFRAVIMGPPGSGKGTVSDRIVKNF-ALKHLSSGDLLRTNVQNK
H3A640_LATCH          -----------MVFRVLFRAVIMGPPGSGKGTISDRIVKSF-GLKHLSSGDVLRVNINNT
G3PZP5_GASAC          -----------MVLQRVFRAVIMGPPGSGKGTMSARISKTF-GLKHISSGDILRANIKDQ
I3J7P4_ORENI          -----------MVLPRVIRAVIMGAPGSGKGTVSGRITKTF-GLKHISSGDILRANINAQ
H2M3P6_ORYLA          -----------MVAQRILRAVIMGPPGSGKGTVSARIVKSF-GVKHISSGDILRANIKQQ
F1R4S7_DANRE          -----------MGLQSVFRAVIMGAPGSGKGTVSSRIAQSF-GLKHLSSGDMLRANIEAK
Q17NS5_AEDAE          ------------MSRNLFRAVIMGAPGSGKGTVSARIVKTF-NMKHISSGDMLRNNIEKS
W5JEZ5_ANODA          -----------MASGKLFRAIIMGAPGSGKGTVSARIVKGF-NLKHISSGDLLRSNIAKG
A0A158NSA6_ATTCE      MVAITTCHAAAATALRPLRAVILGAPASGKGTVSSRIVQQF-DVAHISSGDKLRFHVSVG
H9JDC6_BOMMO          ----------MSVKSKLLKALILGAPASGKGTISSRIVKKY-NIEHVSSGDKLRDHIAKQ
Q9VGU6_DROME          ------------MFTKIFRAVIIGAPGSGKGTISELICKNH-GCVHISTGDILRQNIIKN
Q293Z6_DROPS          ------------MYSKIFRAVIIGAPGSGKGTISERIVKTF-GFLHISSGDILRQNIINN
A7S170_NEMVE          ----------------------MGPPGSGKGTVSERIVRDF-GVEHLSSGELLRHHVQNH
B7G252_PHATC          -------------------MLILGKPGGGKGTISGKILKDFPRFHHVSTGDLLRQHVNEG
C0NC46_AJECG          ------MARTVRQLKKAARIILVGAPGVGKGTQTERLIKRYPQLASISSGDLLRENVRSK
A0A0E1RXB3_COCIM      ------MTVLTRSLRKAARIILIGAPGVGKGTQTERLIKRYPQLASISSGDLLRDHVRNR
Q5BGS1_EMENI          ------MTLTTRQLKKAARIILIGAPGVGKGTQTERLLSKFPELASISSGDLLRENVRRR
Q4WK78_ASPFU          ------MNSITRQLKKAARIILIGAPGVGKGTQTERLLARYPELSSISSGDLLRENVRKK
A7EL27_SCLS1          -----------MRLKKAARIILVGAPGVGKGTQAERLLQRFPQLSAISSGDLLRDNVKNR
C7ZNW4_NECH7          -----------MRLNKAARVILFGAPGVGKGTQSERLLARFPQLNSVSTGDLLRRNVKER
Q7SGV3_NEUCR          -----------MALRRAARVILVGAPGVGKGTQSERLLRRFPQLSSISSGDLLRYNVQQR
Q0UU95_PHANO          --------MAFPQLSKAARLILVGAPGVGKGTQTERLMKKFTDLSSISSGDLLRKNVRER
D5GJ36_TUBMM          ---MNTSTRNLSKLKKAARIILVGPPGCGKGTQSGRLLDHF-KLTPISSGDLLRENVRNR
A0A1D8PQH7_CANAL      --------------MNPLRILLLGAPGSGKGTQTSRLLKRFTQLQSLSSGDILRNQIRSG
KAD3_YEAST            ---MKADAKQITHLLKPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE
Q6C0A1_YARLI          ---------MTTALTRSARLLLVGAPGAGKGTLTDRLLTNFSGLEAISTGDLLRREIKNE
                                            .* *.  *                 * .          

