CLUSTAL format seed alignment for MF_03177

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q756M1_ASHGO          ----------MYQRA---THGLKRTNPAPTDPA------------------------KRP
G8JWH4_ERECY          -----MLVESMYRISGGNTGSECSKDEANRVRK------------------------KKP
C5DM92_LACTC          ----------MFSQR------SKRTKSSHDSSK------------------------TGP
Q6CQY1_KLULA          -----------------------MLNKLNANKK------------------------NKK
A7TJ00_VANPO          ---------------------MKRGSGKPSNVKSSNDQ--------------------KL
G8BSI5_TETPH          ---------------------MIRSNSKPVKKTSSNN-----------------------
G0V6X7_NAUCC          ---------------------MLRSGKSNKPRNSSNSITMNSSTRLS--SSQATNDGHRT
G0W9L4_NAUDC          ---------------------MYKNGNTSNGKSLTGRRTATSSKPNQSFAIYKTKVKQPA
H2AVD6_KAZAF          ---------------------MFRSSNGDSDK-----------------------TKKQR
J7S460_KAZNA          ---------------------MQRSKPFGANG-------------------------SSQ
J8PMR0_SACAR          ---------------------MFRSNASGNKKQWSKRTANGNASAES--------ASGSH
J6EEG6_SACK1          ---------------------MFRSHASGNKKQWSKRASNGNVSADS--------ASGTH
A6ZST7_YEAS7          ---------------------MFRSHASGNKKQWSKRSSNGNTPAAS--------ASGSH
H0GH54_SACCK          ---------------------MFRSHASGNKKQWSKRSSNGNTPAAS--------ASGSH
B3LSF2_YEAS1          ---------------------MFRSHASGNKKQWSKRSSNGNTPAAS--------ASGSH
C8ZAA0_YEAS8          ---------------------MFRSHASGNKKQWSKRSSNGNTPAAS--------ASGSH
RRM3_YEAST            ---------------------MFRSHASGNKKQWSKRSSNGSTPAAS--------ASGSH
N1P392_YEASC          ---------------------MFRSHASGNKKQWSKRSSNGSTPAAS--------ASGSH
G2WFA3_YEASK          ---------------------MFRSHASGNKKQWSKRSSNGSTPAAS--------TSGSH
C7GTU9_YEAS2          ---------------------MFRSHASGNKKQWSKRFSNGNTPAAS--------ASGSH
G8ZVF0_TORDC          ---------------------MKGSEAQGKQP----------------------------
Q6FPW0_CANGA          ---------------------MRRQAK--------------------------------K
C5E0W3_ZYGRC          ---------------------MFRGSSKSSKSK------------------------DQS
I2H165_TETBL          ---------------------MFKVSKKKPEK----------------------------
K0KZ61_WICCF          -------------------------------------MLGSRSQPGKKLSKKENPFGKPS
W1QFA7_OGAPD          -------------------------------------MF--------NVSLKTSNSKKPG
C4R014_KOMPG          MLSLFLEPGVRSTLNLGVRAVAQMAHHCMIYNNIKFRLLWSVEGCMSPVDFSCWTQCPNG
Q6BNW6_DEBHA          ------------------------------------------MSISRPYKSVKKTKSGNS
G8YJN4_PICSO          -------------------------------------------MFNKPYRPVKSEK-VKS
C4Y757_CLAL4          ---------------------------------------------------MAQKK----
H8WVI4_CANO9          ---------------------------------------------------MSTKIKKKG
G8BBJ1_CANPC          ---------------------------------------------------MPTKSKKQS
A5DRR3_LODEL          ---------------------------------------------------MVKGDRRQP
A0A1D8PRM6_CANAL      -------------------------------MARDLEVAFEKKKQQQQPLLFIMTPPVKS
C4YNB1_CANAW          -----------------------------------------------------MTPPVKS
B9WKK1_CANDC          -----------------------------------------------------MKPIVKS
                                                                                  

