CLUSTAL format seed alignment for MF_03175

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MAP2_ENCCU        ------------------------------------------------------------
MAP2_ENCIT        ------------------------------------------------------------
C4V7C3_NOSCE      ------------------------------------------------------------
MAP2_HUMAN        MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
MAP2_BOVIN        MAGVEEAASCGSHLNGDLDPDEREEGAASTAEEAAKKKKRKKKKSKG-AATGQQEPDKEA
MAP2_MOUSE        MAGVEQAASFGGHLNGDLDPDDREEGTSSTAEEAAKKKRRKKKKGKGAVSAVQQELDKES
MAP2_RAT          MAGVEEASSFGGHLNRDLDPDDREEGTSSTAEEAAKKKRRKKKKGKGAVSAGQQELDKES
A8XIH4_CAEBR      -----------------MPPANG-------------------KKGKKGGAAAKAAPEEDF
Q9U2V9_CAEEL      -----------------MPPANG-------------------KKGKKGGAAKAAAPEEDF
MAP21_ARATH       -----------------MAIGNPE-------------VATMGK--ENTEAESSNGNESQL
MAP22_ARATH       -----------------MASESPD-------------VAVVAPVVENGGAESSNGKEEQL
MAP2_DICDI        -----------------MSEIQPK-----------------TEVPPKTVEEEEESDDEED
MAP2_PUCGT        ----------MTIPVPKPAHPAAP-------------DTNTDGLPNPKVVVPVEADEEED
MAP2_SCHPO        -------------------MTSAT-------------TTEATAKDLQEKLSLKENDVVED
MAP2_YEAST        -------------------MTDAE-------------IENSPASDLKELNLENEGVEQQD
MAP2_CANAL        ----------------MAGVTEGE-------------DTKVIESKINELNIDKPKLEDNN
MAP2_YARLI        ----------------MAEAIEKV-------------ADKVADLVVDDKPAAVPESTSDH
MAP21_AJECG       -----------------MAAQV---------------IPELQSLNLKTEGGALPQELAPS
J3KCU9_COCIM      ---------------MKMAVQA---------------LPEINKLSVSEEGAANAAAKGQA
MAP21_EMENI       -----------------MAAQA---------------SEKLEKLDLNGQNGESAAGPAKA
MAP23_ASPFU       -----------------MAAQV---------------SEKLQDLHLNGLNGDAKSNATVI
MAP2_PHANO        -----------------MAAQV---------------ADGVADLKLDDTK-----SKPTN
MAP2_SCLS1        -----------------MAAQV---------------TDALKNLKVKDPN-SVIESAAEA
I1S0T2_GIBZE      -----------------MAAQV-P-------------TEALKELNVADGSQKPGANAQSN
MAP21_NECH7       -----------------MAAQV-P-------------TEALKELNVAEGSQKPGATAQSK
MAP2_NEUCR        -----------------MAAQAAP-------------AEELSKLSVDETKPAPAAANGND
MAP21_ASPFU       -----------------MTVDA---------------PELLEKLRITDAGANGADMSSST
MAP22_AJECG       -----------------MGSKTPH-------------NHRRGPNE--SSSPPAIDAINPP
J3KJV5_COCIM      -----------------MGSKTPH-------------DHRRSPNE--SSAHAAIAAVSLP
MAP22_ASPFU       -----------------MGSKSPE-------------GHRQAPHA--SNCNELKPANPDP
I1RR51_GIBZE      -----------------MGAKTSE-------------DDYNGGNGQGPLSSKPSSAGGEP
MAP22_NECH7       -----------------MGAKISE-------------DHPPQGNG-GPLSNDPCSAGGEP
MAP22_EMENI       -----------------MGSKTPE-------------RDGHKGQE-NTTGPVECPLGGMP
Q4QCC5_LEIMA      -----------------MPPKISAK------------SKQQPKQQGGNKKGKGSNDDGDD
A8BPF2_GIAIC      ----------------------------MVLWKNNCTGFFIFLLFHLSFTLWMALIDSNP
E1F0V2_GIAIA      ----------------------------------------------------MALIDSNP
                                                                              

MAP2_ENCCU        ------------------------------------------------------------
MAP2_ENCIT        ------------------------------------------------------------
C4V7C3_NOSCE      ------------------------------------------------------------
MAP2_HUMAN        --------GASVDEVAR-----QLERSALEDKERDEDDEDGDGDGDGA------------
MAP2_BOVIN        --------GASVDEVTR-----QLERQALEEKEKDDDDEDGDGDGDGA------------
MAP2_MOUSE        --------GALVDEVAK-----QLESQALEEKERDDDDEDGDGDADGA------------
MAP2_RAT          --------GTSVDEVAK-----QLERQALEEKEKDDDDEDGDGDGDGA------------
A8XIH4_CAEBR      --------DAILAEMAL-----ADKKEAAKSTAK---AAGGK-KGGSK------------