F6PR96_CIOIN          STYGTKAKQFIEDGKLVPDALVVELVLSQIQKI---------------------------
H2YJ95_CIOSA          STHGVRAKQYIEEGKLVPDALVVELVLSQIQKI---------------------------
C3YCI9_BRAFL          TAAGLEAKKFIDQGALVPDEVMVQLILNELRE----------------------------
E9FWU3_DAPPU          TEVGLMAKTFMDKGSLVPDDVMSALIINELAL----------------------------
F7AWU9_HORSE          TEVGAMARQYIEKGLLVPDHVITRLMLSELET----------------------------
B1NI70_PIG            TEVGDMAKQYIEKGLLVPDHLITRLMLSELEN----------------------------
E2RFY9_CANLF          TEVGDMAKQYIEKGLLVPDHVITRLMMSELEN----------------------------
KAD4_BOVIN            TEVGDMAKQYIEKGLLVPDHVITRLMLLELEN----------------------------
G3T167_LOXAF          TEVGAMAKQYIGRGLLVPDRVITRLMMSELEN----------------------------
KAD4_PONAB            TEVGEMAKQYIEKSLLVPDHVITRLMMSELEN----------------------------
F7GT48_CALJA          TEVGEMAKQYIEKSLLVPDHVITRLMMSELEN----------------------------
G3SGF3_GORGO          TEVGEMAKQYIEKSLLVPDHVITRLMMSELEN----------------------------
KAD4_HUMAN            TEVGEMAKQYIEKSLLVPDHVITRLMMSELEN----------------------------
H2PZ67_PANTR          TEVGEMAKQYIEKSLLVPDHVITRLMMSELEN----------------------------
KAD4_MOUSE            TEVGDVAKQYLEKGLLVPDHVITRLMMSELET----------------------------
KAD4_RAT              TEVGDVAKQYLEKGLLVPDHVITRLMMSELET----------------------------
G1SYD2_RABIT          TEVGDMAKQYLEKGLLVPDHVITRLMLAELEN----------------------------
G1PE25_MYOLU          TEVGDVAKQYIEKGRLVPDHVITRMMLSELEN----------------------------
F7DL73_XENTR          TEVGVMAKKYLEQGLPVPDSLITRVMLFELET----------------------------
H2ZV67_LATCH          TEVGVMAKQYLENGLLVPDHVITRLMLKEMEK----------------------------
H0ZIA7_TAEGU          GALGRGGQDRVTAVSLMPPTSTSIGLHPRRSP----------------------------
I3JQB8_ORENI          TEAGLLVKTYVERSMLVPDHVMTRLMLPRLEQ----------------------------
H2M295_ORYLA          TEAGVQMKTYIERGLSVPDHVVTGLVLPKLEQ----------------------------
H2VE60_TAKRU          TEAGVLVKSYVDRGILVPDDIITRLMLPRLEQ----------------------------
Q6NUY0_DANRE          TDAGVLAKTYINKGLLVPDHVMTRLLLPRLEE----------------------------
KAD3_BOVIN            TEIGVLAKTFIDQGKLIPDDVMTRLVLHELKN----------------------------
F1SK45_PIG            TEIGVLAKTFIDQGKLIPDDVMTRLVLHELKN----------------------------
G1RC81_NOMLE          TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
KAD3_PONAB            TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
G3S5H3_GORGO          TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
KAD3_HUMAN            TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
F7H3S6_MACMU          TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
F6WDZ4_CALJA          TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
H0WWD5_OTOGA          TEIGVLAKAFIDQGKLIPDDVMTRLALHELKN----------------------------
H0VKB1_CAVPO          TEIGVLAKTFIDQGKLIPDDVMTRLALHELKN----------------------------
I3LVU6_ICTTR          TEIGVLAKTFIDQGKLIPDDVMTRLALHELKN----------------------------
