CLUSTAL format seed alignment for MF_03176

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A098E1Q1_GIBZE      --------MTAGINSLAFRS----------SPTRAILLRRALQQQ---------LSLKLQ
Q7RXT1_NEUCR          ----MKTGLLAGHHLLLHRATINLNLSPNWSTFQAVLVHRAPLRAHVHNSAPKCAAFPLE
PIF1_EMENI            ------------------------------------------------------------
Q4WVU7_ASPFU          ------------------------------------MHVSKITERDLVLLRQYCIYGPKL
A0A0D8JVN0_COCIM      ------------------------------------------------------------
C0NFA5_AJECG          -----------------------------------------MSRYALLARGSTAIVTPSF
Q0UCQ7_PHANO          ------------------------------------------------------------
A7EDF0_SCLS1          -------------------------------MPFGCTTSPALSSLIRGRLAQRWRAHPRF
Q5KKJ1_CRYNJ          ------------------------------------------------------------
A0A0D1DZD7_USTMA      ------------------------------------------------------------
E3LA34_PUCGT          ------------------------------------------------------------
A8N8Y7_COPC7          ------------------------------------------------------------
PIF1_SCHPO            ---------------------------MFSCQSLYKFSHSFRKRIPVMFQRAQQKSSLLH
I1BKX4_RHIO9          ------------------------------------------------------------
Q6CEU3_YARLI          MTMSSDHSLDDIMGSIVVGRRKLSISDFEDDFDIDEITQNAISSATKRSKSTSAVPQNSA
A8N288_COPC7          ------------------------------------------------------------
D6RJX6_COPC7          ------------------------------------------------------------
Q5KCW7_CRYNJ          ------------------------------------------------------------
PIF1_YEAST            ------------------------------------------------------------
Q756Y6_ASHGO          ------------------------------------------------------------
W1QEW7_OGAPD          ------------------------------------------------------------
PIF1_CANAL            ------------------------------------------------------------
G8BK92_CANPC          ------------------------------------------------------------
RRM3_YEAST            ------------------------------------------------------------
Q756M1_ASHGO          ------------------------------------------------------------
W1QFA7_OGAPD          ------------------------------------------------------------
A0A1D8PRM6_CANAL      ------------------------------------------------------------
G8BBJ1_CANPC          ------------------------------------------------------------
C4Y757_CLAL4          ------------------------------------------------------------
PIF1_HUMAN            ------------------------------------------------------------
H2Q9L3_PANTR          ------------------------------------------------------------
G3S8K9_GORGO          ------------------------------------------------------------
A0A2J8T886_PONAB      ------------------------------------------------------------
A0A1D5Q3I2_MACMU      ------------------------------------------------------------
F7HI20_CALJA          ------------------------------------------------------------
F6UY05_CANLF          ------------------------------------------------------------
PIF1_MOUSE            ------------------------------------------------------------
PIF1_RAT              ------------------------------------------------------------
H0X2J4_OTOGA          ------------------------------------------------------------
F7ET02_MONDO          ------------------------------------------------------------
F6R806_ORNAN          ------------------------------------------------------------
I3JWJ9_ORENI          ------------------------------------------------------------
G3PSK1_GASAC          ------------------------------------------------------------
H2LXB4_ORYLA          ------------------------------------------------------------
PIF1_DANRE            ------------------------------------------------------------
F6VQD1_XENTR          ------------------------------------------------------------
G1KND2_ANOCA          ------------------------------------------------------------
W4Y048_STRPU          ------------------------------------------------------------
A0A1X7UHE6_AMPQE      ------------------------------------------------------------
W5JD43_ANODA          ------------------------------------------------------------
Q7Q395_ANOGA          ------------------------------------------------------------
J9HF21_AEDAE          ------------------------------------------------------------
Q9VQR3_DROME          ------------------------------------------------------------
Q29MC1_DROPS          ------------------------------------------------------------
A0A088ASR6_APIME      ------------------------------------------------------------
H9JHA1_BOMMO          ------------------------------------------------------------
G5EFV7_CAEEL          ------------------------------------------------------------
A8WZ54_CAEBR          ------------------------------------------------------------
A0A2H2I3F9_CAEJA      ------------------------------------------------------------
Q54Z42_DICDI          ------------------------------------------------------------
                                                                                  

A0A098E1Q1_GIBZE      LQQRVQVHSGGPVYSPDFETMLQRASSKYEANAPPQKSQAKGGPFLPSS-----------
Q7RXT1_NEUCR          ALHDEDIMFGRAVQAKAAEANNNNNKSKPGASSISNNASLKQQLFPSSSPARAP------
PIF1_EMENI            --------------------MFKKAVKDHSAAAARPLQST--------------------
Q4WVU7_ASPFU          ISLTARYSTARPLGATQEAAMFKKAVKDHSAGPVKPLQSN--------------------
A0A0D8JVN0_COCIM      --------------------MFTKALREHRE----PLKYL--------------------
C0NFA5_AJECG          IRLASRWPYSLPSHRVRKFTMFNQAVRNHTA----PARPL--------------------
Q0UCQ7_PHANO          --------------------MFKQAVNNHNAAIPQPAPTA--------------------
A7EDF0_SCLS1          TFRITNVPTRSVLYSSIAHAMLGRAVKAKATEAQSLHPKN--------------------
Q5KKJ1_CRYNJ          --------MPILTARTLSSSNPNNTSKGTLSRVTSFKRSWG-------------------
A0A0D1DZD7_USTMA      -----------MYPRSNASSQ-SSDRTQVRSALGSLKRSWS-------------------
E3LA34_PUCGT          ----------------MGVSIWRRAFRSSMYPY---------------------------
A8N8Y7_COPC7          -----------------------------MSSR---------------------------
PIF1_SCHPO            TQNESSHQPSLNKLGGFSSASLNFNSSRSS--TNDDQQTFS-------------------
I1BKX4_RHIO9          -MDES----PPSGQGSFKSAEHSVSMTNNSKFNKKAWAPID-------------------
Q6CEU3_YARLI          VLLPPEFSLSSTFEDDIDAVMAEIRVQKPAKKHNSTQATRVTHDIPFQEPERRPQPVLEA
A8N288_COPC7          ------------------------------------------------------------
D6RJX6_COPC7          ------------------------------------------------------------
Q5KCW7_CRYNJ          ------------------------------------------------------------
PIF1_YEAST            ------------------------------------------------------------
Q756Y6_ASHGO          ------------------------------------------------------------
W1QEW7_OGAPD          ------------------------------------------------------------
PIF1_CANAL            ------------------------------------------------------------
G8BK92_CANPC          ------------------------------------------------------------
RRM3_YEAST            ------------------------------------------------------------
Q756M1_ASHGO          ------------------------------------------------------------
W1QFA7_OGAPD          ------------------------------------------------------------
A0A1D8PRM6_CANAL      ------------------------------------------------------------
G8BBJ1_CANPC          ------------------------------------------------------------
C4Y757_CLAL4          ------------------------------------------------------------
PIF1_HUMAN            ------------------------------------------------------------
H2Q9L3_PANTR          ------------------------------------------------------------
G3S8K9_GORGO          ------------------------------------------------------------
A0A2J8T886_PONAB      ------------------------------------------------------------
A0A1D5Q3I2_MACMU      ------------------------------------------------------------
F7HI20_CALJA          ------------------------------------------------------------
F6UY05_CANLF          ------------------------------------------------------------
PIF1_MOUSE            ------------------------------------------------------------
PIF1_RAT              ------------------------------------------------------------
H0X2J4_OTOGA          ------------------------------------------------------------
F7ET02_MONDO          ------------------------------------------------------------
F6R806_ORNAN          ------------------------------------------------------------
I3JWJ9_ORENI          ------------------------------------------------------------
G3PSK1_GASAC          ------------------------------------------------------------
H2LXB4_ORYLA          ------------------------------------------------------------
PIF1_DANRE            ------------------------------------------------------------
F6VQD1_XENTR          ------------------------------------------------------------
G1KND2_ANOCA          ------------------------------------------------------------
W4Y048_STRPU          ------------------------------------------------------------
A0A1X7UHE6_AMPQE      ------------------------------------------------------------
W5JD43_ANODA          ------------------------------------------------------------
Q7Q395_ANOGA          ------------------------------------------------------------
J9HF21_AEDAE          ------------------------------------------------------------
Q9VQR3_DROME          ------------------------------------------------------------
Q29MC1_DROPS          ------------------------------------------------------------
A0A088ASR6_APIME      ------------------------------------------------------------
H9JHA1_BOMMO          ------------------------------------------------------------
G5EFV7_CAEEL          ------------------------------------------------------------
A8WZ54_CAEBR          ------------------------------------------------------------
A0A2H2I3F9_CAEJA      ------------------------------------------------------------
Q54Z42_DICDI          ------------------------------------------------------------
                                                                                  

A0A098E1Q1_GIBZE      -------------------------------------SPSHNADIRQQLKKPN---APAV
Q7RXT1_NEUCR          ----------------------------------SVGSQSRTSSVADMFKKPG---FGGT
PIF1_EMENI            --------------------------------------IPNSSGVAST------------
Q4WVU7_ASPFU          --------------------------------------LFRSNGIVQP------------
A0A0D8JVN0_COCIM      --------------------------------------PSGQLRLNMT------------
C0NFA5_AJECG          --------------------------------------LPKAAPLNRA------------
Q0UCQ7_PHANO          --------------------------------------ASKQQSLGSSFARTG-------
A7EDF0_SCLS1          --------------------------------------DAKKAAITQQNMTRNGNIQESL
Q5KKJ1_CRYNJ          ---------------------------------------EED------------------
A0A0D1DZD7_USTMA      ---------------------------------------GNQQDLGSSTQSTA-------
E3LA34_PUCGT          ------------------------------------------------------------
A8N8Y7_COPC7          ------------------------------------------------------------
PIF1_SCHPO            ---------------------------------------SQSDNLPSSPIT---------
I1BKX4_RHIO9          ---------------------------------------SRRGPLRSSQES---------
Q6CEU3_YARLI          SDISKDISDMDDILADIEIQPTAKLRRVKKASQSSPSLSQQIDDMMNQKKLNVDSHKPAS
A8N288_COPC7          ------------------------------------------------------------
D6RJX6_COPC7          ------------------------------------------------------------
Q5KCW7_CRYNJ          ------------------------------------------------------------
PIF1_YEAST            ------------------------------------------------------------
Q756Y6_ASHGO          ------------------------------------------------------------
W1QEW7_OGAPD          ------------------------------------------------------------
PIF1_CANAL            ------------------------------------------------------------
G8BK92_CANPC          ------------------------------------------------------------
RRM3_YEAST            ------------------------------------------------------------
Q756M1_ASHGO          ------------------------------------------------------------
W1QFA7_OGAPD          ------------------------------------------------------------
A0A1D8PRM6_CANAL      ------------------------------------------------------------
G8BBJ1_CANPC          ------------------------------------------------------------
C4Y757_CLAL4          ------------------------------------------------------------
PIF1_HUMAN            ------------------------------------------------------------
H2Q9L3_PANTR          ------------------------------------------------------------
G3S8K9_GORGO          ------------------------------------------------------------
A0A2J8T886_PONAB      ------------------------------------------------------------
A0A1D5Q3I2_MACMU      ------------------------------------------------------------
F7HI20_CALJA          ------------------------------------------------------------
F6UY05_CANLF          ------------------------------------------------------------
PIF1_MOUSE            ------------------------------------------------------------
PIF1_RAT              ------------------------------------------------------------
H0X2J4_OTOGA          ------------------------------------------------------------
F7ET02_MONDO          ------------------------------------------------------------
F6R806_ORNAN          ------------------------------------------------------------
I3JWJ9_ORENI          ------------------------------------------------------------
G3PSK1_GASAC          ------------------------------------------------------------
H2LXB4_ORYLA          ------------------------------------------------------------
PIF1_DANRE            ------------------------------------------------------------
F6VQD1_XENTR          ------------------------------------------------------------
G1KND2_ANOCA          ------------------------------------------------------------
W4Y048_STRPU          ------------------------------------------------------------
A0A1X7UHE6_AMPQE      ------------------------------------------------------------
W5JD43_ANODA          ------------------------------------------------------------
Q7Q395_ANOGA          ------------------------------------------------------------
J9HF21_AEDAE          ------------------------------------------------------------
Q9VQR3_DROME          ------------------------------------------------------------
Q29MC1_DROPS          ------------------------------------------------------------
A0A088ASR6_APIME      ------------------------------------------------------------
H9JHA1_BOMMO          ------------------------------------------------------------
G5EFV7_CAEEL          ------------------------------------------------------------
A8WZ54_CAEBR          ------------------------------------------------------------
A0A2H2I3F9_CAEJA      ------------------------------------------------------------
Q54Z42_DICDI          ------------------------------------------------------------
                                                                                  

A0A098E1Q1_GIBZE      SARTMPPFSKPLENRSSNMNQASNNK-RTPAGLGRG----SLATLCGGSNSFSERLDVVD
Q7RXT1_NEUCR          SSGAISASSRPSATTDPLTTRPANSAPRPPPNYGSSGSGRAFASLYNASDSFNDTPDVIE
PIF1_EMENI            ---------------KLPPP-QSIGVKRKIELTST---KSTLGSLHS-------------
Q4WVU7_ASPFU          ---------------KPTPPLQSIGVKRKIEMSSAG--DSALGTLHS-------------
A0A0D8JVN0_COCIM      ---------------PAASVDSVIGEKRKFDAPQS--SRNTLASLHS-------------
C0NFA5_AJECG          ---------------TPVSSSQQAGFKRKLDAVQSTPSETPLAILHS-------------
Q0UCQ7_PHANO          ---------------STQSNTNPLASSTKQNGAGKPGLSGPLARGSY-------------
A7EDF0_SCLS1          KPKPSQAIGGYVQPLRPASVNEKMLPKKSQSTIASSAVSSHLSSLFSRDG----------
Q5KKJ1_CRYNJ          --------------------GPESSQ---LDWSPSPEIVQR-------------------
A0A0D1DZD7_USTMA      ---------------RKSTTGHQSSQEFFFDWSDSPSPPRRGAQANS-------------
E3LA34_PUCGT          -------------------KTATNNNKRPLNRIDNS------------------------
A8N8Y7_COPC7          -------------------KAMSGLGSVKRDWSQSS------------------------
PIF1_SCHPO            ---------------LPAKRGRSAASLKQLDNTVGFDVSKPSLPVFE-------------
I1BKX4_RHIO9          ---------------SPSPR----RITPQFNKVVPISRPATSMPRY--------------
Q6CEU3_YARLI          AHKQTSSPGVPVFLKHSQQPLLQLQHPRRADLSSSMVQSGVLEDPFCDEINSSPPLQALD
A8N288_COPC7          ------------------------------------------------------------
D6RJX6_COPC7          ------------------------------------------------------------
Q5KCW7_CRYNJ          ------------------------------------------------------------
PIF1_YEAST            ---------------------------------------MPKWIRS--TLNHIIPRRPFI
Q756Y6_ASHGO          ---------------------------------------MLKYCRQLKTLHALQVRGTIH
W1QEW7_OGAPD          -----------------------------------MVSFLDDTARAALEAESQTRSPKIS
PIF1_CANAL            MLNANKSIIRLATYSIRNRIHHLRTLHSLNYINSRINIQDTNHIRPTCPCGSKQFMLESE
G8BK92_CANPC          -------------------------------MSRKTQSEVPKQEDAVVETQTREAKEAAE
RRM3_YEAST            --------------------------------------MFRSHASGNKKQWSKRSSNGST
Q756M1_ASHGO          --------------------------------------MYQRATHGLKR---------TN
W1QFA7_OGAPD          --------------------------------------MFNVSLKTSNS-----------
A0A1D8PRM6_CANAL      ------------------------------------------------------------
G8BBJ1_CANPC          ------------------------------------------------------------
C4Y757_CLAL4          ------------------------------------------------------------
PIF1_HUMAN            -----------------------------------------------------------M
H2Q9L3_PANTR          -----------------------------------------------------------M
G3S8K9_GORGO          -----------------------------------------------------------M
A0A2J8T886_PONAB      -----------------------------------------------------------M
A0A1D5Q3I2_MACMU      -----------------------------------------------------------M
F7HI20_CALJA          -----------------------------------------------------------M
F6UY05_CANLF          ----------------------------------------------APRALCGSAEAVAM
PIF1_MOUSE            ----------------------------------------------MRSGLCTPAEALEM
PIF1_RAT              -----------------------------------------------------------M
H0X2J4_OTOGA          -----------------------------------------------------------M
F7ET02_MONDO          ------------------------------------------------------------
F6R806_ORNAN          ------------------------------------------------------------
I3JWJ9_ORENI          ----------------------------------------MHRQFENRCFAFRSAGAAER
G3PSK1_GASAC          ------------------------------------------------------------
H2LXB4_ORYLA          ------------------------------------------------------------
PIF1_DANRE            ------------------------------------------------------------
F6VQD1_XENTR          ------------------------------------------------------------
G1KND2_ANOCA          ------------------------------------------------------------
W4Y048_STRPU          ------------------------------------------------------------
A0A1X7UHE6_AMPQE      ------------------------------------------------------------
W5JD43_ANODA          ------------------------------------------------------------
Q7Q395_ANOGA          ------------------------------------------------------------
J9HF21_AEDAE          ------------------------------------------------------------
Q9VQR3_DROME          ------------------------------------------------------------
Q29MC1_DROPS          ------------------------------------------------------------
A0A088ASR6_APIME      ------------------------------------------------------------
H9JHA1_BOMMO          ------------------------------------------------------------
G5EFV7_CAEEL          --------------------------------------------------MSKSLQTDEN
A8WZ54_CAEBR          --------------------------------------------------MNKNLENAEN
A0A2H2I3F9_CAEJA      --------------------------------------------------MSKNIEEA--
Q54Z42_DICDI          ----------------------MFLRLSLKTIKKCQSNFITSFNSKQYKFFTTHYGYDFF
                                                                                  