Q9U2V9_CAEEL      --------DAILAEMQL-----ADAKTAAKEATKK-DAKGGKGKANGS------------
MAP21_ARATH       --------SSDLTKSLD-----LAEVKEDEKDNNQEEEDGLKAEASTK------------
MAP22_ARATH       --------ESELSKKLE-----IAEDGQEENDG----EEGSKAETSTK------------
MAP2_DICDI        --------NTKVTEGGN-----PTGGEGAAKKKKK-KNKKKKKAAPVA------------
MAP2_PUCGT        --------DDDEEGK-------EDADGAVPAASH----FSTHALDGTK------------
MAP2_SCHPO        --------DGKVE----------ENDAAEEGAS-----------NGEK------------
MAP2_YEAST        --------QAKAD----------ESDPVES------------------------------
MAP2_CANAL        --------EAKGNGNGNESGDDDDDDKEEDDDNEIT-EPSTSTASGDE------------
MAP2_YARLI        --------EDGDD----------NDDAVNEGE----------AVDGEK------------
MAP21_AJECG       --------GAPENEDG------DSEDDNGDDQGAD--ESRTIEVLAAK------------
J3KCU9_COCIM      --------AQGTAGND------DAENDESDEDKED--EQEVADGAAAAG-----------
MAP21_EMENI       --------GQADAGEV------EDESDDDADDAGA--AADGAANGAAK------------
MAP23_ASPFU       --------GQTEAGEA------EDDSDDEKEDGNT--APEAGAGGGAYLHVWVIFEMPVS
MAP2_PHANO        --------GTTQNGDA------EHEDSDDDNEGEE--GAAEGGEGAAK------------
MAP2_SCLS1        --------KSNGNTQA------EAEDSDDEEEEPV--NGEGAGEGGAK------------
I1S0T2_GIBZE      --------TDAAGD--------DHGGDDSEDE----ADGAAPAEGAAK------------
MAP21_NECH7       --------TDAAGD--------EHGGDDSEDEADGHVDGAAPTGEATK------------
MAP2_NEUCR        --------SDAES------------GDEEAEE-----GAAAPAAGAAK------------
MAP21_ASPFU       --------SAAANGTG------KEVDDGSDDDGTENPPAVAAEHSTAK------------
MAP22_AJECG       ---KQAAASGLVHGSL------EGESEGGEDEDDDKPGADLKAVGQIG------------
J3KJV5_COCIM      ---KPAATSGLFHGPL------EGEGEDGENGEDDEIRADLKSSGQP-------------
MAP22_ASPFU       QISQNGSGSADLDRGV------IGDDDDDEDAEENGVNTETPNVGKLNQPPFPNLDQVHV
I1RR51_GIBZE      ---RGAHFARDGDGSL------GGEGGDDDDDDDINATTGSIIVDGAG------------
MAP22_NECH7       ---RGAHLSRDGDGSV------GDKGGDDDDDDDEGVVGAVSLTEASD------------
MAP22_EMENI       ---RGMHLATDGDGTI------GDSG---DDDDGEAHSTALINANANG------------
Q4QCC5_LEIMA      ---FDAMLAAAVNASKADAAKNHSNNHQGKRSSNGYGAAPVSRSLAADE-----------
A8BPF2_GIAIC      ------------------------------------------------------------
E1F0V2_GIAIA      ------------------------------------------------------------
                                                                              

MAP2_ENCCU        ------------------MKCILLNQAE--------------ELPIEFLPKDGVYGKGKL
MAP2_ENCIT        ------------------MKFILIDQAP--------------ELPIEFLPKGDCYRKGRL
C4V7C3_NOSCE      ------------------MKLLQINSVE--------------EKPIEFLEKSDQYRKNIL
MAP2_HUMAN        --------------TGKKKKKKKKKRGP-------KVQTDPPSVPICDLYPNGVFPKGQE
MAP2_BOVIN        --------------TGKKKKKKKKKRGP-------KVQTDPPSVPICDLYPNGVFPKGQE
MAP2_MOUSE        --------------TGKKKKKKKKKRGP-------KVQTDPPSVPICDLYPNGVFPKGQE
MAP2_RAT          --------------AGKKKKKKKKKRGP-------RVQTDPPSVPICDLYPNGVFPKGQE
A8XIH4_CAEBR      --------------SNDAAAPEAVKQAW-------QAEI-AAMTPIDEQFPDGKFPHSKD
Q9U2V9_CAEEL      --------------AAATAAPEEAKQAW-------QAEI-AAMKPIDEQFPDGKFPHGID
MAP21_ARATH       --------------KKKKKSKSKKKKSS-------LQQTDPPSIPVLELFPSGDFPQGEI
MAP22_ARATH       --------------KKKKKNKSKKKKEL-------PQQTDPPSIPVVELFPSGEFPEGEI
MAP2_DICDI        --------------SAADIIDSKPIPSG-------LVQTNPPTIPVSKQFSNGVYPMGEI
MAP2_PUCGT        --------------KKKKKKKKPKKKKTGEAG--AGGQSEPPRVPVSKLFPNGNYPSGEE
MAP2_SCHPO        --------------KKKKKKKSSKKKKTPQE------QTNPPTVGLSKIFVNKKYPVGEV
MAP2_YEAST        --------------KKKKNKKKKKKKSN--------------VKKIELLFPDGKYPEGAW
MAP2_CANAL        --------------KKKKNKNKKKKKKK--------------IVSIDSSYPEGIFPEGQW
MAP2_YARLI        --------------KKKKKKNKKKKKKGPAV------QTEPPTVPIDRFFTSGIFPEGEI
MAP21_AJECG       --------------KKKKKKPKKKKKD------TQKAQTEPPRVILSALFPNNEYPVGEL