KAD3_MOUSE            TEIGVLAKTFIDQGKLIPDDVMTRLALHELKT----------------------------
KAD3_RAT              TEIAVLAKSFIDQGKLIPDDDMTRLALHELKN----------------------------
G1T188_RABIT          TEIGVLAKTFIDQGKLIPDDVMTRLALHELKN----------------------------
E2RH37_CANLF          TEIGVLAKTFIDQGKLIPDGVMTRLALHELKN----------------------------
E2QZU8_CANLF          TEIGVLAKVFMDQGKLIPDDIMTRLTLHQLKT----------------------------
F6TLA1_MONDO          TEIGVLAKTFIDQGKLIPDDVMTRLALHELKN----------------------------
F7DCB5_ORNAN          VEIGVLAKTFIDQGRLIPDDVMTRLALHQLKS----------------------------
B5FYH4_TAEGU          TEVGILAKSYIDQGQLIPDHIMTQLMLNEIKS----------------------------
G1KC24_ANOCA          TEIGIIAKSYIDQGQLIPDDIMTQLMLNELKS----------------------------
F7DZ02_XENTR          TEIGVVAKSYIDQGQLVPDDVITRLVLQELHK----------------------------
H3A640_LATCH          TEIGLLAKSYIDQGQLVPDEVMTRLIMQELKK----------------------------
G3PZP5_GASAC          TELGLLMKSSIDRGQLVPDDVMSRLMLSDLRA----------------------------
I3J7P4_ORENI          TELGLLMKSCIDQGQLVPDDVMSRLILNDLRA----------------------------
H2M3P6_ORYLA          TELGLLVRSCMDQGQLVPDGLMSRLILKDLKS----------------------------
F1R4S7_DANRE          TDLGLLMKSCIDQGQLVPDDVISRLILSSLRG----------------------------
Q17NS5_AEDAE          TELGKIAEKYIKEGKLVPDIHITKCILGELAQ----------------------------
W5JEZ5_ANODA          TELGRIADKYIKEGKLVPDIYITKCILSELEQ----------------------------
A0A158NSA6_ATTCE      SDLGKEVKKYMDNGSFVPDNTMISLIGNEIGS----------------------------
H9JDC6_BOMMO          TELGKEVKAYLDEGKLVPDDLMIEFMIKELKE----------------------------
Q9VGU6_DROME          TELGKKAKQYIAEGKLVPDAIVTKTMLARITE----------------------------
Q293Z6_DROPS          TDLGKKAQQFINSGQLVPDEIVTKTMLARIRE----------------------------
A7S170_NEMVE          TDLGEEAQAYILKGELVPDELMVDLILHELDA----------------------------
B7G252_PHATC          TQLGKEAKSFMESGKLVPDSLMINLLMDDAKPY-------I-------------------
C0NC46_AJECG          TPLGLKAESTILAGDLVPDNLILDLISSELSSKGWLT------------DPPTATNS---
A0A0E1RXB3_COCIM      TPLGIQAEAAIQAGNLVPDAMILDLISSELASKGWLS------------KPAPGSSSSTA
Q5BGS1_EMENI          TALGREAEATIQAGNLVPDSMILNLISSEFNSRGWLS-------------KSQSSGSS--
Q4WK78_ASPFU          TPLGIKAEAAMQAGNLVPDSMILELISSEFRSKGWLPVTAP-------LATATSNHTSRP
A7EL27_SCLS1          TPLGIKAESTIQSGSLVPDAMILRLILHELKTRGWLFPSST-------PSMTLASSAAFA
C7ZNW4_NECH7          TPLGIKVETTMKSGGLVADDLILRLISNELYTRGWLASRGP---VMTLASEA-TAMGQHS
Q7SGV3_NEUCR          TPLGIKVESVMKSGGLVSDDIILRLISNELTQRGWLNSAHPAGNVLTLASSALSAEGAHS
Q0UU95_PHANO          TPLGIKAEHLMKTGALVPDAMILRLIVNELTTRGWIRDSTIRPYAVYSSSVEMEDTTVDS
D5GJ36_TUBMM          TPLGIQAETVMRSGGLVQDSLMVKLIVGELSKRGWVETRGN-------LTSGICLTGPLS
A0A1D8PQH7_CANAL      SAIGGEAQTYIKNGSLVPDNIMVGLITAELEKKKWLT-----------------------
KAD3_YEAST            STLGREATTYIAQGKLLPDDLITRLITFRLSALGWLK-----------------------
Q6C0A1_YARLI          SKIGVAARSIIKAGGLVPDNTISQLLQTELETKGWLN-----------------------
                         .      :     :                                           