A0A098E1Q1_GIBZE      LTGSES---QTKAQSAVFFNESDFSDDDDLDLDFKAPSALPPLPPAASTPTKSVPNERMP
Q7RXT1_NEUCR          VSMQSTRRPQHDLTSSVYIEDDDFSDDENLDLDFEAPSALPVLPTGRISLEQHRELQKQQ
PIF1_EMENI            ---------------AVYFDENDFDDDDDLDFESPDPYIPPARIEKDSFRE--ESFHAAK
Q4WVU7_ASPFU          ---------------AVYFDENDFDDDVDLDSEGPEPFIPPTKIVRPSIAD--QSTVTSN
A0A0D8JVN0_COCIM      ---------------TVYFDENDFEDDDELDF--------SSPIVPLSPGK--ELSKSSF
C0NFA5_AJECG          ---------------NVYFDENDFDDDIDLDE--------PTSFSSNLVQS--QSFASSR
Q0UCQ7_PHANO          ---------------NQGTKRTSTGLAKTLDFHEDIIDYPTLNIVDLEKEN--DLPMAYS
A7EDF0_SCLS1          -----AFQDTPNSSFAVEFNEDDWSDDDNIDFDISYTLPTQSLSTNASMPAPPKPTLTTI
Q5KKJ1_CRYNJ          ----------------------KGNILPS-------SGPLQSTTTSPSLPESAAKEIASQ
A0A0D1DZD7_USTMA      --------------HGVDSDKENGASEPSEKRTKSAAGPIQASSSKTSVQPQNGFVSASS
E3LA34_PUCGT          --------------------NTSTEQQQQQPKPTGKLSSLSRQWSSNEPQPPKNLPSSQP
A8N8Y7_COPC7          --------------------LPASSQE----------VPIPWEPSPPRQQPQKRPMTDAE
PIF1_SCHPO            ----------------NSGLGSKYSTEIANGVYIDENDFDDDLLLENDIDQKPIPWSSSP
I1BKX4_RHIO9          -----------------------------------------DWLGDNDVK----PYSSNY
Q6CEU3_YARLI          SSPYFSQKTSGNLLNLPNLPAFDFSSQTLQRSKSDSLKFNKKLISSFDLEGDLSDTKYGV
A8N288_COPC7          ------------------------------------------------------------
D6RJX6_COPC7          ------------------------------------------------------------
Q5KCW7_CRYNJ          ---------------------MPKPGFYAVRFGRRPGVYITWAECQQQVHMFPGAVFKKF
PIF1_YEAST            CSFNSFLLLKNVSH----AKLSFSMSSRGFRSNNFIQAQLKHPSILSKEDLDLLSD----
Q756Y6_ASHGO          AGSKSYLVMKNRLE----GSWAFNSDAKRFKHDGSMVQELEGEG--KRGNASVLEE----
W1QEW7_OGAPD          SADFNYSFSQDAEDEGVISIEEFQANQRPVSTPVEQTSSSVADSSPVDHRTRVLYP----
PIF1_CANAL            LDSALIEFLDNDDPFSDSEIKESDDLSKGQSHVYNGSPVTKNSILQIEKQQIQKSPRPTE
G8BK92_CANPC          EVQPSFEFSDTTQLESLLQYQPSNEHQLGKSNVTSG--VVKKEIEDLDADSFTESP----
RRM3_YEAST            PAASASGSHAYRQQTLSSFFMGCGKKSAAASKNSTTIIDLESGDEGNRNITAPPRPRLIR
Q756M1_ASHGO          PAPTDPAKRPKLKQGTLSFLYDAKKKAAAVAAP----ARLPVGNAPERRLPAAAGLPALR
W1QFA7_OGAPD          -----KKPGASKQSTLASFITSSKPSRDTKPSQPFSALKLDKRSVSN-------------
A0A1D8PRM6_CANAL      ---------------------------MARDLEVAFEKKKQQQ-----------------
G8BBJ1_CANPC          --------MPTKSKKQSTLGQQSILAYLGIDGSKANNDKPKQH-----------------
C4Y757_CLAL4          --------MAQKKPRQ--------RSIASFFAPAPARKKVSTP-----------------
PIF1_HUMAN            LSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPG
H2Q9L3_PANTR          LSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPG
G3S8K9_GORGO          LSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLRA--
A0A2J8T886_PONAB      LSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPG
A0A1D5Q3I2_MACMU      LSGMETAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPG
F7HI20_CALJA          LSGTEAAAGDYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPG
F6UY05_CANLF          PSGTPAAPAEFEDAELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELLLRLRASG
PIF1_MOUSE            PSSTEAATDECDDAELRCRVAVEELSPGGQPRKRQALRAAELSLGRNERRELMLRLQAPG
PIF1_RAT              PSSTEVATDECDDTELRCRVAVEELSPGGQPRKRQALRAAELSLGRNERRELMLRLQAPG
H0X2J4_OTOGA          LLGTEMTAAECEDAELRCRVAVEELSPGGQPRRRQALRTAALSLGRNERRELMLRLQAPG
F7ET02_MONDO          --MMLSELGEPENPALHCRVALEELSPGGQPRRRQAIKDAELSLGRNERRELMLRLQGTG
F6R806_ORNAN          -MATEQEAAEQEATELRCRVSVEELSPGGQPRRRQVLREAQLSLGRNERRELVLRLQA-G
I3JWJ9_ORENI          QRVAVMLSGEDG-AQLQCTVTVEQLNSSGQATRRQVIRKASVILGRNEFQEIVLRVHDGK
G3PSK1_GASAC          -----MLGEEDGGAQLQCCATVEQLNTSGQATRRQVIRKASVVLGRNEFNEIILRVHDGK
H2LXB4_ORYLA          -----MLSGDDG-VDLQCCVTVEQLNSSGQATRRKLIRKAAVILGRNEFQEILLRVHDGK
PIF1_DANRE            -----MLGQMEP-AELQCTVAVERLNPAGQAIKRQLIRKGTVTLGRNEFQEMILRVHDGK
F6VQD1_XENTR          -----MMLAEQLSPEIQSSITIEYLNSSGQTLKRKAIRNALVSLGRNEFRDLVLKVSDGK
G1KND2_ANOCA          -----MQPGSEVGGQIHCMVAIERLGAT--APSRVLLRDALVTLGRDEFRTLVLRVSTTS
W4Y048_STRPU          ----------MDCPELVCSVAIEKLDTSGEVTKRTMCRNGSLILGRNEFRDVLLKVHTGK
A0A1X7UHE6_AMPQE      --------MESSENVLSCTCRIETVDRSGALLKTQTLTKAELIIGRNQFQDVVLKVSYPE
W5JD43_ANODA          --------MDPNDASLTCAVTIEWTNQHGTTTRKLANKQATLRLIRNAAKDLLLNVASDK
Q7Q395_ANOGA          --------MDPNDASLTSAVNLEWNDAHGTTTRKFAHKEATLRLIRNALKEMFLEVSAPK
J9HF21_AEDAE          --------MDPNNASLSCVANIVWTNSLGTTIKKVAYKQATLRLVRNTLKEMFLEVSGEK
Q9VQR3_DROME          --------MDLNDAVLTCAVNMEWTNAVGITGRKLAYKTATLRLVRNDLRELFVEVTPEK
Q29MC1_DROPS          --------MDLNDAVLTCAVNIQWTNAVGITGRKLAYKTATLRLVRNDIRELFVEVTPEK
A0A088ASR6_APIME      --------MDQDNCSVTCSVVIEWTNSQGSIVKKTNHRSATLRLIRNNFREIYIEIRAEK
H9JHA1_BOMMO          ---------------------------------------------------MFLEVTSEK
G5EFV7_CAEEL          GGVSESPSNCTYCYTLECSLRIESTSSIKKKTPISSK-SAIMTVGRNAQRKIHLQIELKT
A8WZ54_CAEBR          DGISESPSNCTYCYTLTCSLRIESTSSSKKKTPINAK-NAILTVGRNSNRKIHLQIELKT
A0A2H2I3F9_CAEJA      -GVSESPSNCTYCYTLDCSLRIESTSSSKKTAPITAK-KALLTVGRNSQRQILLQIEIKT
Q54Z42_DICDI          NNDENDSGGGEYQTSFDYDVDIEVPILSNVTTSNTTIINRPFYNNNNNNNLQVSSLTAEK
                                                                                  

A0A098E1Q1_GIBZE      QP---------PTSTQTDRTIPWSSSPPSHFLPPAQNTSAGSTMANISMKRDSSGDHHDI
Q7RXT1_NEUCR          EEEVKESRFREPPSGTHTSVLSWPESSPSHLQPPKRELNPPPNTNTKHARLQD--DDFDF
PIF1_EMENI            SNSTLSHKADSQSAVTVSKTNYESDIKYPDLPPVPP--DDNPGPSSSALPWSS-----SP
Q4WVU7_ASPFU          ANSTGNNVS--QSAERVTVDLISSDIKYPELPPVSN--DHVPPSSSVQIPWSS-----SP
A0A0D8JVN0_COCIM      VS--------------------ENTIKTPPLPENNAVDREVAPASSAPLPWSS-----SP
C0NFA5_AJECG          IQ--------------------PPE-LPPPLEQPAPPSDNVAPPSTIPLPWSS-----SP
Q0UCQ7_PHANO          ASAR-----------------TKSAGLATALFDEDDFDSDIDLDVEDPATKGR-----AF
A7EDF0_SCLS1          PSSPFAERVKSQRAPSSSAHTWSSSPPSHKETPPGAKKRREREHEQSAVQSLI-----II
Q5KKJ1_CRYNJ          RRRK-----------------AILAALNQNKETVYASPVLDWRSGQTSSTFAS-------
A0A0D1DZD7_USTMA      IHRG-----------------SRHGSDTHTYAGDSHRPYAESYSGRSSHPSRSVDLITQF
E3LA34_PUCGT          PPQS-----------------SSQPSWQLDQEEWPPTPPQPDPPSKKPKPNNN-------
A8N8Y7_COPC7          KRLA-----------------NIQAALQSVQSNKPPAPLQTSEAANR-RPKR--------
PIF1_SCHPO            IE--------------------HTKLTKSMLSSEKRSKNHLSKIYEDHTSEKGASSVISS
I1BKX4_RHIO9          VP--------------------YNSTSTNAFE----------------------------
Q6CEU3_YARLI          CDLESAGRP--QQLRSESARRQQSREAGQVMSSVSHETNDKPLSSLPPHSSPSRERSLST
A8N288_COPC7          ----------------------MPSVRINPRDGTHLSYRQVQAKWLKELREAR-------
D6RJX6_COPC7          ----------------------MPKAKAQKWYAVQIGRDGPQIYDNWNDCKDK-------
Q5KCW7_CRYNJ          GTYDEASLWASLRPQTPPPPETSETDRKDGLKESDKGKRISDSADPSAQHGPR-------
PIF1_YEAST            ------------------------SDDWEEPDC------IQLETEKQEKKIITDIHKEDP
Q756Y6_ASHGO          ------------------------AWDTSGDDD------ILQHIAALE------------
W1QEW7_OGAPD          ------------------------EFKRRQRDSPHWTQGTHAGVTLDHVRDYLTWFGTLS
PIF1_CANAL            TNKRMQIRKDPDQNDNVDDDSLSSTFEFSDMDDDFMEALKAAEEITGNNTNCIKRTASTP
G8BK92_CANPC          --------------------SNSDAFEFSENDDEVLAMLDDAELHSQSPNK-----NDSP
RRM3_YEAST            NNS--------------SSLFSQSQGSFGDDDPDAEFKKLVDVPRLNSYKKSSRSLSMTS
Q756M1_ASHGO          -----------------SALFD-SQGSFEEATDDAYITSMLHEKPVHNFKTLSR----SS
W1QFA7_OGAPD          ------------------------DEDFLQNKENAYKRVKLDRSVSCVGFGQLETPVSDM
A0A1D8PRM6_CANAL      ------------------------QPLLFIMTPPVKSQFSLD-DFFKK-SKYLNPVKAPV
G8BBJ1_CANPC          ------------------------HNKHISRQNSILSATNND-DGFGDDSSYDTSIDTSM
C4Y757_CLAL4          ------------------------EKVVVARADSLLSEMASARSTFDDFASSDTSFGSP-
PIF1_HUMAN            PA------------------GRPRCFPLR--AARLFTRFAEAGRSTLRLPAHDTPGA--G
H2Q9L3_PANTR          PA------------------GRPRCFPVR--AARLFTRFAEAGRSTLRLPAHDTPGA--G
G3S8K9_GORGO          ------------------------CFPLR--AARLFTRFAEAGRSTLRLPAHDTPGA--G
A0A2J8T886_PONAB      PA------------------GRPRCFPLR--AARLFTRFAEAGRSTLRLPAHGAPGA--G
A0A1D5Q3I2_MACMU      PA------------------GRPRCFPLR--AARLFTRFAGAGRSTLRLPAHGVPGA--G
F7HI20_CALJA          PA------------------GRLRYFPLR--AARLFTRFAAAGRSTLRLPTQGAPGA--G
F6UY05_CANLF          PP------------------GPPRCFPLR--AARLFSRFAAAGRSTLRLPGAGAPGA--G
PIF1_MOUSE            PT------------------GRPRCFPLR--AVRLFTRFAATGRSTLRLPTDGVPGA--G
PIF1_RAT              PE------------------GRPRCFPLR--AVRLFTRFAAVGRSTLRLPADGVPRA--G
H0X2J4_OTOGA          PA------------------ERPRCFPLR--AARLFTRFAAAGRSTLRLPAHGAARA--G
F7ET02_MONDO          ---------------------QSRCFPLR--TARLFTRFAAVGRSALRLSPDSDAGLSSG
F6R806_ORNAN          AA------------------AGPRLFPLR--AARLFTRFSASGRSGLRLGPAPDSGS--G
I3JWJ9_ORENI          ---------------------VPQSYHLK--EFKLFTKFARDGKCTVKLVP--------E
G3PSK1_GASAC          ---------------------IPQNYRLK--EFKLFTKFAREGKCTVKLLP--------E
H2LXB4_ORYLA          ---------------------LAQSYRLK--EFQLFTKFVRDGKCTVKLLP--------E
PIF1_DANRE            ---------------------APQNFMLR--DFQLFTRFAKDGKCTVKFVP--------E
F6VQD1_XENTR          ---------------------LQQNFVLK--QIKLFTRFIRDGKASVVLLP--------E
G1KND2_ANOCA          GP------------------GPPQNFPMRREEVRLFTRFMKDGKSSIRLGPVAGL----N
W4Y048_STRPU          ---------------------TSSTLVMQ--DVVLHRRFASDGKACIRLPK--------K
A0A1X7UHE6_AMPQE      --------------------GKQGPYTIK--DYKIHKRFVQEGKATISLQT--------Q
W5JD43_ANODA          ---------------------SQLA-KLLLRGVSVHSKFMTEGKASIKFNE--------E
Q7Q395_ANOGA          ---------------------TSTM-QLKLRGVQVHSKFMAEGKASIKFND--------E
J9HF21_AEDAE          ---------------------VNPI-KMKLKGIKVHSKFMAEGKASIQFTD--------E
Q9VQR3_DROME          ---------------------LKPL-KFKLKDLMVHKKFMSEGKATFNFKA--------E
Q29MC1_DROPS          ---------------------LKPL-KFKLKDLMVHKKFMAEGKATFNFKA--------E
A0A088ASR6_APIME      ---------------------ANTITKLSLISISVFNKFMTEGKASIKFKK--------E
H9JHA1_BOMMO          ---------------------HAAT-KLALKSFNVFKKFMAEGKASIKFQE--------A
G5EFV7_CAEEL          TAT-----------------GQPAVVCYDVTDAVVHLQSVANGKCTVEIPS--------L
A8WZ54_CAEBR          SQT-----------------GQPAVVSYDATDAVVHLQNVANGKCTVEIPS--------M
A0A2H2I3F9_CAEJA      KTS-----------------GQPAAVCYDATDAIVHLQNVANGKCTVEIPS--------K
Q54Z42_DICDI          LPKKIKIN---------------KKPLVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                  

A0A098E1Q1_GIBZE      GVPAHKKAKKRVLPQSFKQEEPED------------------------------------
Q7RXT1_NEUCR          EPPAAVKKPKRELPWTMEAESKEEDWKHAE------------------------------
PIF1_EMENI            PSHFQKPAAPRTVPWRKQE-----NNIITI------------------------------
Q4WVU7_ASPFU          PHHLQQPNSSRTLPWLTKN-----DELSKV------------------------------
A0A0D8JVN0_COCIM      PSHFQPP-KRQTIPWLEKEPVPSPPAPPPP------------------------------
C0NFA5_AJECG          PANLLPPAKRRALPWQADATKSETERRPRI------------------------------
Q0UCQ7_PHANO          LPWSQNQKAANTQEAKDEIDSEEEIIRPKK------------------------------
A7EDF0_SCLS1          EDDEAPKPKRRTLPWIQKQSEQDEVSHRQEQ-----------------------------
Q5KKJ1_CRYNJ          ---PQDINCDISVPSVATH---CPGSSIRH------------------------------
A0A0D1DZD7_USTMA      SYDRQQARSGLPMSASGTDRGSAPNSATGS------------------------------
E3LA34_PUCGT          --ISYPTSAIRYPPQNQNNQKNTLERTTSA------------------------------
A8N8Y7_COPC7          -----PSLEDADAPPSKKRQ----------------------------------------
PIF1_SCHPO            NITRQGIKRSRTLPWAVDPYRYGDPDPKRT------------------------------
I1BKX4_RHIO9          -------KRPRVLPYAVKRPLEDE------------------------------------
Q6CEU3_YARLI          PTELLNYNASDVKPTSTPLASSQIEWEPSSRELCGYDVHTLNLRQKAKLKEYGRLSPGDL
A8N288_COPC7          KASRLQQAAQNDATVTDANNSPSEQSTLQTN-----------------------------
D6RJX6_COPC7          VSRYPGAVHKSFKTRKEAENWLGDHSSKELK-----------------------------
Q5KCW7_CRYNJ          SSSKASPSHPLHLPYQQDCKRERSEDTDDTE-----------------------------
PIF1_YEAST            VDKKPMRDKNVMNFINKDSPLSWNDMFKPSIIQP--------------------------
Q756Y6_ASHGO          -ERRGEPD-----------PSMCSGVASGTRLEV--------------------------
W1QEW7_OGAPD          PSNKHIADTAVNKIQKYFEKKNQEKSGQESIQPP--------------------------
PIF1_CANAL            LKKPIAKSMKNSSTPSKSAGKKYCKYIKTSSPSPSHYLIRE-------------SGSGVD
G8BK92_CANPC          PVVTRASSFKRSASSSQSPPESKRSTMSQSQTQTVKAPAR--------------SGVSKF
RRM3_YEAST            SLHKTASASTTQKTYHFDEDETLREVTSVKSNSRQLSFTS--------------------
Q756M1_ASHGO          SVLAPAENGQRLASHGVRKPPSGTSAPAVDSPP---------------------------
W1QFA7_OGAPD          SISQPSSFKHSKPIEKLEFEKTEIDVSTRQDVS---------------------------
A0A1D8PRM6_CANAL      KPVFQR----QDSVLTSLDDDAGFDDVDVSYDT---------------------------
G8BBJ1_CANPC          EMSNFKNPTLESAVLQHRANQSLSSQRTLKILG---------------------------
C4Y757_CLAL4          EVTNFK--------------NPVLSRVSSNLTG---------------------------
PIF1_HUMAN            AVQLLLSDCPPDRLRRFLRTLRLKLAAAP-------------------------------
H2Q9L3_PANTR          AVQLLLSDCPPDRLRRFLRTLRLKLAAAP-------------------------------
G3S8K9_GORGO          AVQLLLSDCPPDRLRRFLRTLRLKLAAAP-------------------------------
A0A2J8T886_PONAB      AVQLLLSDCPPDRLRRFLRTLRLKLAAAP-------------------------------
A0A1D5Q3I2_MACMU      AVQLLLSDCPPDRLRRFLRTLRLKLAAAP-------------------------------
F7HI20_CALJA          AVQLLLSDCPPDRLRRFLRTLRLKLAAAP-------------------------------
F6UY05_CANLF          AVLLLLSYCPPDRLRRFLRTLRLKLAAAP-------------------------------
PIF1_MOUSE            SVQLLLSDCPPERLRRFLRTLRLKLAVAP-------------------------------
PIF1_RAT              SVQLLLSDCPPERLRRFLRTLRLKLAVAP-------------------------------
H0X2J4_OTOGA          AVQLLLSDCPPDRLRRFLRMLRLKLAAAP-------------------------------
F7ET02_MONDO          SIQLLLSDCPPDRLRRFLRTVRLKLATAP-------------------------------
F6R806_ORNAN          SVQLLLSDCPPLRLRRLPAHLKATAGRES-------------------------------
I3JWJ9_ORENI          NIQVLMSNCPTDQLSLFLKTLSIKHQAWQ-------------------------------
G3PSK1_GASAC          NTQVLLSNCPPDRLNLFLKTLSIKHQARL-------------------------------
H2LXB4_ORYLA          NTQVLLSNCPPDRLSLFLKTLSIKHQAWR-------------------------------
PIF1_DANRE            NTQVLVSDCPPDRLKMFLKTLSIKHQASQ-------------------------------
F6VQD1_XENTR          NVQLLISNCPSDKLQHFMKTLLIKHEAGK-------------------------------
G1KND2_ANOCA          HVQLLLSNCPPDQLRHFIHMLRIKLEATQ-------------------------------
W4Y048_STRPU          CLQVMISNCPPHQLKSFLKSLALKMACKK-------------------------------
A0A1X7UHE6_AMPQE      QIHLMVSNCPTELLKVFLKCLLLKLTA---------------------------------
W5JD43_ANODA          KCTLFLSNAPPGLLVQFLKVIFVKLTNGKAGTTAPA------------------------
Q7Q395_ANOGA          KCTLFLSNAPPGLLVQFLKVVFVKLTNGN-GAGGQP------------------------
J9HF21_AEDAE          KCSCFLSNAPPGLLVQFLKVIFIKITSDQTSNGE--------------------------
Q9VQR3_DROME          KCTLYLSNAPPGTLMFFLRTIFVKMNGNEGGSQPD-------------------------
Q29MC1_DROPS          NCAIYLSNAPPGTLMFFLRTIFIKMNGD--GGQPD-------------------------
A0A088ASR6_APIME      NCTLFLSNAPTSQLINFLKMIYIKISDQ--------------------------------
H9JHA1_BOMMO          NCTIFISNAPPTNLVMFLRTIFVKMTSDE----EQK------------------------
G5EFV7_CAEEL          SLMFQMFNCAPRKLNVFMKSLQAKLDIMKME-----------------------------
A8WZ54_CAEBR          SIMLQMFNCAPRKLNVFMKSLQAKLDIMKAE-----------------------------
A0A2H2I3F9_CAEJA      TIMLQLLDCAPRKLNVFMKSLQAKLDIMRME-----------------------------
Q54Z42_DICDI          NNNKNSNNVNLTKTTKSTNTSTTQSQPNDQG-----------------------------
                                                                                  