J3KCU9_COCIM      -------------GKKKKKKPKKKKKKG-----TAKVQSNPPRVPLSTLFPNNNYPEGEI
MAP21_EMENI       ---------------KKKKRKSKKKKKG-----GAKVQSSPPRVPVSSLFANGQYPEGEI
MAP23_ASPFU       QALGMLAYNSRIPAAKKKKRKSKKKKKG-----GAKVQSSPPRVPVSNLFPNNQYPEGEI
MAP2_PHANO        --------------KKKKRKPRKKKKAGAAGASGPKTQTKPPRVPVHEIFLNDSYPEGEI
MAP2_SCLS1        --------------KKRKRKKKPKKKAGA----NPKVQSSPPRVLLSNLFPSGEYPVGEE
I1S0T2_GIBZE      --------------KKKKRKPKKKKKN-------PTSQSDPPRVQVSQLFPNKSYPPGEE
MAP21_NECH7       --------------KKKKRKPKKKKKH-------PTSQTDPPRVMISQLFPNKAYPKGEE
MAP2_NEUCR        --------------KKKKRKPKKKKKA-------PTSQSEPPRVLVSQLFPNNQYPKGEE
MAP21_ASPFU       --------------KKKNKKRKPKKKQ-------PKVQTDPPSIPLSQLFPNNSYPKGEE
MAP22_AJECG       ----------NDGQKRNKRKKKKKKKNTKEL---EILQTTPPRVALANIFRSQRYPEAEI
J3KJV5_COCIM      ----------SKGKKRKRRSNKKK--NRKTL---GAQQTTPPRVALANLFHDQRYPEGEI
MAP22_ASPFU       TTTDGLCI-TEKKKKRKKSNKKKKKTKSGALPATELKQTSPPRVLVSTLFPSE-YPVGEL
I1RR51_GIBZE      ------------KKKKK-RKPKKKK-KTATQ------QSSPPRVPLSELFANKDYPVGEI
MAP22_NECH7       ------------KKKKKKRKPKKKKAKKATH------QSSPPRVPLSELFTPGQYPTGEF
MAP22_EMENI       ------------NQKKK-RKSKKKGKKKAAK------QSSPPRVPLSQLFLQGKYPIGEV
Q4QCC5_LEIMA      -------------PVVPSSANHPENPYPKTADGYPRQTWPEPTVPVSKQFAAGQFPAGEI
A8BPF2_GIAIC      --------------IPNVTLEAPLYTCG---------QTTPPTLPVHDFFGEKPYPVGRL
E1F0V2_GIAIA      --------------IPNITLEAPLYTCG---------QTTPPTLPVHDFFGEKTYPVGRL
                                                               :        :     

MAP2_ENCCU        --------------------------------------------------FDSRNMEIEN
MAP2_ENCIT        --------------------------------------------------FGPKGEEIEN
C4V7C3_NOSCE      --------------------------------------------------FNKNNEIVDN
MAP2_HUMAN        --CEYPPTQD-----------------------------------GRTAAWRTTSEEKKA
MAP2_BOVIN        --CEYPPTQD-----------------------------------GRTAAWRTTSEEKKA
MAP2_MOUSE        --CEYPPTQD-----------------------------------GRTAAWRTTSEEKKA
MAP2_RAT          --CEYPPTQD-----------------------------------GRTAAWRTTSEEKKA
A8XIH4_CAEBR      ETPYYLKGKD-----------------------------------GRVATDRESNEEKKA
Q9U2V9_CAEEL      ESPYYLKGKD-----------------------------------GRVATDRESNEEKKA
MAP21_ARATH       --QQYNDDN----------------------------------------LWRTTSEEKRE
MAP22_ARATH       --QEYKDDN----------------------------------------LWRTTSEEKRE
MAP2_DICDI        --QEYRDSN----------------------------------------SYRTTSEEKRL
MAP2_PUCGT        --SAYLG----------------------------------------ENSYRTTSSEKRE
MAP2_SCHPO        --CDYAE----------------------------------------DNLWRTTDEEKRA
MAP2_YEAST        --MDYH---------------------------------------QDFNLQRTTDEESRY
MAP2_CANAL        --MEYPL--------------------------------------EDINSYRTTSEEKRY
MAP2_YARLI        --CEHPHKTFKPKGTAVDPFADSEDEREAAEERAKDDAKHGSDDPLDFNRLRTTNEEKRY
MAP21_AJECG       --VEYK----------------------------------------DENAYRTTNEEKRY
J3KCU9_COCIM      --VEYK----------------------------------------DDNAYRTTNEEKRY
MAP21_EMENI       --VEYK----------------------------------------NENSYRTTNEEKRY
MAP23_ASPFU       --VEYK----------------------------------------NENSYRTTNEEKRY
MAP2_PHANO        --HEYL----------------------------------------NENSYRTTSEEKRH
MAP2_SCLS1        --VEYR----------------------------------------DENNYRTTSEEKRY
I1S0T2_GIBZE      --VEYK----------------------------------------DENNYRTTDEEKRH
MAP21_NECH7       --VEYK----------------------------------------DENNYRTTNEEKRH
MAP2_NEUCR        --VEYV----------------------------------------NDNLNRVTNEEKRH
MAP21_ASPFU       --VEYK----------------------------------------DENRYRTTSEEKRH