F6PR96_CIOIN          ---------------------------PTSTSWLLDGFPRTIEQAETLSTK-----EKID
H2YJ95_CIOSA          ---------------------------STNTSWLLDGFPRTIEQAKELSKK-----EKLD
C3YCI9_BRAFL          ---------------------------ITNHSWLLDGFPRTVPQAEALSDK-----LDID
E9FWU3_DAPPU          ---------------------------LKQHSWLLDGFPRTLKQAETLNQN-----EHVD
F7AWU9_HORSE          ---------------------------RRGQHWLLDGFPRTLVQAEALDKI-----CALD
B1NI70_PIG            ---------------------------RRGQHWLLDGFPRTLVQAEALDKI-----CDLD
E2RFY9_CANLF          ---------------------------RRLQHWLLDGFPRTLVQAEALDKI-----CELD
KAD4_BOVIN            ---------------------------RRGEHWLLDGFPRTLVQAEALDRL-----CDLD
G3T167_LOXAF          ---------------------------RRSQHWLLDGFPRTLVQAEALDRI-----CELD
KAD4_PONAB            ---------------------------RRGQHWLLDGFPRTLGQAEALDKI-----CEVD
F7GT48_CALJA          ---------------------------RRGQHWLLDGFPRTLGQAEALDKI-----CEMD
G3SGF3_GORGO          ---------------------------RRGQHWLLDGFPRTLGQAEALDKI-----CEVD
KAD4_HUMAN            ---------------------------RRGQHWLLDGFPRTLGQAEALDKI-----CEVD
H2PZ67_PANTR          ---------------------------RRGQHWLLDGFPRTLGQAEALNKI-----CEVD
KAD4_MOUSE            ---------------------------RSAQHWLLDGFPRTLVQAEALDGI-----CDVD
KAD4_RAT              ---------------------------RSAQHWLLDGFPRTLVQAEALDRI-----CDVD
G1SYD2_RABIT          ---------------------------RSGQHWLLDGFPRTLVQAEALNKI-----CDLD
G1PE25_MYOLU          ---------------------------RQDQHWLLDGFPMTLVQAEALDRI-----CDLD
F7DL73_XENTR          ---------------------------MKTQPWLLDGFPRTLAQAEALDKI-----CDLD
H2ZV67_LATCH          ---------------------------MRNQNWLLDGFPRTLTQAEALNNV-----CEVD
H0ZIA7_TAEGU          ---------------------------SSHSHSYTPGFPRTLGQAKALDGI-----CQLD
I3JQB8_ORENI          ---------------------------LSGHSWLLDGFPRTLGQALALNNL-----YQLD
H2M295_ORYLA          ---------------------------LSSHSWLLDGFPRTLAQALVLNNV-----YQLD
H2VE60_TAKRU          ---------------------------LSAHSWLLDGFPRTLVQAQALNRL-----VQLD
Q6NUY0_DANRE          ---------------------------MTKYSWLLDGFPRTLAQAEALNSS-----CDLD
KAD3_BOVIN            ---------------------------LTQYNWLLDGFPRTLPQAEALDRA-----YQID
F1SK45_PIG            ---------------------------LTQYSWLLDGFPRTLLQAEALDRV-----YQLD
G1RC81_NOMLE          ---------------------------LTQYSWLLDGFPRTLPQAEALDRA-----YQID
KAD3_PONAB            ---------------------------LTQYSWLLDGFPRTLPQAEALDRA-----YQID
G3S5H3_GORGO          ---------------------------LTQYSWLLDGFPRTLPQAEALDRA-----YQID
KAD3_HUMAN            ---------------------------LTQYSWLLDGFPRTLPQAEALDRA-----YQID
F7H3S6_MACMU          ---------------------------LTQYSWLLDGFPRTLAQAEALDRA-----YQID
F6WDZ4_CALJA          ---------------------------LTQYNWLLDGFPRTLPQAEALDRA-----YQID
H0WWD5_OTOGA          ---------------------------LTQYSWLLDGFPRTLTQAEALDRA-----YQID
H0VKB1_CAVPO          ---------------------------LTQYNWLLDGFPRTLPQAEALDKA-----YQID
I3LVU6_ICTTR          ---------------------------LTQCNWLLDGFPRTLPQAEALDKV-----YQID
KAD3_MOUSE            ---------------------------LTQCSWLLDGFPRTLPQAEALDKV-----YQID
KAD3_RAT              ---------------------------LTQCSWLLDGFPRTLPQAEALDRV-----YQID
G1T188_RABIT          ---------------------------LTEHSWLLDGFPRTLPQAEALDRA-----YQID
E2RH37_CANLF          ---------------------------LTQYSWLLDGFPRTLPQAEALDGA-----YQID
E2QZU8_CANLF          ---------------------------FTQESWLLCGFPRTLPQAEALERA-----YQIH
F6TLA1_MONDO          ---------------------------LAQYSWLLDGFPRTVPQAEALDKV-----HQID
F7DCB5_ORNAN          ---------------------------IDQYSWLLDGFPRTVSQAEALNKV-----YRID
B5FYH4_TAEGU          ---------------------------LDQHNWLLDGFPRTVAQAEALNKE-----CHID
G1KC24_ANOCA          ---------------------------LEKNNLLLDGFPRTVPQAEALDKV-----CPID
F7DZ02_XENTR          ---------------------------INETNWLLDGFPRTVPQAVALDKA-----FHIN
H3A640_LATCH          ---------------------------LEQHHWLLDGFPRTVPQAEALDKI-----CQIS
G3PZP5_GASAC          ---------------------------LDHSSWLIDGFPRTVSQAEALDDA-----FTVD
I3J7P4_ORENI          ---------------------------IDSSSWLLDGFPRTVSQAEALDDV-----YTLD