A0A098E1Q1_GIBZE      ------------------------------EDDNYASVIQTPNNKR--------------
Q7RXT1_NEUCR          --------------------------KYPLEKSGYAPTPES-KPKG--------------
PIF1_EMENI            ----------------------------DDEAK--PETPARPAA----------------
Q4WVU7_ASPFU          ----------------------------EGYKK--PETPTRPKS----------------
A0A0D8JVN0_COCIM      ----------------------------RQEEK--PLQAATTKAP---------------
C0NFA5_AJECG          ----------------------------KQEPKTVPRTPASNKTS---------------
Q0UCQ7_PHANO          ----------------------------RQTTEVKAEVAATPKPKS--------------
A7EDF0_SCLS1          --------ADELSSQTSGTSAPAVCFKCRQTGHYSKQCPNSRKGKPSEWDLDQHDCTSVN
Q5KKJ1_CRYNJ          -----------------------------------VNQTLPSLPKR--------------
A0A0D1DZD7_USTMA      -----------------------------------SNAYARTSSAH--------------
E3LA34_PUCGT          ------------------------------NKALPWELPAPQNPRN--------------
A8N8Y7_COPC7          -------------------------------------LPASWAQSN--------------
PIF1_SCHPO            --------------------STSADISQHTVSNDSSNKLSNGRSSS--------------
I1BKX4_RHIO9          ---------------------------------NSVSFYSNKRRQP--------------
Q6CEU3_YARLI          RDTRVKRFKSAGEAEPREQQPDGDSAVAGVSKNGFANSPRKNESRRAK-----SESAPKV
A8N288_COPC7          -----------------------------------TPLSTALASPQ--------------
D6RJX6_COPC7          -----------------------------------KEFFQPHGSAY--------------
Q5KCW7_CRYNJ          -----------------------------------SPGRKAKAGKHD-------------
PIF1_YEAST            ------------PQLISENSFDQSSQKKSRSTGFKNPLRPALKKESSFDELQ--NNSISQ
Q756Y6_ASHGO          ------------QMQRTEAEIKQSKE-----------------APEPLIELP--DVQILG
W1QEW7_OGAPD          ------------PDSPTPDDSHNGIESIMETPVKHNTVNVTAAKAEKANTLPLKENKVLL
PIF1_CANAL            ILEGSPNKVQADNASPFRITSSFSSPSQIQNQGVGANPGPKSKAEQNVSSASQSSSPPMT
G8BK92_CANPC          IVTSSPPKSLHTQTSQSKASESKGSP-------VTNHPVANPPAESNSPQKVFARPSAKI
RRM3_YEAST            -----------------------------------------------------TINIEDS
Q756M1_ASHGO          -----------------------------------------------------------P
W1QFA7_OGAPD          -----------------------------------------------------------I
A0A1D8PRM6_CANAL      ----------------------------------------------------------SV
G8BBJ1_CANPC          ----------------------------------------------------------ES
C4Y757_CLAL4          ----------------------------------------------------------SP
PIF1_HUMAN            -----------------------------------GPGPASARAQLLGPRP---------
H2Q9L3_PANTR          -----------------------------------GPGPASARAQLLGPRP---------
G3S8K9_GORGO          -----------------------------------GPGPASARAQLLGPRP---------
A0A2J8T886_PONAB      -----------------------------------GPRPASAREQLLGPRP---------
A0A1D5Q3I2_MACMU      -----------------------------------GPGPASARAQLLGPRP---------
F7HI20_CALJA          -----------------------------------GPGPASARAQLLGPRP---------
F6UY05_CANLF          -----------------------------------GPAPPSARAQLLGPRP---------
PIF1_MOUSE            -----------------------------------GPGPASARAQLLGPRP---------
PIF1_RAT              -----------------------------------GPGPASARAQLLGPRP---------
H0X2J4_OTOGA          -----------------------------------GPGPASAREQLLGPRP---------
F7ET02_MONDO          -----------------------------------GPGPAPFRSRLLGPRP---------
F6R806_ORNAN          -----------------------------------LPGPPKVRRFLRTPKL---------
I3JWJ9_ORENI          -----------------------------------GSKALSNREKLKAGLP---------
G3PSK1_GASAC          -----------------------------------SSKPMTDREKLKAGLP---------
H2LXB4_ORYLA          -----------------------------------SCKPLSEREKLKAALP---------
PIF1_DANRE            -----------------------------------SSKPLSDREKLRAGLP---------
F6VQD1_XENTR          -----------------------------------TEKPVNERTRLLSGLP---------
G1KND2_ANOCA          -----------------------------------KG-PVTERKRLLSGLP---------
W4Y048_STRPU          -----------------------------------TDKCNMDCPELVCSVA---------
A0A1X7UHE6_AMPQE      -----------------------------------RGALQGSRQHLSGDVS---------
W5JD43_ANODA          --------------------------------TSKAEVLKNARLQMLSGEAS--------
Q7Q395_ANOGA          --------------------------------KSKDELLKQSRAQMLAGK-S--------
J9HF21_AEDAE          ---------------------------------SKEDMLKKTRAHLLSGK----------
Q9VQR3_DROME          ----------------------------------DATLQKKLREHLMSGK----------
Q29MC1_DROPS          ----------------------------------DASMQKKLREHLLSGK----------
A0A088ASR6_APIME      ----------------------------------EDKVKNSLKEKLLSNK-P--------
H9JHA1_BOMMO          --------------------------------ANKTPSKQSMRAKLLSGK----------
G5EFV7_CAEEL          ------------------------------------KSPISAVPRQFSRPP---------
A8WZ54_CAEBR          ------------------------------------KQPISAVSKNFSRPP---------
A0A2H2I3F9_CAEJA      ------------------------------------NGTIQVVPKPISRLP---------
Q54Z42_DICDI          ---------------------------------LFSPTKTKNKTSSVNEKEE--------
                                                                                  

A0A098E1Q1_GIBZE      ---KDFLNPTASAVKEQKKQFRNQRQQ----------EQPSANTDLPMGEIQEITTSN--
Q7RXT1_NEUCR          ---SMLWNTTASAVKEQKKQLKDRQKS----------SSVAPKTEIPMDEIKKVVSSH--
PIF1_EMENI            ---TAPWNKTASAIKEEQKELRRQNKK----------AQAQKTQSSTKHHMPRAQ-----
Q4WVU7_ASPFU          ---TAIWNKSASAIKEEQKELRRQHK------------KNQKGDTNFKQLQTRPK-----
A0A0D8JVN0_COCIM      ---SYPWNKTLSAVKEDQKELRKQHK-----------TRATVEKQGHNPPKPVPK-----
C0NFA5_AJECG          ---SLPWDKTMSAVKEQQKELRKQQK-----------TRISSEKNPTHVGTRAPK-----
Q0UCQ7_PHANO          ---QYLWNATASALKEQQKNLREQNK-----------KQTKEADTSVDDLQAAVKKRK--
A7EDF0_SCLS1          QDKKQPWDNTERQVAENKKLVKERRKK----------TVDLAEKAAAEAHVRTKTAK---
Q5KKJ1_CRYNJ          ---PLPWEGDQKARKKVYTQTSLTPK-----------ENAQPKS--TSSALNIKQ-----
A0A0D1DZD7_USTMA      ---SMSWMKTASQLKNERRNDPAAYQ-----------ASSLIPSSGQADSLNINK-----
E3LA34_PUCGT          ---NNQINGSSSSSSSKSVAFNQLQGI----------GKQNKSDAIIKSHLNNPNMS---
A8N8Y7_COPC7          ---SGFGKDSIAAPQTSGRSSKPPSSK----------GRVITPSSSGSSIFNNNSKK---
PIF1_SCHPO            ---LDSLAKKRMSKSKSTPQISKKFSV----------PLNSASKSPIGSSLFKTSDSR--
I1BKX4_RHIO9          ---PTGISSDLWSRTNDVRKRRTTKEA----------PLAPPMSSYSAPATYRPT-----
Q6CEU3_YARLI          LQQLDFFNKSNRPQLDAGLKSKGPRKS----------IQSRLYTTTTHNTLVDVDGEEDG
A8N288_COPC7          ------QASAGPSSTAVAHVDDHRMGS----------PSPDDHQEGISPAVLSSNIPAAV
D6RJX6_COPC7          ------RTKEKSPSQKLLPEAKPQL-----------------------------------
Q5KCW7_CRYNJ          ------RNEDKNGYDGFTAMDDYISVL----------PPDDEAGQSSSTQVDGNITTAEL
PIF1_YEAST            ERSLEMINENEKKKMQFGEKIAVLTQR----------PSFTELQNDQD--DSNLNP----
Q756Y6_ASHGO          SKTVDSK-ESIKNSAAGTQELAFLTQR----------PTLHEHISADQPQASDQRP----
W1QEW7_OGAPD          NKPLDGR-RMMSTSSAAYAKLELLTQK----------ESLFADVKRKN--DANEAK----
PIF1_CANAL            VSQVRNPFKVPTQFRRNYSTRPITNQG----------SDTKKGNSHHTILLATQKPGVPF
G8BK92_CANPC          SSFTYRGGTATGPSTRNYSTVPQLERP----------S--KTPINHHTILLATQRPSVEK
RRM3_YEAST            SMKLSTDSERPAKRSKPSMEFQGLKLT----------VPKKIKPLLRKTVSNMDSM----
Q756M1_ASHGO          RRIAGVRSHNPVPESTAAREVP--PFT----------VARRLKPVATHRVAPARS-----
W1QFA7_OGAPD          GRSIKLPVRKPVSASR-QRSLPWSNLN----------MKKISNPRNQNKPSSQNG-----
A0A1D8PRM6_CANAL      EVVNLRNTVLPTQTKRSADVLEVYQ----------------PRKLTKVEPTKEVA-----
G8BBJ1_CANPC          NLVNTTQSGKDNLKRTNSDILSTFEGG----------QAKKVAKLTNFKSPTISQ-----
C4Y757_CLAL4          PRKNHGISGSSQEKRQFSRTFFDLDAR----------PKKVPRRVPKAASPSLS------
PIF1_HUMAN            ---RDFVTISPVQPEERRLRAATRV----------------PDTTLVKRPVEPQA-----
H2Q9L3_PANTR          ---RDFVTISPVQPEERRLRAATRV----------------PDTTLVKRPVEPQA-----
G3S8K9_GORGO          ---RDFITISPVQPEERRLRAATRV----------------PDTTLVKRPVEPQA-----
A0A2J8T886_PONAB      ---RDFVTISPVQPVERRLGAATRV----------------PDTTLVKRPAEPQA-----
A0A1D5Q3I2_MACMU      ---HDFVTISPVQPEERRLGAATRV----------------PDTTLVKRPAEPQT-----
F7HI20_CALJA          ---LDFVTISPVQPEERRLGAATQV----------------PDT-MVKRPVEPQA-----
F6UY05_CANLF          ---RDFVTISPVQPEELRRAVATRD----------------PRATPVKRPLQPCA-----
PIF1_MOUSE            ---RDFVTISPVQPEELQRAAATKA----------------PDSALEKRPME--------
PIF1_RAT              ---RDFVTISPVQPEELRRAAATKA----------------PDSALEKRPME--------
H0X2J4_OTOGA          ---RDFVTISPVQPEELQRGAATRV----------------PDTTLVKRPAEPQTR----
F7ET02_MONDO          ---QAFYTISPIQPEDLKPVAATAT----------------QDTTPVKRPCLQEIR----
F6R806_ORNAN          ---KMFLALSPVQLENRHQDADATL----------------DATPREPGAPSFSPL----
I3JWJ9_ORENI          ---RSFEAISPLQQKDIQKVNELRS----------------KVAPNGLTDR--TNRM---
G3PSK1_GASAC          ---RSFEAISPLQQKDIQKINELRS----------------KVDPKGLVDR--TNR----
H2LXB4_ORYLA          ---RSFEAISPLQQKDIQKANELRS----------------KAS-GGPADC--TNR----
PIF1_DANRE            ---RAFETVSPLQLKDVEKANELRS----------------RVNAPMQPRC--LAERPVN
F6VQD1_XENTR          ---RVFETISPVQKKDVEQANEMRA----------------KANSETPVKG--RGLSNKG
G1KND2_ANOCA          ---RSFDTISPVQVRDLQQASSARQ----------------ALAEIATPVKGRD------
W4Y048_STRPU          --IEKLDTCGEVTKRTMCRNGSLILGRNEFRDVLLKVHTGKTSSTLVMQDVVLHRRFASD
A0A1X7UHE6_AMPQE      ---TEFETISPLNMRDLEQAKQNVGGEHN------------KENNVSLTPKRTLPLS---
W5JD43_ANODA          -L-HQYDEISPVTTVELNRAKKLAL---------------GGGSTTTPSPSQKRKRPSGD
Q7Q395_ANOGA          -M-NQYDDVSPVTTTELNRARKLAT---------------GKGSLTTPSPSQKRKRLSDG
J9HF21_AEDAE          -A-NQFDDISPVTNAELARAKKMAS---------------GNGSVTTPSPPQKRKRLSGE
Q9VQR3_DROME          -P-SSFNDVSPVTTAEMILARKKAGLL-------------SKGSVTTPSPQGAKKRRFEE
Q29MC1_DROPS          -P-SSFEDVSPVTTAEMILARKKAGLV-------------PKGTTTTPSPQGAKKRRFDE
A0A088ASR6_APIME      -F-VGYQEISPATSTEKNRAKEKALVV-------------SRATTTTPSPSAVKKRKRID
H9JHA1_BOMMO          -S-QSFDEISPVTVADIHIAKSKIS----------------KSTITTPSPPSKKRKNDDP
G5EFV7_CAEEL          ---AVFSVLSPLTISEMRKVKKLREPSALARP-------SKEATTPKRRTSSMNLLAGGL
A8WZ54_CAEBR          ---AVFNVLSPLTVGEMRKVKKLREPSSLASSASTSSNGSKTATTPKRRNS----TNQNL
A0A2H2I3F9_CAEJA      ---AAFSVLSPLTIGEMRKVKKMREPLSITNS------NGKQVTTPKRRSSSTMLIPGGL
Q54Z42_DICDI          ---IEILNNFAKSLQDQQQKVKTIFDK------------FENIENDNSDNVDSQN-----
                                                                                  

A0A098E1Q1_GIBZE      ---------------------------------------------------SKANFAVSL
Q7RXT1_NEUCR          ---------------------------------------------------LSKASAITL
PIF1_EMENI            ------------------------------------------------------VAPIFL
Q4WVU7_ASPFU          ------------------------------------------------------IASLFL
A0A0D8JVN0_COCIM      ------------------------------------------------------IARMFL
C0NFA5_AJECG          ------------------------------------------------------VASIFL
Q0UCQ7_PHANO          ---------------------------------------------------KNAVARIFL
A7EDF0_SCLS1          ------------------------------------------------------LAPIHL
Q5KKJ1_CRYNJ          -----------------------------------------------------RVT---L
A0A0D1DZD7_USTMA      -----------------------------------------------------SVNKIFL
E3LA34_PUCGT          -----------------------------------------------------IAAKVSL
A8N8Y7_COPC7          -----------------------------------------------------GVAAVFL
PIF1_SCHPO            ---------------------------------------------------KKSVPSIFL
I1BKX4_RHIO9          -----------------------------------------------------------L
Q6CEU3_YARLI          ---------------------------------------------------LMTVQVASL
A8N288_COPC7          ---------------------------------------------------STPSGAIQL
D6RJX6_COPC7          ----------------------------------------------------QPSAAIVL
Q5KCW7_CRYNJ          ---------------------------------------------------PAVGGEPEL
PIF1_YEAST            -------------------------------------------------HNGVKVKIPIC
Q756Y6_ASHGO          -------------------------------------------------SASPKRVQCFM
W1QEW7_OGAPD          -------------------------------------------------QPEGKRVQAIT
PIF1_CANAL            SNPSDRSYH-----------------------------KLEKTEGINEAQSEAKNVKPII
G8BK92_CANPC          SE-------------------------------------------IPEAEQSRKVVQPII
RRM3_YEAST            -------------------------------------------------NHRSASSPVVL
Q756M1_ASHGO          ---------------------------------------------------PSVSSAVVL
W1QFA7_OGAPD          -----------------------------------------------------NSVSGSL
A0A1D8PRM6_CANAL      ------------------------------------------------------PQEICL
G8BBJ1_CANPC          ------------------------------------------------------TEGTQL
C4Y757_CLAL4          ------------------------------------------------------TSSVSL
PIF1_HUMAN            -------------------------------GAEPSTEAPRWPLPVKRLSLPST--KPQL
H2Q9L3_PANTR          -------------------------------GAEPSTEAPRWPLPVKRLSLPST--KPQL
G3S8K9_GORGO          -------------------------------GAEPSTEAPRWPLPVKRLSLPST--KPQL
A0A2J8T886_PONAB      -------------------------------GAEPSTEAPRWPLPVKRLSLPST--KPQL
A0A1D5Q3I2_MACMU      -------------------------------GTEPSTEAPRWPLPVKRLSLPST--KPQL
F7HI20_CALJA          -------------------------------GAEPSTEAPRWPLPVKRLSLPST--KPQL
F6UY05_CANLF          -------------------------------GAQPSTEAPRWPLPVKRLSLPPT--KPQL
PIF1_MOUSE            --------------------------------SQTSTEAPRWPLPVKKLRMPST--KPKL
PIF1_RAT              --------------------------------SQPSMEAPRWPLPVKKLRMPSS--KPKL
H0X2J4_OTOGA          -------------------------------GAERSTENRKWPLPVKKLSLPPT--KPQL
F7ET02_MONDO          -------------------------------GQTGKASSTKSTVPRHRLQLPSP--KPQL
F6R806_ORNAN          -------------------------------QETSTPEPLRSPRPRPRLQL---------
I3JWJ9_ORENI          -------------------TAAGTGQQVKRSRSDCNFSPVKA-NPSKKPILSLP--SRKL
G3PSK1_GASAC          -------------------TVAGTGQQVKRSRCDTNFSPSKG-NPSKKPILCLP--SRKL
H2LXB4_ORYLA          ---------------------AGGKQQVKRGRGDTSSSPEKT-NPNKKPTLTLP--SRRL
PIF1_DANRE            -------------------KVLGDRKQVKRPRPDCDASPVKALHPNKKPVLVLPV-AQKL
F6VQD1_XENTR          -------------------VNGVNRCQQKRTRTESSNSLIADLRPSKKPTLSMPK-QVQL
G1KND2_ANOCA          ---------------------QGRCAARKRARIESEDRNQVAETRQVKKPWSMCS-RVTL
W4Y048_STRPU          GKACIRLPKKCLQVMISNCPPHQLKSFLKSLALKMACKKTDKEAPRKKLHLNTLHKTPPL
A0A1X7UHE6_AMPQE      ---------------------KSLKRKLCELKVEPNSSKDPTAPPLAKKPLLLKTSCSSL
W5JD43_ANODA          GST-----------------------------NTGDRPRKKLYDPTSSAAVGSEAGELRL
Q7Q395_ANOGA          G--------------------------------TGDRPKPKKLLSENVDEAGS-GDAIQL
J9HF21_AEDAE          E----------------------------------QRPAPKKLYVPSPLTVAS-MEPETL
Q9VQR3_DROME          LKE---------------------------EKERGTMPAAKKLYAST------TDESLRL
Q29MC1_DROPS          LKDQ--------------------------DREKGTVPAAKKLYQSSP--LAGTDESLRL
A0A088ASR6_APIME      E-------------------------------------NENKLKPSTAKKLYENPTIEQV
H9JHA1_BOMMO          SRG----------------------------------PAPKKLYSPSP-----LTTTNSL
G5EFV7_CAEEL          ENRIMN-------------RSIGLKRTTSFARDDREKAETLVSLKSFK-DAPAISERIQL
A8WZ54_CAEBR          ENRILN-------------RSISLKRMTSFARCDKEQSEALTSLKPLK-DAPSITERIQL
A0A2H2I3F9_CAEJA      ENRILS-------------RSIGLKRMTSFARDDREK-TEFTSLKPIKEDNTTVLERIQL
Q54Z42_DICDI          ----------------------------------------------------LLELDELL
                                                                                  