MAP22_AJECG       --VKYST--------------------------------------DNDNLQRTTTEELRH
J3KJV5_COCIM      --VEYVS--------------------------------------DNDNLRRTTAEEL--
MAP22_ASPFU       --VPY------------------------------------------DCTARTTDEELRY
I1RR51_GIBZE      --QSYS---------------------------------------DDFNTARTTAEEVRY
MAP22_NECH7       --LEY----------------------------------------EDTNTARTTAAELRA
MAP22_EMENI       --QEYQP--------------------------------------NVENTSRTTAEEVRY
Q4QCC5_LEIMA      --VDHPG---------------------------------------EMNNFRRSSEEKRA
A8BPF2_GIAIC      -------------------------------------------------LWSADPQSSDF
E1F0V2_GIAIA      -------------------------------------------------LWSADPQSSDF
                                                                              

MAP2_ENCCU        FTES---------DILQDARRAAEAHRRARYRVQSIVR-PGITLLEIVRSIEDSTRTLLK
MAP2_ENCIT        TTDC---------DLLQDARRAAEAHRRARYKVQSIIR-PGITLLEIVRSIEDSTRTLLE
C4V7C3_NOSCE      DLDF---------DILRDARRAAEAHRRVRYKVQNAIK-PGMPIVDIVNIIEENTRILLN
MAP2_HUMAN        LDQA-------SEEIWNDFREAAEAHRQVRKYVMSWIK-PGMTMIEICEKLEDCSRKLIK
MAP2_BOVIN        LDQA-------SEEIWNDFREAAEAHRQVRKYVMSWIK-PGMTMIEICEKMEDCSRKLIK
MAP2_MOUSE        LDQA-------SEEIWNDFREAAEAHRQVRKYVMSWIK-PGMTMIEICEKLEDCSRKLIK
MAP2_RAT          LDQA-------SEEIWNDFREAAEAHRQVRKYVMSWIK-PGMTMIEICEKLEDCSRKLIK
A8XIH4_CAEBR      LDAS-------YEETWQDYRRSAEAHRQVRQYVKSWIK-PGMSMIEICERLETTSRRLIK
Q9U2V9_CAEEL      LDIS-------YEEVWQDYRRSAEAHRQVRKYVKSWIK-PGMTMIEICERLETTSRRLIK
MAP21_ARATH       MERL-------QKPIYNSLRQAAEVHRQVRKYMRSILK-PGMLMIDLCETLENTVRKLIS
MAP22_ARATH       LERF-------EKPIYNSVRRAAEVHRQVRKYVRSIVK-PGMLMTDICETLENTVRKLIS
MAP2_DICDI        EERI-------HANIYNDVRRAAEVHRQVRKYVQGIVK-PGLGLTELVESLENASRTLIE
MAP2_PUCGT        LERLAAQEDPESAENYNSIRRAAEVHRQVRRYVQQTVK-PGMSMTEIAEMVEDGTRALVE
MAP2_SCHPO        LDR-------QNFDQYNDLRRAAEVHRQARQYAQSVIK-PGMSMMDVVNTIENTTRALVE
MAP2_YEAST        LKRDL-----ERAEHWNDVRKGAEIHRRVRRAIKDRIV-PGMKLMDIADMIENTTRKYTG
MAP2_CANAL        LDR-------QQNNKWQDFRKGAEIHRRVRHKAQSSIR-PGMTMIEIANLIEDSVRNYSG
MAP2_YARLI        LDR-------EQAAVHNEWRKGAEIHRVVRKYARDNIK-AGMTMTSIAEMIEDSVRALSN
MAP21_AJECG       LDRM-------NNDFLSEYRYAAEVHKQVRQYAQKTIK-PGQTLTEIAEGIEDSVRALTG
J3KCU9_COCIM      LDRM-------NNDFLTDYRKSAEIHRQVRQYAQKELLKPGRSLTEIAEGIEDSVRALTG
MAP21_EMENI       LDRM-------NNDFLQEYRQGAEVHRQVRQYAQKNIK-PGQTLTEIAEGIEDSVRALTG
MAP23_ASPFU       LDRM-------NNNFLQEYRQAAEVHRQVRQYAQKTIK-PGQTLTEIAEGIEDAVRALTG
MAP2_PHANO        LDRM-------NNDFLTDYRRGAEIHRTVRQWARDWIK-PGMSLTEIAEGIEDSVRALTG
MAP2_SCLS1        LDRM-------NNDFLQEYRQAAEIHRQVRQYAKANIK-PGQTLTEIAEGIEDSVRALTG
I1S0T2_GIBZE      LDNL-------NADFLADYREAAEIHRQVRQWTQKNVK-PGQTLTSIAEGIEDGVRALTG
MAP21_NECH7       LDNL-------NSDFLADFREAAEIHRQVRQWTQKTVK-PGQTLTEIAEGIENSVRALTG
MAP2_NEUCR        LDNL-------NQEFLTDYRHAAEVHRQVRQWAQKSIK-PGQTLTEIAENIEDSVRALTG
MAP21_ASPFU       LDNL-------NSDFLSDYRQAAEAHRQVRQWAQRNIK-PGQTLLEIANGIEESARCLVG
MAP22_AJECG       LSVLNA----MDDEFLNDYRKAAEVHRQVRQYVQT-IIKPGIALSQLAPEIEDGVRALTN
J3KJV5_COCIM      ---------------------PAEVHRQVRQHVQT-ITKPGMSMSQLAQEIEDGVRALTD
MAP22_ASPFU       NSRL------WDDDFLPDYRQAAEIHRQVRQYAQKELIKPGATLLSIAEGIEDGVRALSG
I1RR51_GIBZE      KGRKQL----EDPAFLNDYRKAAEVHRQVRQWTQE-NVKPGHTLNEIANGIEDGVRALLG
MAP22_NECH7       LGRKQL----EDPAFLDDYRRAAEVHRQVRQWAQE-SVKPGQTLRDIANGIEDGVRALLG
MAP22_EMENI       KSRSHL----EDDSFLNDYRKAAEVHRQVRKWTQE-RVKPGQGLMEIAEDIDDGVRALLG
Q4QCC5_LEIMA      LARA-------SEQQVQEMREAAEVHRQVRTWAQSWIK-PGLSLMLMTDRIEKKLNELIG
A8BPF2_GIAIC      VPAD-------NEHIRKCMRRAAEIHRQVRTYARSVLK-VGVSMYAAAEDIESRIRLLCG
E1F0V2_GIAIA      VPTD-------NEHIRKCMRRAAEIHRQIRTYARSVLK-VGVSMYAAAEDIESRIRLLCG