H2M3P6_ORYLA          ---------------------------MEHISWLLDGFPRTVSQAEALDQA-----YTLD
F1R4S7_DANRE          ---------------------------LEKTSWLLDGFPRTVAQAEALDCV-----YDVD
Q17NS5_AEDAE          ---------------------------LKSSSWLLDGFPRTPEQAEDLWRQ-----EKID
W5JEZ5_ANODA          ---------------------------IRSHSWLLDGFPRTREQADDLWEQ-----ERID
A0A158NSA6_ATTCE      ---------------------------MTDRNWLLDGFPRTLTQAERLQRL-----HPIN
H9JDC6_BOMMO          ---------------------------VNNKPGLLDGFPRTVEQANALWKV-----QPVD
Q9VGU6_DROME          ---------------------------VGNRSYILDGFPRNIAQAEALAAR-----EQID
Q293Z6_DROPS          ---------------------------VGNKSYILDGFPRNSAQADILSAR-----EQID
A7S170_NEMVE          ---------------------------KKG-NWLLDGFPRTVGQAETLSEK-----HKID
B7G252_PHATC          ---------------------------EEGRSLLLDGFPRTLQQAQALEEV-----AHID
C0NC46_AJECG          -----------------------TPILNPNASFILDGFPRTATQATSLDSL-----IPIN
A0A0E1RXB3_COCIM      -----------------------AASLDPSASFILDGFPRTAIQASSLESL-----VPIN
Q5BGS1_EMENI          --------------------------VSPSASFILDGFPRTASQAASLDSL-----VPIN
Q4WK78_ASPFU          -----------------------STPLSPSASFILDGFPRTAAQALSLDTI-----VPVN
A7EL27_SCLS1          SSSEFDTDLYVEQPSLAEALSPPQTSNEPSASFILDGFPRTAGQAFQLDSL-----IPIN
C7ZNW4_NECH7          YDGAPPVDSFISNPSLFDQHVPPRVSEDPNASFILDGFPRTAAQATPLDKL-----IPIN
Q7SGV3_NEUCR          FQDDAEVAAFLSSPAQARGFMQSQLSNDPAHSFLLDGFPRTATQAKRLDEI-----VPIN
Q0UU95_PHANO          VHIPSEIRT-----------SRYTFSDRPSTSFILDGFPRTAGQAIQLDAI-----VPIN
D5GJ36_TUBMM          VIGGP---------------ITPRASDSPTASFLLDGFPRTKNQAQSLDSE-----VAMN
A0A1D8PQH7_CANAL      ----------------------------QSSSWLLDGFPRTVNQARELDRVIHDR-ANFN
KAD3_YEAST            ----------------------------PSAMWLLDGFPRTTAQASALDELLKQHDASLN
Q6C0A1_YARLI          ----------------------------ADSSWILDGFPRNRAQAEVLDEMLLPHKANLS
                                                          *** .  **  *          . 

F6PR96_CIOIN          CVINLDVPFETIRERLSGRWTHLSSGRVYNDGFNPPKIPGVDDLTGEPLVQRDDDKPETV
H2YJ95_CIOSA          CVINLDVPFNTIRERLSGRWTHLSSGRVYNDGFNPPKVPGVDDITGEPLVQRNDDKPETV
C3YCI9_BRAFL          VVMNLDVPFETIKQRLTARWVHPGSGRVYNLDWNPPQIPGKDDVTGEELIQRDDDKPETV
E9FWU3_DAPPU          VVISLDVPEEEIVQRIAGRWTHISSGRVYNTEFNPPKVPGIDDVTGEKLIQRDDDKPEAV
F7AWU9_HORSE          LVITLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDITGEPLIQQEDDKPEAV
B1NI70_PIG            LVITLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPHVHGIDDITGEPLIQQEDDKPEAV
E2RFY9_CANLF          LVITLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDITGEPLVQQEDDKPEAV
KAD4_BOVIN            LVITLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGMDDVTGEPLVQQEDDKPEAV
G3T167_LOXAF          LVITLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAV
KAD4_PONAB            LVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAV
F7GT48_CALJA          LVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAV
G3SGF3_GORGO          LVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAV
KAD4_HUMAN            LVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAV
H2PZ67_PANTR          LVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAV
KAD4_MOUSE            LVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAV
KAD4_RAT              LVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVLGVDDITGEPLVQQEDDKPEAL
G1SYD2_RABIT          LVITLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVPGIDDITGEPLIQQEDDKPEAV
G1PE25_MYOLU          LVITLNIPFETLRDRLSRRWIHPPSGRVYNLDFNPPLVHGVDDVTGERLVQQEDDKPEAV
F7DL73_XENTR          LVISLNIPFETLKDRLNTRWIHQPSGRVYNLEFNPPHVQGIDDISGEPLIQQEHDKPDAV
H2ZV67_LATCH          FVITLNIPFETLKDRLSTRWIHPPSGRVYNLEFNPPHIHGIDDITGEPLVQQDDDKPEAV
H0ZIA7_TAEGU          LVISLNIPFETLKDRLSARWVHPASGRVYNMDFNPPHTQGVDDLTGEPLVQREDDRPEAV
I3JQB8_ORENI          LVISLNIPYETLKERLSDRWIHPASGRVYNMGFNPPQVQGKDDITGEPLIQHDDDKPEAL
H2M295_ORYLA          LVISLNIPYETLKDRLSDRWIHPASGRVYNMSFNPPRVQGKDDITGEPLIQHDDDKPEAL
H2VE60_TAKRU          LVIILNVPYATLTERLSHRWIHPPSGRVYNMGFNPPRVQGKDDVTGEPLVQHDDDKPEAL