A0A098E1Q1_GIBZE      SEEQKHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIIKDLKTKYAKDPE------------
Q7RXT1_NEUCR          SGEQLHVKSLVVEKGQSVFFTGPAGTGKSVLMRAIISELKKKFAREPE------------
PIF1_EMENI            S--QKHVLKAVVEKGQSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPD------------
Q4WVU7_ASPFU          SDEQRHVLDAVVNQGKSIFFTGSAGTGKSVLMREIIKQLRSKYRKEPD------------
A0A0D8JVN0_COCIM      SEEQNHVLDMIVKKGHSVFFTGSAGTGKSVLMREAIRGLRQKYKKEPD------------
C0NFA5_AJECG          SEEQKRVVEAIVKDGKSIFFTGSAGTGKSVLMREIIKKLREKYRKEPD------------
Q0UCQ7_PHANO          SEEQQNVLNLVTEYKKSVFFTGSAGTGKSVLLREIIAALRRKYVREPD------------
A7EDF0_SCLS1          TDEQTRVKSLVVDHGKSVFFTGSAGTGKSVLMRSIIAALKKKYVREGD------------
Q5KKJ1_CRYNJ          SEEQQKVLSLVVQQQKNVFFTGSAGTGKSVLLREIIHSLRNKYARNPD------------
A0A0D1DZD7_USTMA      SQEQRKVLHMVVEEGKNVFFTGSAGTGKSVLLREIIKELRRKHAKRPD------------
E3LA34_PUCGT          SPEQQSVLDLVLK-GESIFFTGSAGTGKSVLLRHIIAALKRSYSSRPD------------
A8N8Y7_COPC7          SQEQLHILKLVQE-GHSVFYTGSAGTGKSVLLREIIKVLNDKYKRGSG------------
PIF1_SCHPO            SDEQKRILDMVVEQQHSIFFTGSAGTGKSVLLRKIIEVLKSKYRKQSD------------
I1BKX4_RHIO9          SAEQQRVLDMVLKDKKSLFFTGSAGTGKSVLLRAIIDEMETIYGPM--------------
Q6CEU3_YARLI          SAEQQAIHDLVINGETNIFFTGAAGTGKSVLLRQIIASLRRKYKKSLD------------
A8N288_COPC7          SKDQRRILDEVKK-GRNVFFTGPAGTGKSVLLREIIAWARSHYGEK--------------
D6RJX6_COPC7          SPEQTQVLDRVKA-GQNVFFTGSAGTGKSVLLREIISFCGGSHSP---------------
Q5KCW7_CRYNJ          SSQQSEILAKIMN-GENFFFTGSAGTGKSVLLRAIIKAFKEKEGEREQREATRSFRSWQG
PIF1_YEAST            LSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRE-N------------
Q756Y6_ASHGO          LSDEQRNVLKLAEEGTNIFYTGSAGTGKSILLRELIKKLKTVHGRQGA------------
W1QEW7_OGAPD          LSEEQNQVIELARQGHNLFYTGSAGTGKSLLLRSLIKSLKKQHPLG-S------------
PIF1_CANAL            LSNEQEYVLKQVLSGVSLFYTGSAGTGKSVLLRSIIKSLRDKYPKG--------------
G8BK92_CANPC          LSKEQEIVLQKVLQGTSLFYTGSAGTGKSVLLRSIIKSLRRKYPTG--------------
RRM3_YEAST            TMEQERVVNLIVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKE-S------------
Q756M1_ASHGO          SKEQEAVRDIIVHDRLNVFYTGSAGTGKSVLLRELIRTLRAKYGTV-A------------
W1QFA7_OGAPD          SEEQRKVIEMVLYERKNIFYTGSAGTGKSFLLREIIKRLRNRYGSS-S------------
A0A1D8PRM6_CANAL      SPEQQMVVDTVVHAKESIFFTGSAGTGKSVVLKEMVKACKGVYG-D-N------------
G8BBJ1_CANPC          STEQKSVIDSVL-AGCNVFYTGSAGTGKSVVLRELVRILKSKYG-D-N------------
C4Y757_CLAL4          SVEQLAIIDAVVSRGENVFFTGSAGTGKSVVLREMVSRLYAKHGAS-H------------
PIF1_HUMAN            SEEQAAVLRAVLKGQ-SIFFTGSAGTGKSYLLKRILGSLP------PT------------
H2Q9L3_PANTR          SEEQAAVLRAVLKGQ-SIFFTGSAGTGKSYLLKRILGSLP------PT------------
G3S8K9_GORGO          SEEQAAVLRAVLKGQ-SIFFTGSAGTGKSYLLKRILGSLP------PT------------
A0A2J8T886_PONAB      SEEQAAVLRAVLKGQ-SIFFTGSAGTGKSYLLKRILGSLP------PT------------
A0A1D5Q3I2_MACMU      SEEQAAVLRAVLKGQ-SIFFTGSAGTGKSYLLKRVLGSLP------PT------------
F7HI20_CALJA          SEEQASVLRAVLKGQ-SIFFTGSAGTGKSYLLKRILGSLP------PT------------
F6UY05_CANLF          SEEQAAVLRVVLKGQ-SVFFTGSAGTGKSYLLKRILGSLP------PT------------
PIF1_MOUSE            SEEQAAVLRMVLKGQ-SIFFTGSAGTGKSYLLKHILGSLP------PT------------
PIF1_RAT              SEEQAAVLRMVLKGQ-SIFFTGSAGTGKSYLLKHILGSLP------PT------------
H0X2J4_OTOGA          SEEQAAVLRVILKGQ-SVFFTGSAGTGKSYLLKRILGSLP------PT------------
F7ET02_MONDO          SPEQARVLSAVLSGK-SIFFTGSAGTGKSYLLKRILGSLP------PK------------
F6R806_ORNAN          SREQEQVLSAVLRGK-SVFFTGSAGTGKSFLMKRILGSVP------PA------------
I3JWJ9_ORENI          NKEQAAVLSAVLSGK-NVFFTGSAGTGKSFLLKRIMGSLP------PK------------
G3PSK1_GASAC          SKEQAAVLTAVLSGR-NVFFTGSAGTGKSFLLKRIMGSLP------PK------------
H2LXB4_ORYLA          SKEQTAVLSAVLRGK-NVFFTGSAGTGKSFLLKRIMGSLP------PK------------
PIF1_DANRE            SKEQTAVLNAVLSGK-NVFFTGSAGTGKSFLLKRIVGSLP------PK------------
F6VQD1_XENTR          STEQSLVLNTVLSGR-NVFFTGSAGTGKSYLLKRIVGALP------PK------------
G1KND2_ANOCA          SQEQSMVLNAVLSGK-NVFFTGSAGTGKSYLLKRIIASLP------PN------------
W4Y048_STRPU          SNEQKRVLNAVLSRQ-SIFFTGSAGTGKSFLLRHIISALP------PD------------
A0A1X7UHE6_AMPQE      SEDQLQVINVIKNGD-SVFITGSAGTGKSYLLQRIIGMLP------PD------------
W5JD43_ANODA          NEEQKRVLQACQSGR-SIFFTGSAGTGKSFLLRKIIAALP------PD------------
Q7Q395_ANOGA          NEEQKRILSASQSGQ-SLFFTGSAGTGKSFLLRKIIAALP------PD------------
J9HF21_AEDAE          NAEQKMILDACVRGR-SVFFTGSAGTGKSFLLRKIISTLP------PD------------
Q9VQR3_DROME          SEEQMEVLRACTSGK-SVFFTGSAGTGKSFLLRRIISALP------PD------------
Q29MC1_DROPS          NEEQMEVLRACTTGK-NVFFTGSAGTGKSFLLRRIISALP------PD------------
A0A088ASR6_APIME      SEEQNRILDAVLRGK-NIFFTGSAGTGKSFLLRKIIAALP------PD------------
H9JHA1_BOMMO          NSEQQRVLEACLGGK-NIFFTGSAGTGKSFLLKRIVAALP------PD------------
G5EFV7_CAEEL          SDEQKSVVRCVINSRTSVFFTGSAGTGKSVILRRIIEMLP------AG------------
A8WZ54_CAEBR          TNEQKSVVRCVINSRVSVFFTGSAGTGKSVILRRIIEMLP------AG------------
A0A2H2I3F9_CAEJA      TEEQKNVVRSVINTKKSIFFTGSAGTGKSVILRRIIEMLP------AT------------
Q54Z42_DICDI          TSEQQKIVNLIVDGGKNVFFTGSAGTGKSFVLKHLVSKLRKKYPK---------------
                         :            ..* **.****** :::  :                        

A0A098E1Q1_GIBZE      ---------------RVAVTASTGLAACNIGGITLHSFSGIGLGKEDAPTLIKKIRR-NQ
Q7RXT1_NEUCR          ---------------RVAVTASTGLAACNIGGMTLHSFAGIGLGKEDIQTLVKKIRR-NQ
PIF1_EMENI            ---------------RIAVTASTGLAACNIEGVTLHSFAGIGLGKEPVPELVKKIKK-NQ
Q4WVU7_ASPFU          ---------------RVAVTASTGLAACNIEGVTLHSFAGIGLGKEPVPELVKKIKR-NQ
A0A0D8JVN0_COCIM      ---------------RVAVTASTGLAACNIEGVTLHSFAGVGLGKEDATGLLKKVKR-NQ
C0NFA5_AJECG          ---------------RIAVTASTGLAACNIEGVTLHSFAGIGLGKGPVADLVKKVKQ-NQ
Q0UCQ7_PHANO          ---------------RVAVTASTGLAACNVGGVTLHSFSGIGLGKEPAEDLIKKIRR-NA
A7EDF0_SCLS1          ---------------RVAVTASTGLAACNIGGVTLHSFGGIGLGKEDVPSLIRKIKK-NN
Q5KKJ1_CRYNJ          ---------------AVAVTASTGIAACNIGGVTLHSFGGVGLATDTPEILLRKLKM-NK
A0A0D1DZD7_USTMA      ---------------SVAVTASTGIAACNIGGVTIHSFAGIGLGKEAVTPLLNKVRK-QR
E3LA34_PUCGT          ---------------AVAITASTGMAACAIGGTTIHSFAGIGLALEPKDILLGKVKR-NR
A8N8Y7_COPC7          ---------------AVAITASTGIAACNIGGTTIHSFAGIGLGIEPAEQLATKIRRTNR
PIF1_SCHPO            ---------------RVAVTASTGLAACNIGGVTLHSFAGVGLARESVDLLVSKIKK-NK
I1BKX4_RHIO9          ----------------LAVTASTGIAATNINGCTLHSFGGIGIGEDKIETLVEKIKYENK
Q6CEU3_YARLI          ---------------KVAVTASTGLAACNVQGTTLHSFAGCGLAREDVDSLCKRIRR-NK
A8N288_COPC7          ---------------QVAVTASTGIAGLSIGGSTVHSFAGIGLGKESADKIASKILDSP-
D6RJX6_COPC7          ---------------EVAITASTGIASVNIGGTTLHSWAGIGIGNESAAKLVGKFWGQPK
Q5KCW7_CRYNJ          YRGAQKAEKEEVVKWSLAVTASTGMAGVNIGGTTIHSWAGIGLGVDNAEKLANKVRANA-
PIF1_YEAST            ----------------VAVTASTGLAACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRK
Q756Y6_ASHGO          ----------------VAVTASTGLAACNIGGITVHSFAGIGLGNSPKENLLKKVKRSRK
W1QEW7_OGAPD          ----------------VGVTASTGLAACNIGGQTLHSFTGIGLGDAPADKLVKKIKRNPK
PIF1_CANAL            ----------------VAVTASTGLAACNIGGITLHSFAGFGLGQGKVENLIKKIKRNKK
G8BK92_CANPC          ----------------VAVTASTGLAACNIGGITLHSFGAIGLGTGTVDNLIKKIKRNKK
RRM3_YEAST            ----------------IAITASTGLAAVTIGGSTLHKWSGIGIGNKTIDQLVKKIQSQKD
Q756M1_ASHGO          ----------------VAVTASTGLAAVNIGGMTVNRFSGIGIGSGSLEALAARAKKKRE
W1QFA7_OGAPD          ----------------IAVTASTGLAATNIEGTTINRFAGTGLGSEPVNKLVSRIKSRRS
A0A1D8PRM6_CANAL      ----------------FGVTASTGLAACNIQGQTVHRYLGIGFGRDPVDKLAAKVRKNVM
G8BBJ1_CANPC          ----------------MGVTAPTGMAACNIQGQTIFKFLEIGLAFKSAPDLANMIRKNHH
C4Y757_CLAL4          ----------------VGVTASTGLAACNIGGSTVHKFLHIGIGTGSPQEIAVKIKRNGS
PIF1_HUMAN            ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
H2Q9L3_PANTR          ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
G3S8K9_GORGO          ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAHCVALAQR
A0A2J8T886_PONAB      ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
A0A1D5Q3I2_MACMU      ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
F7HI20_CALJA          ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
F6UY05_CANLF          ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
PIF1_MOUSE            ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCMALANR
PIF1_RAT              ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAHR
H0X2J4_OTOGA          ---------------GTVATASTGVAACHIGGTTLHAFAGIGSGQAP---LAQCVALAQR
F7ET02_MONDO          ---------------GTVVTASTGVAACHIGGTTLHAFAGIGSGKAP---LAQCVALAQR
F6R806_ORNAN          ---------------GTVATASTGAAACLIGGTTLHGFAGIGSGQAP---LEQCVARARR
I3JWJ9_ORENI          ---------------STFATASTGVAACHIGGTTLHSFAGIGSGSAP---LEQCIELAQR
G3PSK1_GASAC          ---------------STFATASTGVAASHIGGTTLHNFAGIGSGSAP---LEQCIELAQR
H2LXB4_ORYLA          ---------------STFVTASTGVAACHIGGTTLHNFAGIGSGSAP---LEQCIELAQR
PIF1_DANRE            ---------------STYATASTGVAACHIGGTTLHSFAGIGSGSAP---LEQCIELAQR
F6VQD1_XENTR          ---------------STYATASTGVAACHIGGTTLHAFAGIGTGKAS---IEQCIELAKR
G1KND2_ANOCA          ---------------GTYATASTGVAACQIGGTTLHGFAGIGSGKAP---LSQCIELAQR
W4Y048_STRPU          ---------------STFATASTGVAACHIGGTTLHQFAGIGSGTGQ---LPQLIELASR
A0A1X7UHE6_AMPQE      ---------------TTYCTASTGAAACIIGGTTLHSFAGINTDAAP---LKQCVSMAMR
W5JD43_ANODA          ---------------GTIATASTGVAACLIGGTTLHSFAGIGSGEAT---LQNCYEKASR
Q7Q395_ANOGA          ---------------GTIATASTGVAACLIGGTTLHSFAGIGTGDAT---LQNCYEKASR
J9HF21_AEDAE          ---------------GTVATASTGVAACLIGGTTLHSFAGIGSGEAS---LSRCYEMATR
Q9VQR3_DROME          ---------------GTVATASTGVAACLIGGTTLHAFAGIGGGDAT---MQRCLELASR
Q29MC1_DROPS          ---------------GTIATASTGVAACLIGGTTLHAFAGIGGGDAT---MQRCLELASR
A0A088ASR6_APIME      ---------------VTIATASTGVAACHIGGITLHQFAGIGLGTAN---SERCFEMASR
H9JHA1_BOMMO          ---------------VTMPTASTGVAACHIGGTTLHAFAGIGDGSGS---IENLCERATK
G5EFV7_CAEEL          ---------------NTYITAATGVAASQIGGITLHAFCGFRYENST---PEQCLKQVLR
A8WZ54_CAEBR          ---------------STYITAATGVAASQIGGITLHAFCGFRYENAT---AEQCLQQVLR
A0A2H2I3F9_CAEJA      ---------------STYVTAATGVAASQIGGITLHGFCGFLPQSSS---AEQCVQQVLN
Q54Z42_DICDI          ---------------SVYVTAATGIAAVNIGGTTLHSFAGIKLGVAPAQRLAVEILQSKK
                                         **.** *.  : * *:  :                      