                                        ** *:  *          *  :      ::   .    

MAP2_ENCCU        GER----NNG--------IGFPAGMSMNSCAAHYTVNPGEQDIVLKEDDVLKIDFGTHSD
MAP2_ENCIT        GER----NNG--------IGFPAGMSMNSCAAHYTVNPGEEDIVLKEDDVLKVDFGTHSN
C4V7C3_NOSCE      GER----NNG--------IGFPAGMSINDCAAHFTVNNGD-NICLGVDDILKIDFGTHSN
MAP2_HUMAN        ENG----LNAG-------LAFPTGCSLNNCAAHYTPNAGDT-TVLQYDDICKIDFGTHIS
MAP2_BOVIN        ENG----LNAG-------LAFPTGCSLNNCAAHYTPNAGDT-TVLQYDDICKIDFGTHIS
MAP2_MOUSE        ENG----LNAG-------LAFPTGCSLNNCAAHYTPNAGDT-TVLQYDDICKIDFGTHIS
MAP2_RAT          ENG----LNAG-------LAFPTGCSLNNCAAHYTPNAGDT-TVLQYDDICKIDFGTHIS
A8XIH4_CAEBR      EQG----LEAG-------LAFPTGCSLNHCAAHYTPNAGDT-TVLQYGDVCKIDYGIHVR
Q9U2V9_CAEEL      EQG----LEAG-------LAFPTGCSLNHCAAHYTPNAGDT-TVLQYGDVCKIDYGIHVR
MAP21_ARATH       ENG----LQAG-------IAFPTGCSLNNVAAHWTPNSGDK-TVLQYDDVMKLDFGTHID
MAP22_ARATH       ENG----LQAG-------IAFPTGCSLNWVAAHWTPNSGDK-TVLQYDDVMKLDFGTHID
MAP2_DICDI        ADG----LKAG-------IAFPTGVSLNHIAAHFTPNTGDK-TVLKKDDVLKIDFGTHVN
MAP2_PUCGT        VDG----LQR-------GIGFPTGVSLNHCAAHYTPNAGDT-IVLSADDVLKVDFGVQIG
MAP2_SCHPO        EDG----LKS-------GIGFPTGVSLNHCAAHYTPNAGDT-TILKEKDVMKVDIGVHVN
MAP2_YEAST        AEN----LLAMEDPKSQGIGFPTGLSLNHCAAHFTPNAGDK-TVLKYEDVMKVDYGVQVN
MAP2_CANAL        NDH----TLKA------GIGFPTGLSLNHVAAHYTPNTGDK-LILKKDDIMKVDIGVHVN
MAP2_YARLI        EED----SLKG------GQGFPTGVSLNHCAAHYTPNAGDK-IVLKEDDVLKVDFGVHVN
MAP21_AJECG       HDG----LTEG-DNLLGGIAFPTGVNLNNCAAHYSPNAGNK-MVLQYEDVMKVDFGVHMN
J3KCU9_COCIM      HMG----LEEG-DSLVAGMGFPTGLNINHCAAHYSPNAGNK-MVLQYGDVMKVDFGVHVN
MAP21_EMENI       HQG----LEEG-DNIKGGMGFPCGLSINHCAAHYTPNAGNK-MVLQQGDVMKVDFGAHIN
MAP23_ASPFU       HQG----LEEG-DNLKGGMGFPCGLSINHCAAHYTPNAGNK-MVLQQGDVMKVDFGAHIN
MAP2_PHANO        HQG----LEDG-DAQIAGMGFPTGLSINHCAAHYTPNAGNK-MVVNYEDVMKVDFGVHIN
MAP2_SCLS1        HPG----LEEG-DNIKGGVAFPTGVNLDHIAAHYSPNAGNK-TVLAYENVMKVDFGVHVN
I1S0T2_GIBZE      HSG----LEEG-DSLKAGMGFPCGLSLNHCAAHYTPNAGNK-MVLQQQDVMKVDFGVHVN
MAP21_NECH7       HDG----LTEG-DAMKAGMGFPCGLSLNHCAAHYTPNAGNK-MVLQQEDVMKVDFGVHVN
MAP2_NEUCR        HSG----LEEG-DALIAGMGFPTGLSINHCAAHYTPNAGNK-MVLQEDDVMKVDFGVHVN
MAP21_ASPFU       HDG----LTEG-DSLIAGMGFPTGLNIDNIVAHYSPNAGCK-TVLAQNNVLKVDIGIHVG
MAP22_AJECG       HQG----LETG-DALKAGMAFPTGLCLNNIAAHWTPNPGAKEVILQYDDVLKIDFGVHVN
J3KJV5_COCIM      HEG----LETG-DALKAGMAFPTGLCLNKVGAHWTPNPGAKDVILQYEDVLKLDFGVHVS
MAP22_ASPFU       HQG----LEPG-DFFKAGMGFPTGLCLNHIAAHWTPNPREKDVILDKGDVLKVDFGVHVN
I1RR51_GIBZE      NQG----IEPG-DNIKSGMGFPTGLCLNHETAHYTPNPGQKDVVLKYEDVMKVDFGVQIN
MAP22_NECH7       NQG----LEPG-DGLKSGMGFPTGLCLNHETAHYTPNPGQKDVVLQYEDVMKVDFGVHIN
MAP22_EMENI       HAG----LEPG-DSLKAGLGFPTGLSLNNVVAHYTPNPGQKDIILQSSDVMKVDFGVHIN
Q4QCC5_LEIMA      KDG----ILRG-------QAFPTGCSLNHVAAHYTPNTGDEKVVLTYDDVMKVDFGTHIN
A8BPF2_GIAIC      HSEDEFCTYKPDDNAWCAQAFPLGLSYNHCAAHYTPIKHDD-HIIAEKDVIKVDFGIHCD
E1F0V2_GIAIA      HSKDEFCTYKPDDDTWCAQAFPLGLSYNHCAAHYTPIKHDD-HVIAEKDVIKVDFGIHCG
                                     .** *   :   **::         :   :: *:* * :  

MAP2_ENCCU        GRIMDSAFTVAF--KENLEPLLVAAREGTETGIKS---LGVDVRVCDIGRDINEVISSYE
MAP2_ENCIT        GRIMDSAFTVAF--QENLQPLLMAAREGTETGIRS---LGIDARVCDIGRDINEVITSYE
C4V7C3_NOSCE      GRIMDSAFTVAF--NPEYENLLLASKEATNAGIKA---LGVDVRLCDIGRDIYEVMKSFE
MAP2_HUMAN        GRIIDCAFTVTF--NPKYDTLLKAVKDATNTGIKC---AGIDVRLCDVGEAIQEVMESYE
MAP2_BOVIN        GRIIDCAFTVTF--NPKYDTLLKAVKDATNTGIKC---AGIDVRLCDVGEAIQEVMESYE
MAP2_MOUSE        GRIIDCAFTVTF--NPKYDILLTAVKDATNTGIKC---AGIDVRLCDVGEAIQEVMESYE
MAP2_RAT          GRIIDCAFTVTF--NPKYDILLKAVKDATNTGIKC---AGIDVRLCDVGEAIQEVMESYE
A8XIH4_CAEBR      GRLIDSAFTVHF--DPKFDPLVEAVKEATNAGIRE---SGIDVRLCDVGEVVEEVMTSHE
Q9U2V9_CAEEL      GRLIDSAFTVHF--DPKFDPLVEAVREATNAGIKE---SGIDVRLCDVGEIVEEVMTSHE