Q6NUY0_DANRE          VAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEAL
KAD3_BOVIN            TVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETV
F1SK45_PIG            TVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTVGIDDITGEPLVQREDDKPETV
G1RC81_NOMLE          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
KAD3_PONAB            TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
G3S5H3_GORGO          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
KAD3_HUMAN            TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
F7H3S6_MACMU          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
F6WDZ4_CALJA          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
H0WWD5_OTOGA          TVINLDVPFDVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDVTGEPLIQREDDRPETV
H0VKB1_CAVPO          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
I3LVU6_ICTTR          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDRPDTV
KAD3_MOUSE            TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
KAD3_RAT              TVINLNVPFEVIKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
G1T188_RABIT          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETV
E2RH37_CANLF          TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKAVGIDDLTGEPLIQRDDDKPETV
E2QZU8_CANLF          LVMSLNVPSEVIKQRLSARWIHPSSGRVYNLEFNPPKAIGLDDLTGEPLVQREDDRPETL
F6TLA1_MONDO          TVIDLNVPFEIIKQRLTSRWIHPSSGRVYNTEFNPPKKIGIDDITGEPLIQREDDKPETV
F7DCB5_ORNAN          TVINLNVPFETIKQRLTARWIHPASGRVYNTEFNPPKVPGHDDLTGEPLTQREDDKPETV
B5FYH4_TAEGU          TVIDLDVPFETIKCRLTARWIHPASGRVYNLEFSPPKVQGIDDITGEPLVQRDDDKPETV
G1KC24_ANOCA          TVIDLDVPFETIQQRLTARWIHPNSGRVYNLEFNPPKVSGVDDDTGESLIQRDDDKPETV
F7DZ02_XENTR          SVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQREDDKPETV
H3A640_LATCH          TVINLDVPFDIIYQRLTSRWIHAASGRVYNTDFNPPKVPGIDDLTGEPLIQRNDDKPETV
G3PZP5_GASAC          TVINLNVPFQTIKQRLSSRWTHLSSGRVYNVDFNPPKVPGLDDVTGETLVQREDDTPETV
I3J7P4_ORENI          TVINLNVPFQTIKQRLTSRWTHLPSGRVYNTDFNPPKVPGFDDETGEPLFQRDDDRPETV
H2M3P6_ORYLA          TVINLNVPFQTIKERLTSRWTHISSGRVYNTDFNPPKVPGFDDVTGEPLVQRDDDKPDTV
F1R4S7_DANRE          SVINLDVPFQTIRERLTSRWVHLPSGRVYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETV
Q17NS5_AEDAE          SVINLDVPFDVIVDRLRSRWVHLPSGRVYNIGFNDPKVPGKDDVTGEPLSQRPDDDPVAV
W5JEZ5_ANODA          SVINLDVPFEVIIDRIQSRWVHLPSGRVYNVGFNDPKEPGRDDVTGEPLSQRPDDNPVAV
A0A158NSA6_ATTCE      LVLNLVVPTIVILDRVKSRWVHMPSGRVYNIGFNDPRVPGKDDITGELLCQREDDKPEVV
H9JDC6_BOMMO          VVLNLVVPFDVIIDRVKSRWVHLPSGRVYNIGFNTPKQEGKDDVTGEPLVQRPDDKPEAV
Q9VGU6_DROME          AVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVV
Q293Z6_DROPS          AVINLNIPHDVIICRVKNRWIHAPSGRVYNIGFDDPKVPGKDDVTGEPLTQREDDKPEVV
A7S170_NEMVE          VVVNMDVPFATIVDRIKQRWVHAVSGRVYNLEFNPPKVEGKDDITGEPLTQREDDKPETV
B7G252_PHATC          TVVNLDIPTNTIVERIADRWIHPASGRIYSYSYKPPKAVGKDDVTGEPLVQRDDDKPESV
C0NC46_AJECG          LVVHLLTPPAIIISRIASRWVHAPSGRVYNTQFNAPKEPGKDDVTGEPLVQRADDSIETW
A0A0E1RXB3_COCIM      LVVQLLTPPAVILSRIASRWVHPASGRVYNTEFNAPKVPGKDDITGEALVQRQDDSTDVW
Q5BGS1_EMENI          FVVHLVTPPSIILSRIASRWVHEPSGRVYNTDFNAPKVPGKDDVTGEPLTQREDDSIETW
Q4WK78_ASPFU          FVVHLVTPPSVILSRIASRWVHEPSGRVYNTDFNVPKVPGKDDVTGEPLTQRQDDSVDTW
A7EL27_SCLS1          LVVSLKTPASVILERIAGRWVHAPSGRVYNTTFHAPKVPGLDDITGEKLTKRPDDCEETW
C7ZNW4_NECH7          LVVSLKTPVSVILERIAGRWVHEPSGRVYNTSFNAPRVPGIDDVTGEPLIQRADDSEEVY
Q7SGV3_NEUCR          LVVSLKTPVEVILERISGRWVHEPSGRVYNTTFNAPKVPGIDDVTGEPLVRRADDDEKVY
Q0UU95_PHANO          LVVNLNTPTDIIIDRICNRWVHEPSGRVYNTTFNAPKVEGKDDVTGEPLTRRADDDPEVW
D5GJ36_TUBMM          LVVNLDVPHDVILDRIANRLVHEPSGRVYNMTWNKPKNPGVDDVTGEPLTRRPDDCPETF
A0A1D8PQH7_CANAL      LVVELDVDQKVILQRIEARWIHEASGRVYNLDYNPPKVPFKDDVTGEALTKRQDDTAQVF
KAD3_YEAST            LVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVF
Q6C0A1_YARLI          HVVQLDVPEEVILDRIENRWVHLASGRIYNLTFNPPKVAGKDDVTGEPLSKREDDKPEVF
                       .: :      :  *:  *  *  ***:*.  :  *     ** :** * :: .*     