A0A098E1Q1_GIBZE      --KAKNRWLKTKCLVLDEISMVDGDLFDKLSQIGRTIRNNG-RPWGGIQLIITGDFFQLP
Q7RXT1_NEUCR          --KAKTRWLKTKVLIIDEISMVDGELFDKLSQIGRIIRNNG-RPWGGIQLVITGDFFQLP
PIF1_EMENI            --KARNRWLRTKVLVIDEVSMVDGDLFDKLEEIARLIRNNG-RPFGGIQLVVTGDFFQLP
Q4WVU7_ASPFU          --KARNRWLRTKVLIIDEVSMVDGDLFDKLEEIARRIRNNG-RPFGGIQLVVTGDFFQLP
A0A0D8JVN0_COCIM      --KARNRWLRTKVLIIDEISMVDGEFFDKLEELARKVRSNG-RPFGGIQLVVTGDFFQLP
C0NFA5_AJECG          --KNRTRWLRTKVLVIDEISMVDGDLFDKLEEIARKIRNNG-RPFGGIQLVVTGDFFQLP
Q0UCQ7_PHANO          --KAKQRWMRTKVLIMDEVSMVDGDLFDKLEQIARTIRNNG-RPFGGIQLVITGDFFQLP
A7EDF0_SCLS1          --KAKLRWTRTKVLVIDEISMVDGDLFDKLEEIARGMRNNG-RPFGGIQLVITGDFFQLP
Q5KKJ1_CRYNJ          --KASGRWTKTKVLIIDEVSMVDGAMFDKFCKLGQLIRKNS-KPWGGIQIIVTGDFFQLP
A0A0D1DZD7_USTMA      --KALGRWQRTQVLIIDEVSMVDPALLDKLEEIARLIRKKPDKPFGGIQLVITGDFFQLP
E3LA34_PUCGT          --KAAGKWMRTKVLIIDEISMVDGELFDKLAYIACKMKKSE-KPFGGIQVVIAGDFFQLP
A8N8Y7_COPC7          --KAFTRWTRTKVLIIDEISMVEGDLFDKLAKIGSILRGKP-EPFGGIQVIVTGDFFQLP
PIF1_SCHPO            --KCVNRWLRTRVLIIDEVSMVDAELMDKLEEVARVIRKDS-KPFGGIQLVLTGDFFQLP
I1BKX4_RHIO9          --KAHDRWTKTQVLIIDEISMVDAVLFDKLEAIARGLRNSQ-EPFGGIQVIVSGDFFQLP
Q6CEU3_YARLI          --KARDRWKNVSVLVIDEISMVDARFFDKLEQIAQKLRRNK-RPFGGIQLIVTGDFYQLP
A8N288_COPC7          -GNVKKRWRQTRVMVIDEISMLDGSLFDKLDEIARIVRATD-RPFGGIQLVLTGDFFQLP
D6RJX6_COPC7          FRPVLERWQRVRTLIIDEISMLDGSLFDTLEEVARRTRRND-LPFGGIQLVLCGDFCQLP
Q5KCW7_CRYNJ          --LSRKRWRTTAALVIDEISMIDAPLLDKLDHIGRIVRNDD-RPFGGIQLILTGDFFQLP
PIF1_YEAST            ---HLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNH-QPFGGIQLIFCGDFFQLP
Q756Y6_ASHGO          ---HVQRWQNCKCLIIDEISMIDGELLDKLDYIARKIKKSK-APFGGIQLILCGDFFQLP
W1QEW7_OGAPD          ---MKDRWRDLEVLIIDEVSMIDASLFDKLDMIAREMRKRRDVPFGGLQLVICGDFYQLP
PIF1_CANAL            ---AFTRWRETRVLIIDEISMVDGHLLNKLNEIAKNLRRNN-RPFGGIQLVACGDFYQLP
G8BK92_CANPC          ---AHGRWRDTKVLIIDEVSMVDGELLDKLNEIAKRLRKNN-APFGGIQLVACGDFYQLP
RRM3_YEAST            ---LLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KNDDPFGGIQLVLTGDFFQLP
Q756M1_ASHGO          ---VYERWKRTRVLIIDEVSMVDARFLDKLDYVARQLRGKPDAVFGGIQLVFTGDFFQLP
W1QFA7_OGAPD          ---IVERWKGTKVLIIDELSMIDSIFFDKLNEIAKQIR-GSNKPFGGIQLVLTGDFFQLP
A0A1D8PRM6_CANAL      ---LLRKWQQMRLLIIDEISMIDAGLFDKIEEVARIVR-NNEKPFGGIQIVACGDFYQLP
G8BBJ1_CANPC          ---KLSKWTRLRVLIIDEVSMIDGALFDKLENVARLVR-KSDKPFGGIQIVCTGDFYQLP
C4Y757_CLAL4          ---ARKKWTSLAVLIIDEISMIDGILFEKIDKIAQILR-NSTAPFGGIQLVCTGDFFQLP
PIF1_HUMAN            -PGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
H2Q9L3_PANTR          -PGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
G3S8K9_GORGO          -PGVQQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
A0A2J8T886_PONAB      -PGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
A0A1D5Q3I2_MACMU      -PGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
F7HI20_CALJA          -PGVRQSWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
F6UY05_CANLF          -PAVKQGWLNCQRLVIDEISMVEADLFDKLEAVARTVRQQN-KPFGGIQLIICGDFLQLP
PIF1_MOUSE            -PGVRQGWLNCQRLVIDEISMVEADFFDKLEAVARAVRQQK-KPFGGIQLIICGDFLQLP
PIF1_RAT              -PGVRQGWLNCQRLVIDEISMVEADFFDKLEAVARAVRQQK-KPFGGIQLIICGDFLQLP
H0X2J4_OTOGA          -PGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQN-KPFGGIQLIICGDFLQLP
F7ET02_MONDO          -PSIRQSWASCQRLVIDEVSMVEASLFDKLEAVARAIRQQD-KPFGGIQLIICGDFLQLP
F6R806_ORNAN          -PGVRRAWLSCQRLVIDEISMVEAALFDKLEAVARAVRQRE-EPFGGIQLIICGDFLQLP
I3JWJ9_ORENI          -PGVLQHWTSCRHLIIDEISMVEAQFFDKLEAVARSVRRST-EPFGGIQLIVCGDFLQLP
G3PSK1_GASAC          -PGVLQHWTSCRHLIIDEVSMVDAQFFDKLESVARSVRRST-EPFGGIQLIVCGDFLQLP
H2LXB4_ORYLA          -PSVLQHWTSCRHLIIDEISMVEAQFFDKLEAVARSVKRST-QPFGGIQLIVCGDFLQLP
PIF1_DANRE            -PGVLRHWTSCKHLIIDEISMVEAEFFDKLEAIARSIRRST-EPFGGIQLIVCGDFLQLP
F6VQD1_XENTR          -PGVRQHWTGCKHLIIDEISMVEGEFFDKLEAVARAVRGKD-EPFGGIQLIVCGDFLQLP
G1KND2_ANOCA          -PGVRQQWLNCRRLIIDEISMVEGDFFDKLEAVARDVRNCE-DPFGGIQLIICGDFLQLP
W4Y048_STRPU          -PTRRQQWRKCKHLIVDEISMIDGDFFTKLEAVARVIKRCD-EPFGGIQLILCGDFLQLP
A0A1X7UHE6_AMPQE      -EHKAVHWKRCKVLLIDEISMVDGEFFDKLEAVARAVRKSK-KPFGGIQLVLCGDFLQLP
W5JD43_ANODA          -ANTAQIWRKCKRLIIDEISMVEADYFEKIEAVARYIRKND-KPFGGIQLILCGDFFQLP
Q7Q395_ANOGA          -PNTAQAWRKCKRLIIDEISMIEADFFEKIEAVARYVRKND-KPFGGIQLILCGDFFQLP
J9HF21_AEDAE          -ANSGQIWRRCKRLIIDEISMVDGSYFEKIEAVARYVRKCD-KPFGGIQLILCGDFFQLP
Q9VQR3_DROME          -PANAQTWRKCKRLIIDEISMVDGQFFEKIEAVARHIRRND-RPFGGIQLILCGDFLQLP
Q29MC1_DROPS          -PVSAQTWRKCKRLIIDEISMVDGQFFEKIEAVARHIRRND-RPFGGIQLILCGDFLQLP
A0A088ASR6_APIME      -SSSATLWRKTKHLIIDEISMVDGDYFDKIEAVARHIRKNE-RPFGGIQLILCGDFFQLP
H9JHA1_BOMMO          IPLVAQKWRKCKHLIIDEISMVDGIFFEKLEAVARHIRKND-KPFGGIQLILCGDFLQLP
G5EFV7_CAEEL          QNHMVRQWKQCSHLIIDEISMIDRDFFEALEYVARTVRNND-KPFGGIQLIITGDFFQLP
A8WZ54_CAEBR          HTHMVKQWKQCAHLIIDEISMIDSEFFEILEYVARAVRNND-EPFGGIQLIITGDFFQLP
A0A2H2I3F9_CAEJA      QNQMVRQWKRCAHLIIDEISMVDSEFFEKLEYVARCVRNNS-LPFGGIQLIITGDFLQLP
Q54Z42_DICDI          ---LLQKWLDCSVLIIDEISMIDAELFEKLDTIGQMVRGNN-QPFGGIQLVLVGDFFQLP
                             *     :::**:**::   :  :  :.   :      :**:*::  *** ***

A0A098E1Q1_GIBZE      PVPDHGA-----------------------NKV--TKFAFDASTWTTSIDH--TIGLTQV
Q7RXT1_NEUCR          PVLDKDL-----------------------NKQRDVKFAFDAATWNMSIDH--TIGLTEV
PIF1_EMENI            PVPEG--------------------------HNREAKFSFAAASWNTSIQH--TILLTHV
Q4WVU7_ASPFU          PVPEG--------------------------SSREAKFAFAAATWNTSIQH--TILLTHV
A0A0D8JVN0_COCIM      PVAD---------------------------SSKEAKFAFDANTWNTCVQH--TILLTHV
C0NFA5_AJECG          PVPD---------------------------STKVAKFAFSASTWNTTIQH--TILLTHV
Q0UCQ7_PHANO          PVPE---------------------------YGKASKFAFDAGTWTTSIEH--TIGLTHV
A7EDF0_SCLS1          PVPDYN------------------------QKSRGVKFAFDAATWGTAIHH--TIGLTEV
Q5KKJ1_CRYNJ          PVTKN---------------------------GGMPKFAFEAEMWDETIHL--SVNLTKV
A0A0D1DZD7_USTMA      PVNP----------------------------GGSVTFAFDAQCWDRVVQH--KVNLTQV
E3LA34_PUCGT          PVSK----------------------------GK-VSFAFNASSWSECIPK--TINLTQV
A8N8Y7_COPC7          PVTK----------------------------SSSVKFAFEAETWSTTLKH--TFNLTKV
PIF1_SCHPO            PVPE---------------------------NGKESKFCFESQTWKSALDF--TIGLTHV
I1BKX4_RHIO9          PVNP---------------------------NG-PTKFAFEANSWKKVITQ--TVMLTQV
Q6CEU3_YARLI          PVPDTNKDRFRGSYGGNKTNTGMVDSRSAVNSDPEALFAFEAESWSTVIDS--TFLLTKV
A8N288_COPC7          PVPDKSH-----------------------NYEGKATFAFGAKQWPRCIGQ--PMFLRQV
D6RJX6_COPC7          PVSGR--------------------------NGPPAKFAFEADCWDTCVPT--MMHLTRV
Q5KCW7_CRYNJ          PVTKG----------------------------QIPQFAFEAKCWPKLFSHKNIKTLTRV
PIF1_YEAST            PVSKDP--------------------------NRPTKFAFESKAWKEGVKM--TIMLQKV
Q756Y6_ASHGO          PVTRD---------------------------NQQPNFAFDSEAWKQAITA--TIVLTRV
W1QEW7_OGAPD          PVTKN----------------------------GEPVFAFESQAWKQAIKY--TIVLKKV
PIF1_CANAL            PVVKKTAHDGTEL------------------DDVEVFFAFESSAWKETIQR--TITLKEI
G8BK92_CANPC          PVVKKISAEGDTR------------------DDVEAFFSFESLAWNETIEE--TIILKEI
RRM3_YEAST            PVAKKDE-------------------------HNVVKFCFESEMWKRCIQK--TILLTKV
Q756M1_ASHGO          PVTDRSAG------------------------NEGPLFCFESRAWQQGIQK--TLCLSQV
W1QFA7_OGAPD          PVSLSKM--------------------------GAAKFCFDAVSWKECIDE--TILLTKV
A0A1D8PRM6_CANAL      PVNKDGK----------------------------ARFCFEGKSWHKVIKK--SIVLKQV
G8BBJ1_CANPC          PVAVNRT----------------------------AQFCFQSKSWSKVINK--NIVLKQI
C4Y757_CLAL4          PVSKNQS----------------------------ARFCFLSDSWRKAIRN--TFILTTV
PIF1_HUMAN            PVTKG---------------------------SQPPRFCFQSKSWKRCVPV--TLELTKV
H2Q9L3_PANTR          PVTKG---------------------------SQPPRFCFQSKSWKRCVPV--TLELTKV
G3S8K9_GORGO          PVTKG---------------------------SQPPRFCFQSKSWKRCVPV--TLELTKV
A0A2J8T886_PONAB      PVTKD---------------------------SQPPRFCFQAKSWKRCVSV--TLELTKV
A0A1D5Q3I2_MACMU      PVTKG---------------------------FQPPRFCFQAKSWKRCVPV--TLELTKV
F7HI20_CALJA          PVTKG---------------------------SQPPRFCFQAKSWKRCVPV--TLELTKV
F6UY05_CANLF          PVTKG---------------------------SQPPKFCFQAKSWKRCVPV--TLELTEV
PIF1_MOUSE            PVTKG---------------------------SQQPQFCFQAKSWRRCVPV--ILELTEV
PIF1_RAT              PVTKG---------------------------SQHPRFCFQAKSWRKCVPV--TLELTEV
H0X2J4_OTOGA          PVTKG---------------------------SQPPKFCFQAKSWKRCVPV--TLELTQV
F7ET02_MONDO          PVTKN---------------------------NQPPQFCFQAKSWRKCIQL--TMELTEV
F6R806_ORNAN          PVSSGDR-------------------------TRRPQFCFQARSWSRCIQV--TMELTQV
I3JWJ9_ORENI          PVSKG---------------------------KEKASFCFQARSWHKVIQI--NMELTEV
G3PSK1_GASAC          PVSKG---------------------------KEKASFCFQARSWRKVIQV--NIELMEV
H2LXB4_ORYLA          PVSKG---------------------------KEKASFCFQARCWRKVIQV--NMELTEV
PIF1_DANRE            PVTKG---------------------------KEKANFCFQSRSWRKCIHM--NMELMEV
F6VQD1_XENTR          PVTQA---------------------------SSQTKFCFQARSWRKCIHL--TMELTEV
G1KND2_ANOCA          PVSKG---------------------------TEKPRFCFQAKSWRRCIHL--NMELTEV
W4Y048_STRPU          PVVKR---------------------------GEKQKFCFQSPAWHRCIQV--NFELMEV
A0A1X7UHE6_AMPQE      PVCKD---------------------------GKKRLFCFQAESWRKCVNR--TIELNDV
W5JD43_ANODA          PVGRQDRYGKQQALSQDNE----------TGAAGGVRFCFESPVWADCIQT--SYELTVV
Q7Q395_ANOGA          PVGRLPDRSRPGQYSQDAQQ---------DDESGRVRFCFESKAWRECIQA--SYELTIV
J9HF21_AEDAE          PVVKQDSFSR-NALTQDDN--------------SVMRFSFETKTWQECVQQ--SFELTVV
Q9VQR3_DROME          PVIKGDFGAAPTATP-------------------QQRFCFQSSAWETCIQC--VYELKQV
Q29MC1_DROPS          PVIRGDFGAAPNATP-------------------QQRFCFQSSAWETCIQC--VYELKQV
A0A088ASR6_APIME      PVSKKD---------------------------KKAKFCFQSNAWTKCIHF--NYELQTV
H9JHA1_BOMMO          PVVDKNK---------------------------QKRFCFQSHCWDKCIEL--CFELKQV
G5EFV7_CAEEL          PVSKD-----------------------------EPVFCFESEAWSRCIQK--TIVLKNV
A8WZ54_CAEBR          PVTKDN---------------------------KEPVFCFESEAWSRCVQL--TIVLKNV
A0A2H2I3F9_CAEJA      PVSKE-----------------------------EPVFCFESQAWYRCIQK--TIVLNNV
Q54Z42_DICDI          PVHGN--------------------------------YAFECKAWKKSIDI--SVELTTV
                      **                                   :.*    *   .       *  :