MAP21_ARATH       GHIVDSAFTVAF--NPMFDPLLAASRDATYTGIKE---AGVDVRLCDVGAAVQEVMESYE
MAP22_ARATH       GHIIDCAFTVAF--NPMFDPLLAASREATYTGIKE---AGIDVRLCDIGAAIQEVMESYE
MAP2_DICDI        GYIIDCAFTVTF--DEKYDKLKDAVREATNTGIYH---AGIDARLGEIGAAIQEVMESHE
MAP2_PUCGT        GRIVDSAFTMTF--NNKYDKLLEAVRAATNTGIRE---AGIDARLSDIGASIQETMESYE
MAP2_SCHPO        GRIVDSAFTMSF--DPQYDNLLAAVKAATNKGIEE---AGIDARLNEIGEAIQEVMESYE
MAP2_YEAST        GNIIDSAFTVSF--DPQYDNLLAAVKDATYTGIKE---AGIDVRLTDIGEAIQEVMESYE
MAP2_CANAL        GRICDSAFTMTFNEDGKYDTIMQAVKEATYTGIKE---SGIDVRLNDIGAAIQEVMESYE
MAP2_YARLI        GKIIDSAFTHVQ--NDKWQGLLDAVKAATETGIRE---AGIDVRLGDIGEAIQETMESHE
MAP21_AJECG       GRIVDSAFTIAF--DPVYDNLLAAVKDATNTGIR---EAGIDVRMSDIGAAIQEAMESYE
J3KCU9_COCIM      GRIVDSAFTVAF--DPVYDNLLNAVKDATNTGIR---EAGIDVRMSDIGAAIQETMESYE
MAP21_EMENI       GRIVDSAFTMSF--DPVYDPLLEAVKDATNTGIRSLQEAGIDVRMSDIGAAIQETMESYE
MAP23_ASPFU       GRIVDSAFTMTF--DPVYDPLLEAVKDATNTGIR---EAGIDVRMSDIGAAIQEAMESYE
MAP2_PHANO        GRIVDSAFTLTF--DPVYDNLVEACKAATNAGIK---EAGIDVRMSDIGAAIQEVMESYE
MAP2_SCLS1        GRIVDSAFTIAF--DPMYDNLLEAVKQATNTGIK---EAGIDARLGEIGEHIQETMESYE
I1S0T2_GIBZE      GRIVDSAFTMSF--DNKYDNLLQAVKEATNAGIR---EAGIDARVGEIGGVIQETMESFE
MAP21_NECH7       GRIVDSAFTMAF--EPKYDNLLQAVKDATNAGIR---EAGIDARVGEIGGVIQEVMESFE
MAP2_NEUCR        GRIVDSAFTVAF--NPRYDPLLEAVKAATNAGIK---EAGIDVRVGDIGAAIQEVMESYE
MAP21_ASPFU       GRIVDSAFTMAF--DPMYDNLLAAVKDATNTGVR---EAGIDVRVGELGGYIQEAMESYE
MAP22_AJECG       GRIVDSAFTMAF--NPVYDNLLAAVKDATNAGLKE---AGIDSRIAHISEAIQEVMESYE
J3KJV5_COCIM      GRIVDSAFTVAF--SPAYDNLLAAVKAATNTGLKE---AGIDARIDHISEEIQEVMESYE
MAP22_ASPFU       GRIVDSAFTVAF--DDKYDNLLTAVREATNTGIKH---AGVDARMSDIGAAIQEVMESYE
I1RR51_GIBZE      GWIVDSAFTMSF--DPTYDNLLAAVKDATNSGIKA---SGIDVRICDVSAEIQEAMESYE
MAP22_NECH7       GWIVDSAFTMSF--DPTYDNLLAAVKDATNSGIK-------------VNAAIQEAMESYE
MAP22_EMENI       GWIVDSAFTMTF--DPVYDNLLAAVKDATNAGLKT---AGIDVRISDVSAAIQEAMESYE
Q4QCC5_LEIMA      GRIIDCAWTVAF--NPMFDPLLQAVKEATYEGIKQ---AGIDVRLGDIGAAIEEVMESHE
A8BPF2_GIAIC      GYIIDSAFTIHF--DPMFDPLAQASLEATTEAIKL---AGPDVLISELGNKIEEIICSYE
E1F0V2_GIAIA      GYIIDSAFTIHF--DSIFDPLAQASLEATTEAIKL---AGPDTLISELGNKIEEIICSYE
                  * : *.*:*     .   : :  *   .*  .:              :.  : * : *.*

MAP2_ENCCU        VEIGGR--MWPIRPISDLHGHSISQFRIHGG---ISIPAVNN-RDT-TRIKGDSFYAVET
MAP2_ENCIT        VEIEGK--TWPIRPVSDLHGHSISQFKIHGG---ISIPAVNN-RDT-TRIKGDTFYAVET
C4V7C3_NOSCE      VTIKGK--TFPVKPVFDLHGHSIGQYVIHAG---LSIPCYDN-LDS-TKIREDTFYAVET
MAP2_HUMAN        VEIDGK--TYQVKPIRNLNGHSIGQYRIHAG---KTVPIVKG-GEA-TRMEEGEVYAIET
MAP2_BOVIN        VEIDGK--TYQVKPIRNLNGHSIGPYRIHAG---KTVPIVKG-GEA-TRMEEGEVYAIET
MAP2_MOUSE        VEIDGK--TYQVKPIRNLNGHSIGPYRIHAG---KTVPIVKG-GEA-TRMEEGEVYAIET
MAP2_RAT          VEIDGK--TYQVKPIRNLNGHSIGPYRIHAG---KTVPIVKG-GEA-TRMEEGEVYAIET
A8XIH4_CAEBR      VELEGK--TYVVKPIRNLNGHSIAQYRIHAG---KTVPIVKG-GEQ-TKMEENEIYAIET
Q9U2V9_CAEEL      VELDGK--SYVVKPIRNLNGHSIAQYRIHAG---KTVPIVKG-GEQ-TKMEENEIYAIET
MAP21_ARATH       VEINGK--VYQVKSIRNLNGHSIGRYQIHAE---KSVPNVRG-GEQ-TKMEEGELYAIET
MAP22_ARATH       VEINGK--VFQVKSIRNLNGHSIGPYQIHAG---KSVPIVKG-GEQ-TKMEEGEFYAIET
MAP2_DICDI        IELNGK--TYPIRSIRNLNGHSIRPYVIHGG---KTVPIVRG-GEM-TKMEEGEFYAIET
MAP2_PUCGT        VEVDGK--VHKVKSIRNLTGHNILPYHIHGG---KSVPIVAN-SDESAIMEEGDHFAVET
MAP2_SCHPO        VEINGK--THQVKSIRNLCGHNLDPYIIHGG---KSVPIVKG-GEE-IKMEEGEIFAIET
MAP2_YEAST        VEINGE--TYQVKPCRNLCGHSIAPYRIHGG---KSVPIVKN-GDT-TKMEEGEHFAIET
MAP2_CANAL        MEENGK--TYPIKCIKNLNGHNIDDFVIHSG---KSVPIIAN-GDM-TKMEEGETFAIET
MAP2_YARLI        VEVDGK--VYQVKSIRNLNGHNIAPYEIHGG---KSVPIVKS-ADM-TKMEEGETFAIET
MAP21_AJECG       VEIKGT--TYPVKAIRNLNGHTIGQFEIHGGKNGKSVPIVKG-GDQ-SKMEEGEVYAIET