F6PR96_CIOIN          QKRLETYQLQTAPLLDFYREKGLLHSYSGTKTDEIWPKVKEFLSTTIMPHVNRSRL----
H2YJ95_CIOSA          QKRLETYQLQTAPLLDFYGEKGLLHSYSGTKTDEIWPKVKEFLNS-IMPQGNRSRL----
C3YCI9_BRAFL          TARLRNYENQTKPLLQFYSAAGKLVSFHGTESNIIYPKVKDFLATKIPAVADQSQSVKQ-
E9FWU3_DAPPU          RQRLQTYEANIKPILEFYDGHGILKLFKGRFTNEIWPKVHGFLSESIPKSN---------
F7AWU9_HORSE          AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPVQSKEAQ----
B1NI70_PIG            AARLRQYKDVAKPVIELYKGRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
E2RFY9_CANLF          AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
KAD4_BOVIN            AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPVQSKEAY----
G3T167_LOXAF          AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNNIWPYVYTLFSNKITPVESKEAY----
KAD4_PONAB            AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
F7GT48_CALJA          AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
G3SGF3_GORGO          AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
KAD4_HUMAN            AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
H2PZ67_PANTR          AARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY----
KAD4_MOUSE            AARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY----
KAD4_RAT              AARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY----
G1SYD2_RABIT          AARLRRYKDAAKPVIELYKSQGVLHQFSGTETNKIWPYVYTLFSNKIAPIQSKEAY----
G1PE25_MYOLU          NVRLRQYKEVAKPVVKLYKSRGVLHQFSGTDTDKIWPCVYTVFSNKITPIQSREAC----
F7DL73_XENTR          ISRLRQYKDVAKPVIELYKNKGILHTFSGTETNRIWPYIYTLLSTKITPVHPEDTSQTFC
H2ZV67_LATCH          VARLRQYKDVAKPVIELYKNKGVLHVFSGTETNKIWPYIYSMLCTKITPAHPDESHSFHN
H0ZIA7_TAEGU          AARLRKYKDAAKPVMELYKSRGILHSFSGTETNKIWPYVYTLLSSRIPPVLPEEEH----
I3JQB8_ORENI          MARLRHYKDVAKPVIDLYKSQGILHSFSGTETDRIWPYINSLLSTKMHTQPSDTCQAQTP
H2M295_ORYLA          MSRLRQYKEVAKPVIDLYKTQGILHSFSGTETNKIWPYINSLLSTKLNRQPSDAHQTP--
H2VE60_TAKRU          MARLRHYKDVAKPVMDLYKSKGILYSFSGTDTDRIWPYISSLLVTKLHTQSTDSFQTHTP
Q6NUY0_DANRE          VARLRHYKDVAKPVIDFYKAKGILYTFSDTETDRIWPNINTLLSTKIPAIQSDARCASTR
KAD3_BOVIN            VKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP--
F1SK45_PIG            VKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKVPQINQKTSVPP--
G1RC81_NOMLE          NKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQTSQKASVTP--
KAD3_PONAB            IKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKVWPYVYAFLQTKVPQTSQKASVTP--
G3S5H3_GORGO          IKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP--
KAD3_HUMAN            IKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP--
F7H3S6_MACMU          IKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQTSQKASVTP--
F6WDZ4_CALJA          IKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQTSQKASVTP--
H0WWD5_OTOGA          IKRLKAYEAQTKPVLEYYQKKGVLETFSGTETDKIWPHVYAFLQTKVPQTNQKASVTP--
H0VKB1_CAVPO          IKRLKAYEAQTEPVLEYYQKKGVLETFSGTETNKIWPHVYAFLQTKVPQTNQKASVTP--
I3LVU6_ICTTR          IKRLKAYEAQTEPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQTNQKASVTP--
KAD3_MOUSE            IKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQTKVPETTQKASVTP--
KAD3_RAT              IKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIRPHVYSFLQMKVPETIQKASVTP--
G1T188_RABIT          IKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPNVYAFLQTKIPEAHQKDSVTP--
E2RH37_CANLF          VKRLKAYEVQTQPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKVPQINQKASVTP--
E2QZU8_CANLF          NQRLKAYEDQTKPVLEYYREKGVLETFSGTKTDQIWPCVRAFLQTKVPQIDQKASVTP--
F6TLA1_MONDO          TKRLKAYEAQTKPVLEYYRNKGVLETFSGTETNKIWPQVYAFLQTKLPDISEKEASTP--
F7DCB5_ORNAN          AKRLKAYEAQTKPVLEYYQKKGVLQSFSGTETNMLWPHVYAFLQTKLADGSPKKQITV--
B5FYH4_TAEGU          SKRLQAYDAQTKPVLEYYRKKGLLKSFSGTETNKIWPHIYAFLQTKLPDVSQKDAAKPR-
G1KC24_ANOCA          MKRLKSYEAQTRPVLQYYRQKGVLKSFAGTETNKIWPHVHRFLQTKLPEIVFMTAEITT-
F7DZ02_XENTR          TRRLKGYEALTRPVLEYYQNKGVLETFSGTETNKIWPHVYAFLQSKLPDVSHNKAY----
H3A640_LATCH          TKRLNAYEAQTKPVLEYYRTKGILETFSGTETNKIWPRVHAYLASKLPDVSRQEAANQV-