A0A098E1Q1_GIBZE      FRQR-DPVFANMLNEMRLGRITEDTVRAFKSLERPLQFNDG-LETSELFSTRNEVEYSNE
Q7RXT1_NEUCR          FRQR-DPEFAEMLNEMRLGRISDRTVKNFQQLSRPLAFDDG-LEVTELFPTRNEVENSNR
PIF1_EMENI            FRQR-DPEFADMLNEMRLGKLSPRTIQAFKELSRPLDFHDA-LEATELFPTRAEVDNANS
Q4WVU7_ASPFU          FRQK-DPEFAEMLNEMRLGKLTPRTIETFKSLSRPLNFHDA-LEATELFPTRQEVEQANS
A0A0D8JVN0_COCIM      FRQK-DPEFASMLNELRLGRVTQKTIDAFKQLSRPLNFEDD-LEATELFPTRHEVEGANS
C0NFA5_AJECG          FRQK-DPKFAGMLNEMRLGKLSPETIAAFKQLSRPLNFHDS-LEATELFPTRSEVENANS
Q0UCQ7_PHANO          FRQK-DPVFANMLNEMREGRLTPDSIARFRKLDRALPASDENIEATELFPTRQEVDRANN
A7EDF0_SCLS1          FRQK-DPVFANMLNEMRLGKVSQDTIKAFAGMKRAINYEDD-LTATELFPTRNEVENSNT
Q5KKJ1_CRYNJ          FRQK-DQRFVDMLNEMRFGRLSNESIIAFKSLARPLKFNDG-IEPTALFPRREDVDRANL
A0A0D1DZD7_USTMA      FRQK-DQSFVTMLNEMRFGKLSQKTIDAFRKLERVPKYDND-IMPTELFPMRNEVDRANA
E3LA34_PUCGT          FRQK-DSTFIDMLNEMRMGELTRDSIQRFYKLSRELNFGDG-IEPTELYPTRNEVERSNA
A8N8Y7_COPC7          FRQR-DQTFVDMLNEMRFGTLSQKSIAKFYQLARPLHFEDG-VESTELFPIRDQVDASNH
PIF1_SCHPO            FRQK-DEEFVKMLNELRLGKLSDESVRKFKVLNRTIEYEDG-LLPTELFPTRYEVERSND
I1BKX4_RHIO9          FRQK-DGTFVNILNEMRLGRLSQSAIDIFKSLARKPAGSNE-IEPTELYPLRREVELSNK
Q6CEU3_YARLI          FRQK-DPVFANMLNQLRTQSLDQASLDGFLSLSRPLSVPDG-IIPTELFPTRREVDRSNF
A8N288_COPC7          FRQT-DNTFIDLLSSIRLGKLENRHIEILNSLQRPIHYTDG-IGPTHLYPRKVEVEGFNN
D6RJX6_COPC7          FRQK-DQAFVDMLNEMRLGNMKPATIQAFRSLSRKVTYKDG-IEPTELYSTRREVDQANK
Q5KCW7_CRYNJ          FRQR-DDRFINMLEAMRRGTITPDDTVLLQSLNRPIEYPDN-IEPVALYPQKRDVEFVNS
PIF1_YEAST            FRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLPDDE--IIPAELYSTRMEVERANN
Q756Y6_ASHGO          YRQQGDTKFIQMLNDMRLGKISEETEAEFRKLSRPLVTDD--IIPAQLFSTRVEVERANG
W1QEW7_OGAPD          FRQQSDRDFINMLNEVRNGNVSEATARKFRALSRPLASKEG-VIPAKLFPTRREVDRANS
PIF1_CANAL            FRQKGDQRFINMLNNLRDGNVPDDTARDFCRLSRPLKCPEG-IVPSELYATRYEVDMANS
G8BK92_CANPC          FRQKGDQVFINMLNEMRDGRISEKTVQEFRRLSRPLECPAG-ISPAELFATRNEVERANN
RRM3_YEAST            FRQQ-DNKLIDILNAIRYGELTVDIAKTIRNLNRDIDYADG-IAPTELYATRREVELSNV
Q756M1_ASHGO          FRQQ-DTELVDLLNAIRFGEVTPQVAAQMRQFEREVVYGDG-IEPTELFPTRREVEQANR
W1QFA7_OGAPD          FRQQNDSDLIEMLNALRIGKLSDDLKRKFKRLERPLQYNDG-IYPTELYPTREEVDRANL
A0A1D8PRM6_CANAL      FRQKGDTEFIDMLNALRLGNLNAAVLEKFATLQREIHYEDK-LEPTELFPTLNEVRQANS
G8BBJ1_CANPC          FRQKGDHDLIEMLNALRTGELGDAIVAKFKDLSRTVHYDDG-IEPTQLFPTRKEVHSANS
C4Y757_CLAL4          FRQKGDSELIEMLNSLRKGKLDDAMVAKFRQLGRKVVYDDN-IEPTELYPTRQEVKAANQ
PIF1_HUMAN            WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDG-IVATRLCTHQDDVALTNE
H2Q9L3_PANTR          WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDG-IVATRLCTHQDDVALTNE
G3S8K9_GORGO          WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDG-IVATRLCTHQDDVALTNE
A0A2J8T886_PONAB      WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDG-IVATRLCTHQDDVALTNE
A0A1D5Q3I2_MACMU      WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDG-IVATRLCTHQDDVALTNE
F7HI20_CALJA          WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATAAHKVGRDG-IVATRLCTHQDDVALTNQ
F6UY05_CANLF          WRQA-DQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDG-IVATRLCTHQDDVALTNE
PIF1_MOUSE            WRQA-DQTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDG-IVATRLCTHQDDVALTNE
PIF1_RAT              WRQA-DQTFISLLKAVRLGRCSDEVTRQLRATAAHKVGRDG-IIATRLCTHQDDVALTNE
H0X2J4_OTOGA          WRQA-DQTFISLLQAVRLGRCTDEVTHQLQATATNKVGRDG-IVATRLCTHQDDVALTNK
F7ET02_MONDO          WRQT-DPTFISLLQAVRLGRCSDEVTQKLKATARHKVERDG-ILATRLCTHQDDVALTNE
F6R806_ORNAN          RRQS-DPAFISLLRNVRLGRCPEEVTRQLRATAGHKLERDG-VVATRLCTHQDDVETTNW
I3JWJ9_ORENI          RRQT-DQSFISLLQAVRVGRVTEEVTAKLMKSAYHQIERDG-ILATRLCTHKDDVDLTNE
G3PSK1_GASAC          RRQT-DQSFISLLQAVRVGRVTEDVTTKLMDSAYHLIERDG-ILATRLCTHKDDVDLTNE
H2LXB4_ORYLA          RRQT-DQNFISLLQAVRLGRVTEEISMKLMTSSYHRIERDG-VLATRLCTHKDDVELTNE
PIF1_DANRE            RRQT-DKTFISLLQAVRVGRVTEEVTAQLLKSANHCIERDG-ILATRLCTHKDDVELTNE
F6VQD1_XENTR          RRQT-DKNFISLLQAIRLGRCTDDVSRKLLQTSSHKVERDG-ILATRLCTHKDDVEITNE
G1KND2_ANOCA          RRQT-DREFISLLNMVRLGRCTEEVTRQLTLTATHKVERDG-ILATQLCTHKEDVELTNA
W4Y048_STRPU          KRQK-DPAFINILQKIRVGRCSAEVTDCLTGTAKHCVDTEG-IHATRLCTHKEDVDQLNN
A0A1X7UHE6_AMPQE      YRQK-DREFIAILQNIRIGRCPPAITKLLKNTENQLIEKGG-IRATKLYTHTNEVESTNQ
W5JD43_ANODA          HRQK-DQEFVSILNSIRIGRVTTEISERLRKTAGQRIETEG-ILATQLCSHTAEVDAINQ
Q7Q395_ANOGA          HRQR-DQEFISILNSIRIGRVTDEISERLRKTASQRIETEG-ILATQLCSHTSEVDAINQ
J9HF21_AEDAE          HRQK-DSNFVSILNSIRIGRVTPQIRDTLTATSKQRIEMEG-ILATQLCSHTNDADLINQ
Q9VQR3_DROME          HRQS-DPEFVKILNHLRIGHVNDSITSRLAATSKQKIEGNG-ILATQLCSHTNDANSINE
Q29MC1_DROPS          HRQS-DPEFVKILNHLRIGHVNESITTRLAATSRQKIEGNG-ILATQLCSHTNDANSINE
A0A088ASR6_APIME      YRQK-DPEFIKILNNIRIGRVTDDIAKTLKATAKQKIENNG-ILATRLCSHVNEVEEINE
H9JHA1_BOMMO          HRQT-DQEFISILNSIRIGRVTKEISDRLTRTARQKIEADG-ILATRLCSHTNDSKMINE
G5EFV7_CAEEL          KRQN-DNVFVKILNNVRVGKCDFKSADILKESSKNQFPSS--VIPTKLCTHSDDADRINS
A8WZ54_CAEBR          KRQN-DMEFVEILNSVRIGKCDQLSADRLQASSQNEFPAH--VIPTKLCTHSEDAERINQ
A0A2H2I3F9_CAEJA      KRQD-DDVFVKILNKVRVGICDFKSADLLKQSAKHQFPPN--VIPTRLCTHSDDAERINR
Q54Z42_DICDI          MRQK-ETEFIDILNKIRVGDIKEDMINRLVSTCNKPLDISNGILPTRLYSTNASVDQENQ
                       **  :  :  :*  :*           :             :    * .   .    * 

A0A098E1Q1_GIBZE      RRLRDLPGKPRRYDAQDTG----------KEEVRDKLLANMMAPKSIVLKVNAQVMLIKN
Q7RXT1_NEUCR          QRLAALKGKIYRYEAYDTG----------EPAVREKLLANMMAPPVIELKKDAQVMLIKN
PIF1_EMENI            ARMARLSGETMTFNAVDSGTI-------QDIQFREKLLSNCMAPQTIHLKKGSQVMLIKN
Q4WVU7_ASPFU          ARMSRLSGETMTFHAVDSGTI-------QDVQFREKLLANCMAPPVIHLKKGAQVMLIKN
A0A0D8JVN0_COCIM      TRMGRLSGEVIPFTAVDSGAI-------QDKSMRDKMLANCMAPPLIHLKKGAQVMLIKN
C0NFA5_AJECG          ARMARLSGETMVFTAVDGGTM-------QNEAQRSQLLADCVAPT-IQLKKGAQVMLIKN
Q0UCQ7_PHANO          LRMQQLHGTVFSFEARDGGTI-------TNKEQRDRLLQSCMVPEVVHLKKGAQVMLVKN
A7EDF0_SCLS1          FRLRSLHGKSYRYDAADSGSI-------TDEGMREKLLSNMMAPKSIELKKGAQVMLIKN
Q5KKJ1_CRYNJ          SRLNQLDSVGFTYHSIDGGS--------AEANQREKLLSNFMAPKIIELKENAQVMLVKN
A0A0D1DZD7_USTMA      SRLMALQAEGQTYRAQDGGT--------LTGEARDRILSHSIAVPVLSLKKGAQVMLIKN
E3LA34_PUCGT          TRLAALKTEARVYAAIDSGKA-------PP-EQRARDLANMMAVPSLTLKKDAQVMMIKN
A8N8Y7_COPC7          TRMSRLQTEEEVYRAHDSGTM-------PMGSSRTKLLASFMVPGEMRLRIGAQVMLVKN
PIF1_SCHPO            MRMQQINQNPVTFTAIDSGTV-------RDKEFRDRLLQGCMAPATLVLKVNAQVMLIKN
I1BKX4_RHIO9          LRLDALGGDVIEFKAVDKGDQ-------RK-------VSQCMAPDVIQLKLHAQVMLLKN
Q6CEU3_YARLI          SKLSTLGGKTHTFDALETGS--------AEREFRDKLLENIMVPKKLTLKAGAQVMMLKN
A8N288_COPC7          RKLTELPGPEFQYESTDSGGYDPFGNVVP-GDSVRTLLERMIALSSVTLKIGAQVMLIQN
D6RJX6_COPC7          SRLNQLQGEARTYAAQDIPGRDADGRITS-PAKMEQLLDRLLAPKSITLKVGAQVMLVKN
Q5KCW7_CRYNJ          ARLDALPGAVTLYDCHDEPGFTAGGFPISRTEATIKLNKNTIWPQHLSLKEGAQVMLVTN
PIF1_YEAST            SRLSKLPGQVHIFNAIDG-GA------LEDEELKERLLQNFLAPKELHLKVGAQVMMVKN
Q756Y6_ASHGO          SQLAKLPGKRRAYNAIDG-GD------LSDEELKQRLLANFLAPKRLELKVGAQVMNIKN
W1QEW7_OGAPD          TMLKQLPGAEVVFRAFDG-GS------LTDEDQRQRLLSSFLAPERIALKKDAQVMLIKN
PIF1_CANAL            RKLNTIQGDVVVYNSVDT-GI------LP-EPQKTQVLTNFLAPQVLNLKVGAQVMCIKN
G8BK92_CANPC          RRLNALPGETVSYHAIDS-GS------LQ-EPQKSALLSNFLAPQDLLLKKDAQVMCVKN
RRM3_YEAST            KKLQSLPGDLYEFKAVD--NA------PERYQAILDSS--LMVEKVVALKEDAQVMMLKN
Q756M1_ASHGO          RRLERLPGFGMTFEAYDSGNV------GGRFSSYFDA---VMAERTLALKEGAQVMMLKN
W1QFA7_OGAPD          ERLNSLPGRVYTFQSRDNFPP------NGNPAMFIKQLDGLMCAKTLQLKEGAQIMYLKN
A0A1D8PRM6_CANAL      SRLARLPGKERVFVATD----------RGDPRQ-HKMLDNLMCEKVLRLKEGAQVMNIVN
G8BBJ1_CANPC          DRLKKLSSKAYEFMAKD----------SHKGEHVKKQYDQLLCEETLVLKEGAQVMNIKN
C4Y757_CLAL4          QRLRFLPGQSNIYKAQD----------SEKDQFKRKLYDNLMCEEILELKKGAQVMYLKN
PIF1_HUMAN            RRLQELPGKVHRFEAMDSNPELA-----------STLDAQCPVSQLLQLKLGAQVMLVKN
H2Q9L3_PANTR          RRLQELPGKVHRFEAMDSNPELA-----------STLDAQCPVSQLLQLKLGAQVMLVKN
G3S8K9_GORGO          RRLQELPGKVHRFEAMDSNPELA-----------STLDAQCPVSQLLQLKLGAQVMLVKN
A0A2J8T886_PONAB      RRLQELPGKVHRFEAMDSNPELA-----------STLDAQCPVSQLLQLKLGAQVMLVKN
A0A1D5Q3I2_MACMU      RRLQELPGKVHRFEAIDSNPELA-----------SILDAQCPVSQLLQLKLGAQVMLVKN
F7HI20_CALJA          RRLQELPGKVHRFEATDSNPELA-----------STLDAQCPVNQLLQLKLGAQVMLVKN
F6UY05_CANLF          KRLQELPGEVHSFKAMDSDPKQA-----------RTLDAQCPVSQILQLKLGAQVMLVKN
PIF1_MOUSE            KWLKALPGDVHSFEAIDSDPELS-----------RTLDAQCPVSRVLQLKLGAQVMLVKN
PIF1_RAT              KRLKELPGDVHSFEAIDSDPELS-----------RTLDAQCPVGRVLQLKLGAQVMLVKN
H0X2J4_OTOGA          RRLQELPGEQGAGLGKTRQEGPS-----------SRRGSPGPQYHLDYLAIGAEPSAWER
F7ET02_MONDO          RRLQQLPGQVHSYEAVDSDPTMV-----------RTLDSQCPVSHLLQLKLGAQVMLVKN
F6R806_ORNAN          RRLQELPGAVRCYEAVDSDPEQA-----------GTINRQCPVGQQLQLKLGAQVILVKN
I3JWJ9_ORENI          NKLQQLPGSARLFEALDSDPVLV-----------KTIDAHSPVGRLIQLKVGAQVMLTKN
G3PSK1_GASAC          NKLQQLPGSARVFEALDSDPALV-----------KTIDAHSPVSRLIQLKVGAQVMLTKN
H2LXB4_ORYLA          DKLQQLPGSVRLFEAVDSDPELV-----------KNIDAHSPVSRLIQLKVGAQVMLTKN
PIF1_DANRE            NKLKQLPGVVRMYEAVDSDPMLV-----------QTIDAQSPVSRLLQLKVGAQVMLTKN
F6VQD1_XENTR          RRLQQLPGESHLYEALDSDPMLV-----------KTINAQCPVNQQIQLKKGAQVMLAKN
G1KND2_ANOCA          RQLQELPGEQRSFKAVDSDPTSV-----------KIIDAQCPVNSVIELKQGAQVMLTKN
W4Y048_STRPU          VHLNKLIGDVRVFEAMDSDPSLV-----------KQTNSQCPVRQRIDLKIGAQVMLAKN
A0A1X7UHE6_AMPQE      TELNALAGEGRRFDATDNQPNCM-----------QQLNALCLVPHTLVLKIGAQVMLAKN
W5JD43_ANODA          AKLDGLTTEAKTFEAKDSDPYSS-----------KQLDQMVQAPGRLTLKVGAQVMLLKN
Q7Q395_ANOGA          AKLEALRTEAKLFEAKDSDPYSV-----------KQLDMMLQAPAKLTLKIGAQVMLLKN
J9HF21_AEDAE          SKLNNLSGEEKTYHAIDSDAYMT-----------KQLDQQVQAPGKLVLKLGAQVMLLKN
Q9VQR3_DROME          SKLENLDGDKILFKADDSDASMT-----------RTLDQQIQAPSQLYLKVNAQVMLLKN
Q29MC1_DROPS          SKLENLQGDKVLFRSDDSDAGMT-----------KQLDQQIQAPSQLYLKVNAQVMLLKN
A0A088ASR6_APIME      FQLNELKGESKTYIAQDSDQSMT-----------KILNQQLTVPDKLILKIGAQVMLLKN
H9JHA1_BOMMO          SKLIALDGEGKLFTSQDSD-NAT-----------TLLDMQTIAPSKLMLKIGAQVMLLKN
G5EFV7_CAEEL          SSIETTQGDAKTFHAYDDESFDT-----------H-AKARTLAQKKLVLKVGAQVMLIKN
A8WZ54_CAEBR          TSLQNSEGVQKTFHAYDDSEFN------------D-AKCRTMAVKTLILKEGSQVMLIKN
A0A2H2I3F9_CAEJA      RNLLNTKGDEKTFHAHDDDNFD--------------SSFRTLAVKKLTLKVGSQVMLIKN
Q54Z42_DICDI          SSLDKLLGEPFSFQAVDSGNK----------ELIELLDRDCPAMKNLTLKVGAQVVLLRK
                        :                                             *   ::     .

A0A098E1Q1_GIBZE      LD-----ESLVNGSLGKVIGFSDEKTFDMSPPD-------EYDED---------------
Q7RXT1_NEUCR          MD-----ETLVNGSLGTVVGFMNEATFELKAGS-------DFDDDE--------------
PIF1_EMENI            ME-----DTLVNGSIGRVVAFMDEATFDFYVEN-----ENDFASGKF-------------
Q4WVU7_ASPFU          ME-----DSLVNGSIGRVVAFMDEATFEYYRDN-----ESEFADGRD-------------
A0A0D8JVN0_COCIM      MD-----DSLVNGSLGKVVAFMDDSTYDHYVRN-----EDSYHSGH--------------
C0NFA5_AJECG          MD-----ESLVNGSLGKVVAFMDEARFDYYTKN-----DEDFAG----------------
Q0UCQ7_PHANO          MD-----DTLVNGSLGKVTGFMTEQMFVLYKED-----EEAFLEG---------------
A7EDF0_SCLS1          MD-----DGLVNGSLGKVVAFMSEKSFEIYDSNPDILNEKEFSDAEE-------------
Q5KKJ1_CRYNJ          LD-----ETLVNGSMGKVIGFTYKNMFQCDDLGK---WTPDADLKD--------------
A0A0D1DZD7_USTMA      LD-----ETLVNGSVGKVIDF-----MDDADYDK---QTGALEAGE--------------
E3LA34_PUCGT          HAGEDGPAWLVNGLVGKVVDFVDPDITPDYLLHQQRTREEAEAVDLS-------------
A8N8Y7_COPC7          YD-----EILVNGTLGKVVDFVDPD---------KLGDELASYTILG-------------
PIF1_SCHPO            ID-----DQLVNGSLGKVIGFIDDETYQMEKKDAEMQGRNAFEYDSL-------------
I1BKX4_RHIO9          FD-----IDLVNGSLGVVIGFVGRGNYRSEK-----------------------------
Q6CEU3_YARLI          MD-----PNLVNGSIGVVVGFMSPHNFIAAENAADLDIIREKPSKRP-------------
A8N288_COPC7          VIQ----GKLVNGSTGKVVEFLTIHEALQRDIAIAELNEKPRRRHPG-------------
D6RJX6_COPC7          IQQ----GRLVNGSVGTVIKFMSVDEAAKEHVTIAEA-ERPSDNEKT-------------
Q5KCW7_CRYNJ          MGD----GVLVNGSTGTVVDFLTIPDAIKRGIHLPEA-----------------------
PIF1_YEAST            LD-----ATLVNGSLGKVIEFMDPETYFCYEALTNDPSMPPEKLETWAENPSK---LKAA
Q756Y6_ASHGO          FD-----DTLVNGSLGKVIDFIDEATFMFYQSVRDD-DLDVAEWEKYRDALAKNDWNAPE
W1QEW7_OGAPD          MD-----ETLVNGSLGKIVDFIDPDTYSHYRSIKSD-KIDVKTLEEKAANSLN----KGP
PIF1_CANAL            FD-----DQLVNGTLGKVIDFVDRDTYMKSESKENPSTETSDEVSGLNDYIFNDF-----
G8BK92_CANPC          FD-----ETLVNGSLGTVVDFVDKDTYMKAFK----DGDHVDEEGNLKDFIFND------
RRM3_YEAST            KP----DVELVNGSLGKVLFFVTESL--VVKMKEIYKIVDD-------------------
Q756M1_ASHGO          K-----DDQLVNGSVGRVLFFTTAALWGRVEREHMHALEDP-------------------
W1QFA7_OGAPD          DLE---DPQLVNGSIGKIVCFCSIALW-TLFTNTFKEYERP-------------------
A0A1D8PRM6_CANAL      YS----EDIV-NGSLGVVLFFATRELYYKFIQHYGPINAND-------------------
G8BBJ1_CANPC          IN----DHLV-NGTLGTVMFFTTLKLYLKILDIYGAIEAMD-------------------
C4Y757_CLAL4          HP----DNLVVNGSIGTVVGFITENLFKTLFDVLGEQTFCNMS-----------------
PIF1_HUMAN            LSV---SRGLVNGARGVVVGFEAEG-----------------------------------
H2Q9L3_PANTR          LSV---SRGLVNGARGVVVGFEAEG-----------------------------------
G3S8K9_GORGO          LSV---SRCLVNGARGVVVGFEAEG-----------------------------------
A0A2J8T886_PONAB      LSV---SRGLVNGARGVVVGFEAEG-----------------------------------
A0A1D5Q3I2_MACMU      LSV---SRGLVNGARGVVVGFEAEG-----------------------------------
F7HI20_CALJA          LSV---SRGLVNGARGVVVGFEAEG-----------------------------------
F6UY05_CANLF          LAV---SRGLVNGARGVVVGFETEG-----------------------------------
PIF1_MOUSE            LAV---SRGLVNGARGVVVGFESEG-----------------------------------
PIF1_RAT              LAV---SRGLVNGARGVVVGFESEG-----------------------------------
H0X2J4_OTOGA          PKG---PCSLPLSPAGLTVGLLTSS-----------------------------------
F7ET02_MONDO          LAV---SQGLVNGARGVVVGFEADG-----------------------------------
F6R806_ORNAN          LAV---TRGLVNGARGVVVGFEAGE-----------------------------------
I3JWJ9_ORENI          LDV---ARGLVNGARGVVVGFESGK-----------------------------------
G3PSK1_GASAC          LDV---ARGLVNGARGVVLAFESGK-----------------------------------
H2LXB4_ORYLA          LDV---ARGLVNGARGVVEAFESEK-----------------------------------
PIF1_DANRE            LDV---QRGLVNGARGVVVDFQPGN-----------------------------------
F6VQD1_XENTR          LDV---SRGLVNGARGVVTKFEEGN-----------------------------------
G1KND2_ANOCA          LDV---SRGLVNGARGVVTGFETDG-----------------------------------
W4Y048_STRPU          LDV---HKGLVNGARGVVTGFESGM-----------------------------------
A0A1X7UHE6_AMPQE      IDV---SRSLVNGARGIVTSFTD-------------------------------------
W5JD43_ANODA          YNI---AEGLVNGARGVVMDFVQ-------------------------------------
Q7Q395_ANOGA          YNI---SEGLVNGARGVIVNFVQ-------------------------------------
J9HF21_AEDAE          LNI---AEGLVNGARGVVTNFVQ-------------------------------------
Q9VQR3_DROME          INI---SNGLVNGARGVVVRMEK-------------------------------------
Q29MC1_DROPS          INI---SNGLVNGARGVVVRMEK-------------------------------------
A0A088ASR6_APIME      INV---SNGLVNGARGVVIKFAD-------------------------------------
H9JHA1_BOMMO          INV---NSGLVNGARGIVVRFEE-------------------------------------
G5EFV7_CAEEL          IDV---IKGLCNGSRGFVEKFSENG-----------------------------------
A8WZ54_CAEBR          LDV---FKGLCNGSRGFVEKFGENG-----------------------------------
A0A2H2I3F9_CAEJA      IDV---NKGLCNGSRGYVEKFSDNG-----------------------------------
Q54Z42_DICDI          IEK---GDGLVNGSRGVVVDFVKARVSRKNNK----------------------------
                               :  .  *    :                                       