J3KCU9_COCIM      VEINGT--TYPVKAIRNLNGHTIGHYLIHGGSTGKSVPIVKG-GDQ-TKMEEGETYAIET
MAP21_EMENI       IELNGT--TYPIKPIRNLNGHNIDQHVIHGG---KSVPIVKG-SDQ-TKMEEGEVFAIET
MAP23_ASPFU       VELNGT--MYPVKCIRNLNGHNIDRHIIHGG---KSVPIVKG-SDQ-TKMEEGETFAIET
MAP2_PHANO        VEIKGE--TFPVKCIRNLNGHSIGHYTIHGG---KTVPIVKG-GDQ-TKMEEGETFAIET
MAP2_SCLS1        VEIKGQ--TYQVKPIRNLNGHDILQWKIHGG---KSVPIVKS-NDQ-TKMEEGEVFAIET
I1S0T2_GIBZE      VEIDGT--TYPVKSIRNLTGHNILPYSIHGT---KAVPIVKS-NDQ-TKMEEGDVFAIET
MAP21_NECH7       VEIDGT--TYPVKSIRNLTGHNILPYSIHGT---KAVPIVKS-NDQ-TKMEEGDVFAIET
MAP2_NEUCR        VEINGQ--MLPVKSIRNLNGHTINHYSIHGT---KSVPIVKS-NDQ-TKMEEGDVFAIET
MAP21_ASPFU       CEIRGK--TYPIKAIRNLCGHTILPYSIHGT---KNVPFVKS-NDM-TKMEEGDVFAIET
MAP22_AJECG       VELNRK--VIPVKAVRNITGHNILHYKIHGD---KQVPFVKT-QTN-QRMEEGDVFAIET
J3KJV5_COCIM      IELNRK--IIPVKAIRNITGHNILRYKIHGD---KQLPFVKT-RTT-QRMEEGDVFAIET
MAP22_ASPFU       VEIDGK--VFPVKAIRNITGHDILRYHIHGG---KQIPFIKN-NNQ-DKMEEGEVYAIET
I1RR51_GIBZE      VEINRK--TYPVKPVRNISAHNIKHYQIHGG---KSIPFIKN-RDQ-TKMEEGEVFAIET
MAP22_NECH7       VEIAGK--TYPVKPVRNISAHNIQHYRIHGG---KSIPFIKN-SDQ-TKMEEGEVFAIET
MAP22_EMENI       VEIGGK--TFPVKAVRNITGHNIKHYQIHGG---KSVPFVKN-SDQ-TKMEEGEIFAIET
Q4QCC5_LEIMA      VEINGK--VHQVKSIRNLSGHNIAPYIIHSG---KSVPIVKG-GEQ-AKMEEGEVFAIET
A8BPF2_GIAIC      MDYKNQNAPIKLQPVRNLSGHMVGKYKIHSG---KSIPNCRGKGKEYGRMLEGETFACET
E1F0V2_GIAIA      VDYKNQNAPIKLQPVRNLSGHMVGKYKIHSG---KSIPNCRGKGKEYGRMLEGETFACET
                             ::   :: .* :    **.      :*           :  .  :* **

MAP2_ENCCU        FATTGKGSIDDRPPCSHFVLNTYKS---RKLFNKD--LIKVYEFVKDSLGTLPFSPRHLD
MAP2_ENCIT        FATTGKGFINDRSPCSHFMLNVHKS---RKLFNKD--LIKVYEFVKSSFGTLPFSPRHLD
C4V7C3_NOSCE      FATTGNGHIKDSSPCTHYVLNNKKS---AVLKNLN--CIKIYNFVKNKLGTLPFSPKHID
MAP2_HUMAN        FGSTGKGVVHDDMECSHYMKNFDVG--HVPIRLPR--TKHLLNVINENFGTLAFCRRWLD
MAP2_BOVIN        FGSTGKGVVHDDMECSHYMKNFDVG--HVPIRLPR--TKHLLNVINENFGTLAFCRRWLD
MAP2_MOUSE        FGSTGKGVVHDDMECSHYMKNFDVG--HVPIRLPR--TKHLLNVINENFGTLAFCRRWLD
MAP2_RAT          FGSTGKGVVHDDMECSHYMKNFDVG--HVPIRLPR--TKHLLNVINENFGTLAFCRRWLD
A8XIH4_CAEBR      FGSTGKGYVHDDMETSHYMKNFELADEKIPLRLQK--SKGLLSLIDKNFSTLAFCRRWID
Q9U2V9_CAEEL      FGSTGKGYVHDDMETSHYMKNFELADEKIPLRLQK--SKGLLNLIDKNFATLAFCRRWID
MAP21_ARATH       FGSTGKGYVREDLECSHYMKNYDVG--HVPLRLPR--AKQLLATINKNFSTLAFCRRYLD
MAP22_ARATH       FGSTGKGYVREDLECSHYMKNFDAG--HVPLRLPR--AKQLLATINKNFSTLAFCRRYLD
MAP2_DICDI        FGSTGRAQVIEDLECSHYMKTDYQT----TVRLPK--AKQLLQYINKNYDTLCFCRRWLD
MAP2_PUCGT        FGSTGRGYVMDDGECSHYAK-NPDV-NK-PIRLAR--AKTLLNTINKHFDTLPFCKRYLD
MAP2_SCHPO        FGSTGRGVVHEDMECSHYAK-IPDA-GHIPLRLPR--AKALLNTITQNFGTLPFCRRYLD
MAP2_YEAST        FGSTGRGYVTAGGEVSHYAR-SAED-HQVMPTLDS--AKNLLKTIDRNFGTLPFCRRYLD
MAP2_CANAL        FGSTGNGYVLPEGECSHYAM-NKGV-EHLKPPSER--SKQLLETIKQNFGTLPWCRRYLE
MAP2_YARLI        FGSTGRGYVVTDGECSHYAK-NVGV-GHVPLRVNK--AKQLLATIDKNFGTLPFCRRYLD
MAP21_AJECG       FGSTGRGYVRDDMETSHYAKVPDA--PNVPLRLSS--AKNLLNVITKNFGTLPFCRRYLD
J3KCU9_COCIM      FGSTGKGFVRDDMEVSHYAKVPDA--PNVPLRLSS--AKNLLNVITKNFGTLPFCRRYLD
MAP21_EMENI       FGSTGKGYVREDMETSHYALVANA--PQVPLRLSS--AKSLLNVINKNFGTLPWCRRYLD
MAP23_ASPFU       FGSTGKGYVREDMETSHYALIPDA--PSVPLRLSS--AKNLLNVINKNFGTLPFCRRYLD
MAP2_PHANO        FGSTGKGYVRDDMETSHYAKRSDA--PKVALRVSS--AKTLLNSITKNFGTLPFCRRYLD
MAP2_SCLS1        FGSTGNGYVRDDLECSHYAKVADA--PNVPLRIAS--AGKLLNVINKNFGTLPFCRRYLD
I1S0T2_GIBZE      FGSTGNGYVRDDMETSHYAKRGDS--SHVDLRLSS--AKSLLNVINKNFGTLPFCRRYLD
MAP21_NECH7       FGSTGNGYVRDDMETSHYAKRGDS--QHVDLRLSS--AKNLLNVINKNFGTLPFCRRYLD
MAP2_NEUCR        FGSTGNGYVHEEGEVSHYAKRGDA--AKVDLRLSS--AKSLLNVITKNFGTLPFCRRYID
MAP21_ASPFU       FGSTGSGRYVEGGEVSHYALRGDA--DRKDLTLSS--ARSLLTAIKKNFSTIPFCRRYLD