G3PZP5_GASAC          TRRLKAYQNQTEPVLEFYRSKGVLEIFSGTETNKIWPHVEAFLRRKVSPVEQTAA-----
I3J7P4_ORENI          TRRLKSYETQTEPVLEYYRSKGVLETFSGTETNKIWPHVEVFLQRKLSSINQKDCLFTP-
H2M3P6_ORYLA          TQRLKAYETQTQPVLEFYRSKGVVKTFTGTETNKIWPHVEEFLHQRISLD----------
F1R4S7_DANRE          SRRLKDYERQTQPVLEYYRSKGVLETFSGTETNKIWPHVHTFLSRKIPGHKQAMGKA---
Q17NS5_AEDAE          RKRLEIYDACTRPLNEYFHQQGVLVTFSGKTTDEIWPNVKKYLESKIVKS----------
W5JEZ5_ANODA          RKRLEVYDACTKPINEYFERKGVLATFKGSTTDEIWPHVKKYLETKLQ------------
A0A158NSA6_ATTCE      QKRLQDYAMKTEPVLQFYREIGILREFHGNTTNEMWPAIRNCVAQYCWSSERSNI-----
H9JDC6_BOMMO          KKRLEIYENITRPVIEFYKQKGILKEFEGRTSDEIWPKVTKYLDPIFK------------
Q9VGU6_DROME          AKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFLNDRINA-----------
Q293Z6_DROPS          AKRLQLYDELMSPVLAWYAERGLVTSFKGRETKEIWPRVERFLKDKVQG-----------
A7S170_NEMVE          MARLKKYEEQTKPLIEYYNKKGVLASFSGTETNVIWPRVKKYLQENHYKL----------
B7G252_PHATC          RTRLAAYDKVTAPLVDWYRRKGLVQTFRGTESDVIYPQVKAYLEEKNF------------
C0NC46_AJECG          KQRLRKFEETSRSLLEHYERRGCLWRVEGESSDEISPKLFAEIERRFS------------
A0A0E1RXB3_COCIM      KERFKKFEETSQSLLDHYEKQGCLWRVEGNSSDEISPKLFAEVERRFG------------
Q5BGS1_EMENI          KQRLHKFEETSKALLQHYQQKGCLWRVEGNSSDEITPKLLAEFERKFC------------
Q4WK78_ASPFU          KQRLHKFEETSKALLQYYERKGCLWRVEGDSSDEISPKLFAEIERRFC------------
A7EL27_SCLS1          KTRLKKFEETSEPLLEHYARKGVLWEVEGNSSDEISPKLYQEFERRFAEI----------
C7ZNW4_NECH7          RARFKKFQETSEPVLNHYAQKGVLVEIEGMSSDEISPKLFHEFEKRFVD-----------
Q7SGV3_NEUCR          LARYKKFQETAEPLLEHYARQGVLWEVEGMSSDEITPKLISEFERHFVE-----------
Q0UU95_PHANO          KARLKRFKENNEPLLEHYDKLGVLWEVKGNSSDEITPKLFEEFSRRFGAES---------
D5GJ36_TUBMM          SKRLKNYAEATGPLLEHYDKAGVLWTVSGSTSDEITPQLDAEILKRFG------------
A0A1D8PQH7_CANAL      QKRLDQYNEEIEPLKVFYKQQGLLYTVSGDTSDIIYPKLENLIVDKIM------------
KAD3_YEAST            KKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY---------------------
Q6C0A1_YARLI          KKRLVAYKQETEPLFEFYEKRGVLVTLKGETSNIIWPKLEQLIKTEYC------------
                        *   :     .:   :   * .    .  :. :                         

F6PR96_CIOIN          ----
H2YJ95_CIOSA          ----
C3YCI9_BRAFL          ----
E9FWU3_DAPPU          ----
F7AWU9_HORSE          ----
B1NI70_PIG            ----
E2RFY9_CANLF          ----
KAD4_BOVIN            ----
G3T167_LOXAF          ----
KAD4_PONAB            ----
F7GT48_CALJA          ----
G3SGF3_GORGO          ----
KAD4_HUMAN            ----
H2PZ67_PANTR          ----
KAD4_MOUSE            ----
KAD4_RAT              ----
G1SYD2_RABIT          ----
G1PE25_MYOLU          ----
F7DL73_XENTR          AEEH
H2ZV67_LATCH          QQN-
H0ZIA7_TAEGU          ----
I3JQB8_ORENI          ----
H2M295_ORYLA          ----
H2VE60_TAKRU          ----
Q6NUY0_DANRE          ----
KAD3_BOVIN            ----
F1SK45_PIG            ----
G1RC81_NOMLE          ----
KAD3_PONAB            ----
G3S5H3_GORGO          ----
KAD3_HUMAN            ----
F7H3S6_MACMU          ----
F6WDZ4_CALJA          ----
H0WWD5_OTOGA          ----
H0VKB1_CAVPO          ----
I3LVU6_ICTTR          ----
KAD3_MOUSE            ----
KAD3_RAT              ----
G1T188_RABIT          ----
E2RH37_CANLF          ----
E2QZU8_CANLF          ----
F6TLA1_MONDO          ----
F7DCB5_ORNAN          ----
B5FYH4_TAEGU          ----
G1KC24_ANOCA          ----
F7DZ02_XENTR          ----
H3A640_LATCH          ----
G3PZP5_GASAC          ----
I3J7P4_ORENI          ----
H2M3P6_ORYLA          ----
F1R4S7_DANRE          ----
Q17NS5_AEDAE          ----
W5JEZ5_ANODA          ----
A0A158NSA6_ATTCE      ----
H9JDC6_BOMMO          ----
Q9VGU6_DROME          ----
Q293Z6_DROPS          ----
A7S170_NEMVE          ----
B7G252_PHATC          ----
C0NC46_AJECG          ----
A0A0E1RXB3_COCIM      ----
Q5BGS1_EMENI          ----
Q4WK78_ASPFU          ----
A7EL27_SCLS1          ----
C7ZNW4_NECH7          ----
Q7SGV3_NEUCR          ----
Q0UU95_PHANO          ----
D5GJ36_TUBMM          ----
A0A1D8PQH7_CANAL      ----
KAD3_YEAST            ----
Q6C0A1_YARLI          ----