A0A098E1Q1_GIBZE      ---------------------DQSAKARKKLLKSFQHES--ESSASDK------------
Q7RXT1_NEUCR          ---------------------DLDKKRRIKAFTSALSNAAIEKGDNTE------------
PIF1_EMENI            ----------------DEGDEDRAARARKKIKG--MGHRDGGVTVTRK------------
Q4WVU7_ASPFU          ----------------AGSDDERLNHARKKLKG--LGNKDGGVVASRK------------
A0A0D8JVN0_COCIM      ----------------EYNRDDESSRARKKIKSMAYDPKGLGVTTAKL------------
C0NFA5_AJECG          ----------------DPSHDDRKSQAINKVRS--YENKIGTVSTNGK------------
Q0UCQ7_PHANO          ---------------------GASEQAMKNEMA----KSTLGLNTAQV------------
A7EDF0_SCLS1          ----------------EHNRQSDLARFKQTNKE---LPITGISNNGRL------------
Q5KKJ1_CRYNJ          ---------------------LEEEDKMKSLAVRQALRDKYQAKGANP------------
A0A0D1DZD7_USTMA      ---------------------QQRED-----------RDKAPRISTRK------------
E3LA34_PUCGT          ----------------GIFSDDDSDLEIKPRPISSKPSAFPPLRGAAKI-----------
A8N8Y7_COPC7          ----------------GTSTSPTGTLTVKK------------MLGAKR------------
PIF1_SCHPO            ----------------DISPFDLPDVKQKKYKLIAMRKASSTAIK---------------
I1BKX4_RHIO9          ------------------SVQFLRTPQRQKETYLEAGGRIDMKTP---------------
Q6CEU3_YARLI          ----------------NIYDVSNESELNQLNQLIETGKVVGESSQASEESAFFSSPAQGD
A8N288_COPC7          ----------------KDAKKKEDRSKDEILEDLTRQIQGTAHDYELRR-----------
D6RJX6_COPC7          ----------------KAGTR-ESPINVDDFESGEDEEDDIVIVSESAN-----------
Q5KCW7_CRYNJ          -----------------------------------------AIKGQTSM-----------
PIF1_YEAST            MEREQSDGEESAVASRKSSVKEGFAKSDIGEPVSPLDSSVFDFMKRVK------------
Q756Y6_ASHGO          LDEDEEPKKETRTSMVKKALREKFRTIDTDDTVDHLGDTIFDFLKDDRE-----------
W1QEW7_OGAPD          SKRD-----------------EKHLIEDSTVLESQLDENVFSFLKELKEEQPE-------
PIF1_CANAL            --------------------QKPKKVVKEDAPIAEQVLFTGQLSQKVE------------
G8BK92_CANPC          -------------------------------PDTSIGLTTATLTQKVM------------
RRM3_YEAST            -----------------------EVVMDMRLVSRVIGNPLLKESKEFRQ-----------
Q756M1_ASHGO          -----------------------EFVLDMRLVCQAIGISESARSPELLQ-----------
W1QFA7_OGAPD          -----------------------MHTDLLVMASRFTGNEPTAQDEALYN-----------
A0A1D8PRM6_CANAL      ----------------------EDAIKEMRFICHRIDESE--YTAEEKE-----------
G8BBJ1_CANPC          ----------------------SQMLKEVKFITSRIGSVKS-WTDDDRL-----------
C4Y757_CLAL4          ----------------------EEYQQLLTLLCDLIGNRS--MTSDQTR-----------
PIF1_HUMAN            ------------------------------------------------------------
H2Q9L3_PANTR          ------------------------------------------------------------
G3S8K9_GORGO          ------------------------------------------------------------
A0A2J8T886_PONAB      ------------------------------------------------------------
A0A1D5Q3I2_MACMU      ------------------------------------------------------------
F7HI20_CALJA          ------------------------------------------------------------
F6UY05_CANLF          ------------------------------------------------------------
PIF1_MOUSE            ------------------------------------------------------------
PIF1_RAT              ------------------------------------------------------------
H0X2J4_OTOGA          ------------------------------------------------------------
F7ET02_MONDO          ------------------------------------------------------------
F6R806_ORNAN          ------------------------------------------------------------
I3JWJ9_ORENI          ------------------------------------------------------------
G3PSK1_GASAC          ------------------------------------------------------------
H2LXB4_ORYLA          ------------------------------------------------------------
PIF1_DANRE            ------------------------------------------------------------
F6VQD1_XENTR          ------------------------------------------------------------
G1KND2_ANOCA          ------------------------------------------------------------
W4Y048_STRPU          ------------------------------------------------------------
A0A1X7UHE6_AMPQE      ------------------------------------------------------------
W5JD43_ANODA          ------------------------------------------------------------
Q7Q395_ANOGA          ------------------------------------------------------------
J9HF21_AEDAE          ------------------------------------------------------------
Q9VQR3_DROME          ------------------------------------------------------------
Q29MC1_DROPS          ------------------------------------------------------------
A0A088ASR6_APIME      ------------------------------------------------------------
H9JHA1_BOMMO          ------------------------------------------------------------
G5EFV7_CAEEL          ------------------------------------------------------------
A8WZ54_CAEBR          ------------------------------------------------------------
A0A2H2I3F9_CAEJA      ------------------------------------------------------------
Q54Z42_DICDI          ------------------------------------------------------------
                                                                                  

A0A098E1Q1_GIBZE      ----------------------------------------------YPVVQFMAGD-GTS
Q7RXT1_NEUCR          ----------------------------------------------YPLVRFHAVD-GTR
PIF1_EMENI            ----------------------------------------------WPLVCFIQPD-GTE
Q4WVU7_ASPFU          ----------------------------------------------WPLVCFVQPD-GTE
A0A0D8JVN0_COCIM      ----------------------------------------------WPLVSFVLPD-GTE
C0NFA5_AJECG          ----------------------------------------------WPVVCFVQPD-GTE
Q0UCQ7_PHANO          ----------------------------------------------FPVVRFAIAD-GTT
A7EDF0_SCLS1          ----------------------------------------------FPLVRFSIPD-GTV
Q5KKJ1_CRYNJ          ----------------------------------------------LPVVRFKVPG-GGT
A0A0D1DZD7_USTMA      ----------------------------------------------WPLVRFHLPN-GQT
E3LA34_PUCGT          -----------------------EAEAKGLPTTANTSTTPKSNGGLVPLVEWFLMN-GKR
A8N8Y7_COPC7          ----------------------------------------------YPVVDFYTPK-ITR
PIF1_SCHPO            ----------------------------------------------WPLVRFKLPN-GGE
I1BKX4_RHIO9          ----------------------------------------------YPVVRFAS-----G
Q6CEU3_YARLI          SDCVFERLKAFPEDADNATFLKRKLERRKQLEDLAKTNLAAMNGAVYPVVRFRRMD-HTF
A8N288_COPC7          ---------------------------------------INNNVFSTSQYWPLVRF-TNG
D6RJX6_COPC7          ---------------------------------------APLPATRRLMLWPLVRF-VGG
Q5KCW7_CRYNJ          ---------------------------------------DLEFPVVAFAQSKFARK-KVP
PIF1_YEAST            -----------------TDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASD-MST
Q756Y6_ASHGO          -----------------VTDPEVKANLERKKQLLQEVHMSSKGKK-LPLVQFFQPD-NTT
W1QEW7_OGAPD          -----------------DLPESAQKNIERKIELLNQLYSSSKNRR-MPLVRFIQAD-GTT
PIF1_CANAL            -------------------EES--ESSKRKSKLKDDLMKDYKNKK-YPLVKFLLPDGITF
G8BK92_CANPC          -------------------THDGKQTDDRKTELNNDLLGDFKNRK-FPLVKFLSPDGVNS
RRM3_YEAST            -----------------DLNARPLARLERLKILINYAVKISPHKEKFPYVRWTVGK-NKY
Q756M1_ASHGO          -----------------AIAARPALRRPHLQEFLSRAPHE-PRDGLLPVVRFVVA--GRA
W1QFA7_OGAPD          -----------------EFLATNYNSPP--QVELAKEMIRTAKNSKLSEVLPLVKF-SHS
A0A1D8PRM6_CANAL      -----------------YYEGLSNERKEWVQNATNVAVR-GTGVECFPVVNFKTR--GSD
G8BBJ1_CANPC          -----------------VFQQVPDERKTHFESLVQMAVL-ETTANILPVVLFKLN--GYD
C4Y757_CLAL4          -----------------VFNNLPPDLHAKASRLIMEAYKQDPNEERMPLVSFLVD--GYP
PIF1_HUMAN            -------------------------------------------------RGLPQVRFLCG
H2Q9L3_PANTR          -------------------------------------------------RGLPQVRFLCG
G3S8K9_GORGO          -------------------------------------------------RGLPQVRFLCG
A0A2J8T886_PONAB      -------------------------------------------------RGLPQVRFLCG
A0A1D5Q3I2_MACMU      -------------------------------------------------RGLPQVRFLCG
F7HI20_CALJA          -------------------------------------------------RGLPQVRFLCG
F6UY05_CANLF          -------------------------------------------------RGLPQVRFLCG
PIF1_MOUSE            -------------------------------------------------RGLPRVRFLCG
PIF1_RAT              -------------------------------------------------RGLPRVRFLCG
H0X2J4_OTOGA          -------------------------------------------------SGLPQVRFLCG
F7ET02_MONDO          -------------------------------------------------RGLPTVKFLCG
F6R806_ORNAN          -------------------------------------------------KGLPQVRFLCG
I3JWJ9_ORENI          -------------------------------------------------HGLPRVRFLCG
G3PSK1_GASAC          -------------------------------------------------HGLPRVHFLCG
H2LXB4_ORYLA          -------------------------------------------------KGLPRVRFLCG
PIF1_DANRE            -------------------------------------------------QGLPRVRFLCG
F6VQD1_XENTR          -------------------------------------------------KNLPVVRFLCG
G1KND2_ANOCA          -------------------------------------------------RGLPKVKFLCG
W4Y048_STRPU          -------------------------------------------------KGNPKVRFMSG
A0A1X7UHE6_AMPQE      -------------------------------------------------QGFPVVQFTTG
W5JD43_ANODA          --------------------------------------------------GLPLVKFKR-
Q7Q395_ANOGA          --------------------------------------------------GLPLVKFKR-
J9HF21_AEDAE          --------------------------------------------------GYPLVKFKK-
Q9VQR3_DROME          --------------------------------------------------DLPVVRFKNN
Q29MC1_DROPS          --------------------------------------------------DLPVVRFKNN
A0A088ASR6_APIME      --------------------------------------------------NVPIVQFKSG
H9JHA1_BOMMO          --------------------------------------------------GFPVVRFKNK
G5EFV7_CAEEL          -------------------------------------------------NPMIRFVSQAD
A8WZ54_CAEBR          -------------------------------------------------NPIVRFVAQ-N
A0A2H2I3F9_CAEJA      -------------------------------------------------NPLVRFVSQKH
Q54Z42_DICDI          --------------------------------------------FHKVNQYLPVVLFNDG
                                                                                  

A0A098E1Q1_GIBZE      RVILCQPEEWKVELPNG--------EVQAKRAQLPLILAWALSIHKAQGQTLERVKVNLG
Q7RXT1_NEUCR          RDILCQPEDWKVELPTG--------EVQASRKQLPLILAWALSIHKAQGQTLERVKVDLG
PIF1_EMENI            RHLLCQPESWKIELPNG--------EVQAQRQQVPLILAWALSIHKAQGQTLQRVKVDLG
Q4WVU7_ASPFU          RHLLCQPEAWKIELPNG--------EVQAQRQQVPLILAWALSIHKAQGQTLQRVKVDLG
A0A0D8JVN0_COCIM      RQLLCKPETWKIELPNG--------EVQAQRQQVPLILAWALSIHKAQGQTLQRVKVDLG
C0NFA5_AJECG          RHLLCQPETWKIELPNG--------EVRAQRTQVPLILAWALSIHKAQGQTLQRVKVDLG
Q0UCQ7_PHANO          RDLLCKREDWKIELPNG--------EVQASRSQIPLILAWALSIHKAQGQTLERVRVDLG
A7EDF0_SCLS1          RDLLVQPEEWKIELPNG--------EIQAQRTQLPLILAWALSIHKAQGQTLERVKIDLK
Q5KKJ1_CRYNJ          RDVLMEMDVFKAELPNG--------EVQASRSQLPLILAWAMSIHKSQGQTLDRVRVDLG
A0A0D1DZD7_USTMA      RDYLARPESWKTELPNG--------EVQASRTQVPLILAWAMSIHKSQGQTLPCCKIDLN
E3LA34_PUCGT          EFTVVKRAEFKVENMDG--------EVQSRRSQLPLILAWAMSIHKSQGQTLQRVKVDLG
A8N8Y7_COPC7          RRVLVLQDSWKSELPTG--------EVQLSRVQLPLILAWAMSIHKSQGQTLERVKVDLD
PIF1_SCHPO            RTIVVQRETWNIELPNG--------EVQASRSQIPLILAYAISIHKAQGQTLDRVKVDLG
I1BKX4_RHIO9          RELVLEYETWSFELPGG--------KVLASRSQIPLMLAWAISIHKSQGQTLDRVKVDLG
Q6CEU3_YARLI          RNVLLHPETFSVENIEG--------EVLASRTQIPLILAWALSIHKAQGQTLQYVKVDLA
A8N288_COPC7          MELLCAPLAFTAQGFIG--------NIEAHRLQVPLILSWALSIHKSQGQTLDRVKVDLA
D6RJX6_COPC7          IERMVIPADFTVNNAEG--------EVEAKRIQIPLILSWALSVHKSQGQTLERVKVDLK
Q5KCW7_CRYNJ          ERVIIPSMSVDMLNALG--------QPEATRYQIPLILAWALTIHKSQGQTLERVKIDLA
PIF1_YEAST            RMVLVEPEDWAIEDENE--------KPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLR
Q756Y6_ASHGO          RTVLVREEAWAIEDENE--------KPLVTRVQLPLMLAWALSIHKSQGQTLNKVKVDLR
W1QEW7_OGAPD          REVLIEPETFSLEDEFE--------RPIVSRTQIPLILAWSLSIHKSQGQTLPLVQIDLR
PIF1_CANAL            RTVVVEPEQWTTEDEDG--------TVLVSRIQFPLILAWSLSIHKSQGQTLSKVVVDMK
G8BK92_CANPC          RTVLVEPEQWTVEDEDG--------RVLVSRVQFPLMLAWSLSIHKSQGQTLSRVKVDLK
RRM3_YEAST            IHELMVPERFPIDIP--------RENVGLERTQIPLMLCWALSIHKAQGQTIQRLKVDLR
Q756M1_ASHGO          RFELVQREEFPVEVPAG-----PHAAGDASRLQVPLVPCWALSIHKAQGQTIPRLKVDLR
W1QFA7_OGAPD          SLRLIEPVPFSTESN-----------SDLSREQLPILLSWALSIHKSQGQTLERVKVDLT
A0A1D8PRM6_CANAL      VVALVDKQDFKMEKASKKVTDQLDDLNVLAREQLPLLLAWAMSIHKSQGQTLDRVRVDLG
G8BBJ1_CANPC          EAVLVDRQEFTVETGHENRAD-----GNPYRAQLPLLLSWAMSIHKAQGQTLPRVKIDLN
C4Y757_CLAL4          TVLYVRREEFTVDQGQAKKDGQ---GNEMTRSQLPLLLAWAMSIHKAQGQSIDRLRVDLR
PIF1_HUMAN            VTEVIHADRWTVQATG---------GQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLG
H2Q9L3_PANTR          VTEVIHADRWTVQATG---------GQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLG
G3S8K9_GORGO          VTEVIRADRWTVQATG---------GQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLG
A0A2J8T886_PONAB      VTEVIRADRWTVQATG---------SQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLG
A0A1D5Q3I2_MACMU      VTEVIRADRWTVQATR---------NQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLG
F7HI20_CALJA          VTEVIRTDRWTVQVTG---------SQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLG
F6UY05_CANLF          VTKVIHADRWTVQATG---------GQLLSRRQLPLQLAWAISIHKSQGMSLDCVEISLG
PIF1_MOUSE            ITEVIRTDRWTVQVTG---------GQYLSRQQLPLQLAWAISIHKSQGMSLDCVEISLG
PIF1_RAT              ITEVIRTDRWTVQVTG---------GQYLSRQQLPLQLAWAMSIHKSQGMSLDCVEISLG
H0X2J4_OTOGA          LTEVIRADRWTVQATG---------GQLLSRQQLPLQLAWAISIHKSQGMSLDCVEISLG
F7ET02_MONDO          VTEVVRTERWTVHGPG---------GQLLSRQQLPLRLAWALSIHKSQGMTLDCVEISLA
F6R806_ORNAN          VTEVVHFERWNLQSPG---------GQPLSRQQLPLRLAWALSIHKSQGMSLDCVEISLA
I3JWJ9_ORENI          VTEVLKPERWVFKSGG---------GIHLSRQQLPLKLAWAISIHKSQGMTLDCVEISLA
G3PSK1_GASAC          ATEVLKPERWVFKSGG---------GIHLSRQQLPLKLAWAISIHKSQGMTLDCVEISLA
H2LXB4_ORYLA          VTEVLRPERWVFKSAS---------GVHLSRTQLPLKLAWAISIHKSQGMTLDCVEISLA
PIF1_DANRE            AVEVMKRERWMFKAPG---------GLYLSRQQLPLKLAWAISIHKSQGMTLDCVEISLA
F6VQD1_XENTR          VTEVIKPDRWVFKGHG---------GIYLSRQQLPLKLAWAISIHKSQGMSLDCVEISLS
G1KND2_ANOCA          VTNAVGMERWLLKGPA---------GTYLSRQQLPLKLAWAISIHKSQGMSLDCAEVSLA
W4Y048_STRPU          LEEVIRPERWSMCIGQ---------SLILTRRQLPLKLAWAISIHKSQGMSLDCVEISLS
A0A1X7UHE6_AMPQE      LKETIGFEKWTFHTGG---------GYALSRKQLPLKLAWAMSIHKSQGMTLDCVEISLG
W5JD43_ANODA          RELVVRSEKWSVKTAA---------GMVLTRTQLPLKLAWAFSIHKSQGLTLDCVELSLS
Q7Q395_ANOGA          RELLIRHEKWSVKTGS---------GMVLTRIQLPLKLAWAFSIHKSQGLTLDCVELSLS
J9HF21_AEDAE          RDLLVKPEKWSIKTAG---------AVIVTRSQLPLKLAWAFSIHKSQGLTLDCVEMSLS
Q9VQR3_DROME          QEYVCKHERWIIKTAS---------GNHITRRQVPLKLAWAFSIHKSQGLTLDCVEMSLS
Q29MC1_DROPS          QEYVCKHEKWIIKTAT---------GGVITRRQVPLKLAWAFSIHKSQGLTLDCVEMSLS
A0A088ASR6_APIME      IQYHAKLEKWNLKTNI---------GTIVCRKQIPLKLAWAFSIHKSQGLTLDCVEMCLA
H9JHA1_BOMMO          KEYIARTERWYVKNSN---------GTLLCRRQVPLSLAWAFSIHKSQGLTLDCVEMSLS
G5EFV7_CAEEL          ASIEIRRSKFSVRIPGS--------DAPLIRRQLPLQLAWAISIHKSQGMTLDCAEISLE
A8WZ54_CAEBR          VAIEIRRSKFSIRVPGS--------DVPYIRRQYPLQLAWAISIHKSQGMTLDCAEISLE
A0A2H2I3F9_CAEJA      TSIEIRRSKFSVRIPGC--------DTTAIRRQLPLQLAWAISIHKSQGLTLDCAEISLE
Q54Z42_DICDI          QKVTIPPSEWCVWSEEK-----------AYRNQIPLKLAWALTIHRAQGMTLDKVECELS
                                                    * * *:  .:::::*::** ::      : 