MAP22_AJECG       FGSTGKAYLDDATGIYGYGYDENS--STTGLHHSS--AKSLLKTIKENFGTLVFSRRYLE
J3KJV5_COCIM      FGSTGKAYLRDDVGVYGYGCNEHA--SATGLRHAS--AKSLLKTIHENFGTLVFSRRYLE
MAP22_ASPFU       FGSTGRGFLDDDVGVYGYGRNENM--SGANLRLSS--AKSLLKTIDASFGSIVFSRRYLE
I1RR51_GIBZE      FGTTGTGKLYDDVGIYGYGLQHDAP-KNVHLPFAT--ATKLHKVIREQFGTIVFCRRYLD
MAP22_NECH7       FGTTGRGRLYDDVGIYGYKLENGGP-SPASLPFAS--AKKLHKVIKENFGNIVFCRRYLE
MAP22_EMENI       FGSTGRGYIYDDVGVYGYGKSYDAP-RQVSLPLAS--ARSLYKTINENFGTIVFCRRYLD
Q4QCC5_LEIMA      FGSTGRGFVNEDLECSHYMMQPGAE--VMQLRSEK--AQQLLKHIHKSYSTLAFCRKWLD
A8BPF2_GIAIC      FASTGRGMISDEYPVSHYMVSSKSMSLQPAFIKGPEMSKKLFTKLRTMFGTLAWSPRTLE
E1F0V2_GIAIA      FASTGRGMISDEYPVSHYMVSSKSMSLQPAFIKGPEMSKKLFTKLRTMFGTLAWSPRTLE
                  *.:** .          :                      :   :     .: :. : ::

MAP2_ENCCU        YYGLVKGGSLKSVNLLTMMGLLTPYPPLNDIDGCKVAQFEHTVYLSEHGKEVLTRGDDY
MAP2_ENCIT        HYNLVEGGSLKSVNLLTMMGLFTPYPPLNDIDGSKVAQFEHTVYLSENGKEILTRGDDY
C4V7C3_NOSCE      YFNLIDGPSQMYIKLLAQRNLLISYPPLNDIKGSYVAQFEHTLYLTEGCKEVLTKGDDY
MAP2_HUMAN        RLGESK--YLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
MAP2_BOVIN        RLGESK--YLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
MAP2_MOUSE        RLGESK--YLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
MAP2_RAT          RLGESK--YLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
A8XIH4_CAEBR      RLGETK--YLMALKDLCDKGIVDPYPPLCDVKGCYTAQWEHTILMRPTVKEVVSRGDDY
Q9U2V9_CAEEL      RLGETK--YLMALKDLCDKGIVDPYPPLCDVKGCYTAQWEHTILMRPTVKEVVSRGDDY
MAP21_ARATH       RLGETK--YLMALKNLCDSGIIEPCPPVCDVKGSYISQFEHTILLRPTCKEIISKGDDY
MAP22_ARATH       RIGETK--YLMALKNLCDSGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVLSKGDDY
MAP2_DICDI        RAGEDK--HILALNNLCDLGIIQRHAPLVDSKGSYVAQYEHTLLLKPTAKEVLSRGDDY
MAP2_PUCGT        RLGESR--YYAALDNLVNLGIVQAYPPLSDIQGCMTAQYEHTIILRPTCKEVVSRGDDY
MAP2_SCHPO        RIGESK--YLLALNNLVSAGIVQDYPPLCDIRGSYTAQFEHTIILHPTQKEVVSRGDDY
MAP2_YEAST        RLGQEK--YLFALNNLVRHGLVQDYPPLNDIPGSYTAQFEHTILLHAHKKEVVSKGDDY
MAP2_CANAL        RTGEEK--YLFALNQLVRHGIVEEYPPIVDKRGSYTAQFEHTILLHPHKKEVVTKGDDY
MAP2_YARLI        RLGEEK--YLLALKNLVQSGVVQDYPPLVDQKGCQTAQYEHTIYLRPTCKEILSRGDDY
MAP21_AJECG       RLRQDK--YLLGLNNLVANGLVDAYPPLCDIKGSYTAQFEHTILLRPNIKEVISRGDDY
J3KCU9_COCIM      RLGQEK--YLLGLNNLVSSGLVDAYPPLVDVKGSYTAQFEHTILLRPNVKEVITRGDDY
MAP21_EMENI       RLGQDK--YLLGLNNLVQSGIVQDYPPLCDIKGSYTAQFEHTIVLRPTVKEVISRGDDY
MAP23_ASPFU       RLGQEK--YLLGLNNLVSSGIVQDYPPLCDVKGSYTAQFEHTILLRPTVKEVISRGDDY
MAP2_PHANO        RLGHDK--YLLGLNNLVSAGIVEAYPPLCDIKGSYTAQSEHVSFFPSV-----------
MAP2_SCLS1        RLGQDK--YLLGLNALVSHGIVQDYPPLVDKKGSYTAQFEHTIVLRPNCKEVISRGDDY
I1S0T2_GIBZE      RIGQDK--YLLGLNNLVNAGIVEAYPPLCDKKGSYTAQFEHTILIRPTVKEVISRGDDY
MAP21_NECH7       RLGSDK--YLLGLNSLVNSGIVEAYPPLCDKKGSYTAQFEHTILIRPTVKEVVSRGDDY
MAP2_NEUCR        RLGQDK--YLLGLNNLVSQGIVEAYPPLVDKKGSYTAQYEHTILLRPTVKEVISRGDDF
MAP21_ASPFU       RIGQEK--YLLGLNYLVKSGIVEDYPPLNEKPGTYTAQFEHTILLRPTVKEVISRGDDY
MAP22_AJECG       RLGVQR--YHLGMRSLVTNGIVQSYAPLVDVPGSYVAQFEHTVLLRPNCKEVISRGDDY
J3KJV5_COCIM      RIGVKN--YHLGMRSLVSNGIVESYAPMVDVPGS-------------------------
MAP22_ASPFU       RLGVKN--YLLGMKNLIDNGIVECYSPLVDVKGSYTAQFEHTILLHSGGKEVISRGDDY
I1RR51_GIBZE      RLGLDR--YLAGLNSLVSHGILEAYEPLADIKGSYSAQFEHTILLRESNKEVISRGSDY
MAP22_NECH7       RLGQER--YLAGLNCLVSNGLLEAYEPLADVKGSYSAQFEHTILLRESSKEILSRGSDY
MAP22_EMENI       RLGLQR--YLAGMNTLVQHGVVDVYAPLVDIKGSYSAQFEHTVLLRESNKEVISRGDDY
Q4QCC5_LEIMA      RDGFDR--HLMNLNRLVDEGAVNKYPPLVDVKGSFTAQYEHTIYLGPTAKEILSKGSDY
A8BPF2_GIAIC      SMGEKN--FQLALDTLVKNGVVNAYPKLSDKSGCHTSQFEHTFMVGSWGTEVFSAGDDY
E1F0V2_GIAIA      SMGEKN--FQLALDTLVKNGVVNAYPKLSDKSGCHTSQFEHTFMVGSWGTEIFSAGDDY
                              :  *   . .     : :  *