A0A098E1Q1_GIBZE      RVFEKGQAYVALSRATTQDGLQVLGFQKAKVMAHPRVIDFYNKLYSAEEALGKPK--AQS
Q7RXT1_NEUCR          RVFEKGQAYVALSRATTQQGLQVLRFQKDKVMAHPRVVSFYNKLYSAESAVMKRTKVDQS
PIF1_EMENI            KVFEKGQAYVALSRATSKAGLQVLRFDPRKVMVHPKVIEFYRNLVHASDLIK--------
Q4WVU7_ASPFU          RVFEKGQAYVALSRATSKAGLQVTRFDPRKVMVHPKVTEFYSNLVSITDALA--------
A0A0D8JVN0_COCIM      RVFEKGQAYVALSRATSTSGLQVTRFEPRKVMVHHKVKEFYANLSTTNDII---------
C0NFA5_AJECG          RVFEKGQAYVALSRATSQAGLQVSRFDPRRVMVHPKVLEFYSNLSTVHNIKDAANSKANI
Q0UCQ7_PHANO          RVFEKGQAYVALSRATSMAGLQILRFDPRKVIAHEKVRSFYSSLSRAEQVEGKA------
A7EDF0_SCLS1          RVFENGQAYVALSRATSQAGLEVQNFDPKKVMAHPRVAEFYNSLYSVNRALAHPKVARAD
Q5KKJ1_CRYNJ          KVFEKGQAYVALSRATSLEGLQVTGFTAEKVMAHKKVAVWSSTLKDLNLV----------
A0A0D1DZD7_USTMA      RVFEKGQAYVALSRATSLEGLQVLGFRPDKVMAHPRVIQWSQSLIALSD-----------
E3LA34_PUCGT          KVFEKGQIYVALSRATSLEGLQVLRFDPKKVMAHPDVILWSKNNLVTGSSL---------
A8N8Y7_COPC7          KVFEKGQAYVALSRATSLEGLQVINFRPEKVQAHSKVLAWSKTLKTVTDTQNTP------
PIF1_SCHPO            RVFEKGQAYVALSRATTQEGLQVLNFSPAKVMAHPKVVQFYKQLASVNGLPIRN------
I1BKX4_RHIO9          KVFEKGQAYVALSRATSLDRLQILNFDPAKVMAHPRVTEFYKTLQTVN------------
Q6CEU3_YARLI          KTFERGQAYVALSRATSKEGLQVLNFLPEKVKTHPKVVEFYKTLTTYEDDE---------
A8N288_COPC7          SVFENGQAYVALSRARTMEGLEVVNFDPSKIRADPRVAAWQEFYTSLGC-----------
D6RJX6_COPC7          QTFEKGQAYVALSRATSMDHLQVLNFEASKVEAHPLVLHWYRTKAGSPASLRDEFD----
Q5KCW7_CRYNJ          KIFVEGQTYVAISRAVSLDSLEVLNFRPHSVKAHSKVIDWARPYEEEQA-----------
PIF1_YEAST            RVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQV
Q756Y6_ASHGO          RVFEKGQAYVALSRAVSRGGLQVLNFDKEKIQAHSKVVEFYDSLVSANDAVKMRKD----
W1QEW7_OGAPD          NIFERGQAYVALSRATHRRGLQVRNFNPSRILTHEKVVAFYNSLMTVDEIKDREES----
PIF1_CANAL            KIFENGQAYVALSRAVSRAGLQVLNFNRSKVASHRKVIEFYKNLSSHEKESRSGQQ----
G8BK92_CANPC          SVFETGQSYVALSRATSRDGLQVLNFNEHKVRSHPKVVEFYKSLVDISKAHSTGQQ----
RRM3_YEAST            RIFEAGQVYVALSRAVTMDTLQVLNFDPGKIRTNERVKDFYKRLETLK------------
Q756M1_ASHGO          RTFEAGQAYVALSRAVSKDHLQIINFDPKKIKADPKVKQFYHTLELLPTA----------
W1QFA7_OGAPD          KIFEKGQVYVALSRCVDTKNLEIVNFDEKRIRVSEDVVQFYENLKRLK------------
A0A1D8PRM6_CANAL      RSFADGQAYVALSRATSKDRLELRHFRPDKVTTSNAVRMFYQSLEQV-------------
G8BBJ1_CANPC          RVFENGHAYVAISRAVSRETLQVKHFSIGKVKASPIVKQFYQHLEK--------------
C4Y757_CLAL4          KIFERGQVYVALSRATNKEHLEVINFDPRRITVAEEVLQFYSQISPVDVKREKSLAEVH-
PIF1_HUMAN            RVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDDDEA
H2Q9L3_PANTR          RVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDDDEA
G3S8K9_GORGO          RVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDDDEA
A0A2J8T886_PONAB      RVFASGQAYVALSRARSLQGLRVLDFDPTAVRCDPRVLHFYATLRRGRGLSLESPDDDEA
A0A1D5Q3I2_MACMU      RVFASGQAYVALSRARSLQGLRVLDFDPVAVRCDPRVLHFYATLQRGRGLSLESPDDDEA
F7HI20_CALJA          RVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDGDEA
F6UY05_CANLF          RVFASGQAYVALSRARSLEGLRVLDFDPMVVRCDPRVLSFYATLQRGRGPSLKSPDDDEA
PIF1_MOUSE            RVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDSRVLHFYATLRQGRGLSLESQDDEEA
PIF1_RAT              RVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDSRVLQFYATLRQGRGLSLESQDDEEA
H0X2J4_OTOGA          RVFASGQAYVALSRARSLQGLRVLDFDPMVVRCDPRVLHYYATLRRSRGLSLVRGRRGSE
F7ET02_MONDO          RVFESGQAYVALSRARSLQGLRVLDFDPNVVRCDPRVLKFYASLRKQAYL-----NEDEE
F6R806_ORNAN          RVFESGQAYVALSRARSLQGLRVLDFDPDVVRSDPRVLRYYASLRPEGRPGEMPPTEEGD
I3JWJ9_ORENI          RVFESGQAYVALSRARNLEGLRVMDFDPRVVRADPDVLLFYRKLRKERLLMQASMEDFVS
G3PSK1_GASAC          RVFESGQAYVALSRARSLEGLRVMDFDPRVVRADPDVLIFYKKLRKERLLMQASMDDFLG
H2LXB4_ORYLA          RVFESGQAYVALSRARSLEGLRVMDFNPHVVRADPDVLLFYKKLRKERLLVQETESRFLS
PIF1_DANRE            RVFESGQAYVALSRARSLEGLRVMDFDPRVVQANQDVLIFYKRLRKERLLMQSSMNDFVG
F6VQD1_XENTR          RVFESGQAYVALSRARNLEGLRVMDFDPKVVRANPYVLQFYSQMRKERALRQTCLEDFLE
G1KND2_ANOCA          RVFEYGQAYVALSRARSLVGLRVLDFDPKVVRANPYVLQFYKQLRKDKFLTQAALNFCIQ
W4Y048_STRPU          RVFECGQAYVALSRATSLQGLRVLDFDGSCVRAHPDVIRFYVQLRKEQRHLQQTSIRRYG
A0A1X7UHE6_AMPQE      GVFETGQAYVALSRAKSLKTLRVKGFDPSRVQANKDVLEYYRNIRRIKRATHCGPV----
W5JD43_ANODA          KVFEAGQAYVALSRAQSLDSIRVLDFDLKQVWANTKVLEYYRKLRKRLAEESLMQPVAVR
Q7Q395_ANOGA          KVFEAGQAYVALSRAQSLDSIRVLDFDLRQVWANTKVLEYYRYLRKMIANGNHMEPVAVK
J9HF21_AEDAE          KVFEAGQAYVALSRAQSLDSLRVLDFDGKQVWANPKVLEYYRDLRRQIRDREYITPMAVK
Q9VQR3_DROME          KVFEAGQAYVALSRAKSLQSIRILDFDAKQVWANPHVLQFYKGFRRKLMD-TTMIPLGPK
Q29MC1_DROPS          KVFEAGQAYVALSRAKSLQSVRILDFDAKQVWANPQVLQFYKGFRRRLMD-TTMIPLGPK
A0A088ASR6_APIME      RVFDAGQSYVALSRAQSLQSLRVLEFNNQQVWAHSDVLMFYKKFRRNLQE-MEIIPVGKK
H9JHA1_BOMMO          KIFEAGQAYVALSRAQSLDSLRVLDFDSRHVWANPDVLEFYQRFRRRLQQ-MEIVPLGRP
G5EFV7_CAEEL          RVFADGQAYVALSRARSLAAIRIIGFDASCVRANSKVIDFYKSIEAEC---DDEQDWEAP
A8WZ54_CAEBR          RVFADGQAYVALSRARSLAAIRITGFDVSCVRANSKVIDFYKSIENDYHLNDDDGDDDRL
A0A2H2I3F9_CAEJA      RVFADGQAYVALSRARSLSSIRILEFDASCVRANSKVIQYYKSIEDDN---EEEDNYLES
Q54Z42_DICDI          RTFASGQGYVALSRVKSLAGLHLKSLNTPALKTSPKVVTFNKKIIRSINNSHI-------
                        *  *: ***:**      :.:  :    :     *  :                    

A0A098E1Q1_GIBZE      ITSFVSNRIGSAPSRAPAPKKP--------------APQVVDLDDEEEAMAAAYGN----
Q7RXT1_NEUCR          ITKFAYKTPSVAQAITKQQQQ---------------RREVIDIEDEEERMAGYG------
PIF1_EMENI            ----SKQPPKPQRTISNGDE----------------------DVYIDELIAEAEAY----
Q4WVU7_ASPFU          ----PKSSKPREHQEVDEDG----------------------QLEDEELLQHLYG-----
A0A0D8JVN0_COCIM      ----TSRAQANKAAPTDDDI------------------PGLDSDLEREIYAQALG-----
C0NFA5_AJECG          LVDGNNSANVDTSTSTSADIDTNAKPSRDQAKIAKRPSTNFSDDFDDDVLERVYA-----
Q0UCQ7_PHANO          ----KSKTILGKMQTATAKK----------------------KGVDNEE-----------
A7EDF0_SCLS1          ----PPKIATKPIKPLRDDP---------------------SVDEDEGEMARNFG-----
Q5KKJ1_CRYNJ          ------------------------------------------------------------
A0A0D1DZD7_USTMA      ------------------------------------------------------------
E3LA34_PUCGT          ------------------------------------------------------------
A8N8Y7_COPC7          ------------------------------------------------------------
PIF1_SCHPO            ----ENKAPVQMRGVKNK------------------------------------------
I1BKX4_RHIO9          ------------------------------------------------------------
Q6CEU3_YARLI          ----PHEVQQENVQPMRAVG----------------------------------------
A8N288_COPC7          ----DDDDFMDSEEAMRSYWDTD-------------------------------------
D6RJX6_COPC7          ----DFDDEMDSEEAMQAYYDL--------------------------------------
Q5KCW7_CRYNJ          ----AEEEWNNLEDNIGILY----------------------------------------
PIF1_YEAST            KKRKLDYAPGPKYKAKSKSKSNSPAPISATTQSNNGIAAMLQRHSRKRFQLKKESNSNQV
Q756Y6_ASHGO          VQRKISFP-----ITKSKAPNAPTLPLAPQLRGNS-IITLLERSNKN-----SGRSLSQK
W1QEW7_OGAPD          -------------KRKKTTGFVSSTQLNRLENLADNVADAGDFVNEK------DNVIDEF
PIF1_CANAL            -------------------------RLNFMQTSVKSVARAQI------------------
G8BK92_CANPC          -------------------------RLNFASRE---------------------------
RRM3_YEAST            ------------------------------------------------------------
Q756M1_ASHGO          ------------------------------------------------------------
W1QFA7_OGAPD          ------------------------------------------------------------
A0A1D8PRM6_CANAL      ------------------------------------------------------------
G8BBJ1_CANPC          ------------------------------------------------------------
C4Y757_CLAL4          ------------------------------------------------------------
PIF1_HUMAN            ASDQENMDPIL-------------------------------------------------
H2Q9L3_PANTR          ASDQENMDPNL-------------------------------------------------
G3S8K9_GORGO          ASDQENVDPNL-------------------------------------------------
A0A2J8T886_PONAB      ASDQENMDPNL-------------------------------------------------
A0A1D5Q3I2_MACMU      ASDQENVDPNL-------------------------------------------------
F7HI20_CALJA          ASDQENTDPNL-------------------------------------------------
F6UY05_CANLF          ASDQENEDPNL-------------------------------------------------
PIF1_MOUSE            NSDLENMDPNL-------------------------------------------------
PIF1_RAT              SSDLENMDPNL-------------------------------------------------
H0X2J4_OTOGA          DRSRSNIRPL--------------------------------------------------
F7ET02_MONDO          DPEQENKDPDI-------------------------------------------------
F6R806_ORNAN          ASDQENVAPDL-------------------------------------------------
I3JWJ9_ORENI          N-NKENAW----------------------------------------------------
G3PSK1_GASAC          NSNKENPW----------------------------------------------------
H2LXB4_ORYLA          PSLQASMDEFV-------------------------------------------------
PIF1_DANRE            QSNKENSRW---------------------------------------------------
F6VQD1_XENTR          N--KENC-----------------------------------------------------
G1KND2_ANOCA          D-DKENVEGT--------------------------------------------------
W4Y048_STRPU          TEDKENYS----------------------------------------------------
A0A1X7UHE6_AMPQE      ------------------------------------------------------------
W5JD43_ANODA          AKPDRTGKNLKKSLSALGLSKAAMNKPLMTIN----------------------------
Q7Q395_ANOGA          RK-------LKKSLSAMGLSKSIMDKPLMTIK----------------------------
J9HF21_AEDAE          KKDG----GLKKSLSAMGLTKSLMSKPLVTIN----------------------------
Q9VQR3_DROME          NKDKK-PGDKAANSALAKLKKSLINKPLVSIS----------------------------
Q29MC1_DROPS          NKDKR-PGD--ANSALAKIKKSLMNKPLVSIS----------------------------
A0A088ASR6_APIME      QKI---------------------------------------------------------
H9JHA1_BOMMO          LPEKA-----TKKLKLRDILEKQLRQK---------------------------------
G5EFV7_CAEEL          AAGPRLKRVRSI------------------------------------------------
A8WZ54_CAEBR          SISSKIKRFRSI------------------------------------------------
A0A2H2I3F9_CAEJA      DCQPKKFKPSNF------------------------------------------------
Q54Z42_DICDI          ------------------------------------------------------------
                                                                                  

A0A098E1Q1_GIBZE      -------------------
Q7RXT1_NEUCR          -------------------
PIF1_EMENI            -------------------
Q4WVU7_ASPFU          -------------------
A0A0D8JVN0_COCIM      -------------------
C0NFA5_AJECG          -------------------
Q0UCQ7_PHANO          -------------------
A7EDF0_SCLS1          -------------------
Q5KKJ1_CRYNJ          -------------------
A0A0D1DZD7_USTMA      -------------------
E3LA34_PUCGT          -------------------
A8N8Y7_COPC7          -------------------
PIF1_SCHPO            -------------------
I1BKX4_RHIO9          -------------------
Q6CEU3_YARLI          -------------------
A8N288_COPC7          -------------------
D6RJX6_COPC7          -------------------
Q5KCW7_CRYNJ          -------------------
PIF1_YEAST            HSLVSDEPRGQDTEDHILE
Q756Y6_ASHGO          FSYVPSQSNNQAPSP----
W1QEW7_OGAPD          DSVWSGQ------------
PIF1_CANAL            -------------------
G8BK92_CANPC          -------------------
RRM3_YEAST            -------------------
Q756M1_ASHGO          -------------------
W1QFA7_OGAPD          -------------------
A0A1D8PRM6_CANAL      -------------------
G8BBJ1_CANPC          -------------------
C4Y757_CLAL4          -------------------
PIF1_HUMAN            -------------------
H2Q9L3_PANTR          -------------------
G3S8K9_GORGO          -------------------
A0A2J8T886_PONAB      -------------------
A0A1D5Q3I2_MACMU      -------------------
F7HI20_CALJA          -------------------
F6UY05_CANLF          -------------------
PIF1_MOUSE            -------------------
PIF1_RAT              -------------------
H0X2J4_OTOGA          -------------------
F7ET02_MONDO          -------------------
F6R806_ORNAN          -------------------
I3JWJ9_ORENI          -------------------
G3PSK1_GASAC          -------------------
H2LXB4_ORYLA          -------------------
PIF1_DANRE            -------------------
F6VQD1_XENTR          -------------------
G1KND2_ANOCA          -------------------
W4Y048_STRPU          -------------------
A0A1X7UHE6_AMPQE      -------------------
W5JD43_ANODA          -------------------
Q7Q395_ANOGA          -------------------
J9HF21_AEDAE          -------------------
Q9VQR3_DROME          -------------------
Q29MC1_DROPS          -------------------
A0A088ASR6_APIME      -------------------
H9JHA1_BOMMO          -------------------
G5EFV7_CAEEL          -------------------
A8WZ54_CAEBR          -------------------
A0A2H2I3F9_CAEJA      -------------------
Q54Z42_DICDI          -------------------