Q756M1_ASHGO          KLKQGTLSFLYDAKKK--------------------AAAVA-------APARLPVGNAPE
G8JWH4_ERECY          KLKQGTLGFLYRAKDKSS-------------GSGDGANCSG-------AIERKVLAGKRD
C5DM92_LACTC          KSHISSSDAPTMRQKT--------------------VTSFF-------AKKTRRLVGTSS
Q6CQY1_KLULA          KDGQSTLNMFFKVKNK--------------------PALES-------SSSFNSHFTEKT
A7TJ00_VANPO          SLKQKSIASFFNR---SNRVK---------EEVVHEARKKEQHVVVIQDSIQETRQTIIN
G8BSI5_TETPH          --KQPSIASFFSKNSNSASLK---------NSTTSNAFKK--------SSRPSSPQKEIS
G0V6X7_NAUCC          TKKQQTLSSFFFTAKSSN----SISTSTTSKHLHSHSHSQS-------QNKTTTGLDANH
G0W9L4_NAUDC          VLRQKTLSSFFFKTGSQSPKKASHTHSLTEIVRSSEIESSS-------QVSHEKEGDVNH
H2AVD6_KAZAF          GLKQKTLSSYFFQVKPKS-------QSFDSKSQSTKANLAT-------KSKSFKETRTIR
J7S460_KAZNA          KPRQKSICTFFSSAKSPG------ANGISRASPQVQSGSAK-------DPITLNGPVPKL
J8PMR0_SACAR          FYRQQTLSSFLMGPNKRT------------AVVAKNSATII-------DLENGHEGDQTK
J6EEG6_SACK1          AFRQQTLSSFFVGSKKRA------------AAV---PTTVI-------DLESADEGSRPK
A6ZST7_YEAS7          AYRQQTLSSFFMGSGKKS------------AAASKNSTTII-------DLESGDEGNRNI
H0GH54_SACCK          AYRQQTLSSFFMGSGKKS------------AAASKNSTTII-------DLESGDEGNRNI
B3LSF2_YEAS1          AYRQQTLSSFFMGSGKKS------------AAASKNSTTII-------DLESGDEGNRNI
C8ZAA0_YEAS8          AYRQQTLSSFFMGSGKKS------------AAASKNSTTII-------DLESGDEGNRNI
RRM3_YEAST            AYRQQTLSSFFMGCGKKS------------AAASKNSTTII-------DLESGDEGNRNI
N1P392_YEASC          AYRQQTLSSFFMGCGKKS------------AAASKNSTTII-------DLESGDEGNRNI
G2WFA3_YEASK          AYRQQTLSSFFMGSGKKS------------AAASKNSTTII-------DLESGDEGNRNI
C7GTU9_YEAS2          AFRQQTLSSFFMGSGKKS------------AAASKNSTTII-------DLESGDEGNRNI
G8ZVF0_TORDC          VLRQATLSSFFKSSRRLA------------AVRPVRHAAVQ-------QPD-----VPPA
Q6FPW0_CANGA          DPKQKSINSFFFKAAKSK---------SLIVNSSSRSQAHS-------TLPSSQGSSRSD
C5E0W3_ZYGRC          ASRQMSISSFFGSKTVQR-----------------------------------GPVERSP
I2H165_TETBL          --KQRSIASFFSSKKTFTPPKDDAPTTKIATENATTHTDATIDLTTTTAKTTISTSGIPS
K0KZ61_WICCF          KGQQPSVSMFFMKKSN-------------------------------------STLGTEK
W1QFA7_OGAPD          ASKQSTLASFITSSKP-------------------------------------SRDTKPS
C4R014_KOMPG          AFAPTARSTFLRVCFHLR----------------------ICKVMLTKKKKDKNQPSINA
Q6BNW6_DEBHA          DKNQSSISSFFGTAAS--------------------------GSTKSNIKRTPLVLTTPE
G8YJN4_PICSO          DKKQATLSSFFSVKSSEN----------------------FGNNTKEISGQTHTNFSTPR
C4Y757_CLAL4          -PRQRSIASFFAPAPA------------------------------------RKKVSTPE
H8WVI4_CANO9          SLVQHSIFSFHCPGVS---------------------------------KVDNDKSKSQQ
G8BBJ1_CANPC          TLGQQSILAYLGIDGS---------------------------------KANNDKPKQHH
A5DRR3_LODEL          --GIESFFGNPARLRSF--------------------------------EIPIGRDANIV
A0A1D8PRM6_CANAL      QFSLDDFFKKSKYLNP---------------------------------------VKAPV
C4YNB1_CANAW          QFSLDDFFKKSKYLNP---------------------------------------VKAPV
B9WKK1_CANDC          QFKLDDFFKRSKFVKH---------------------------------------EDVVV
                                                                                  

Q756M1_ASHGO          RRLPAAAGLPALRSA-------------LFDSQGSFEE----------------------
G8JWH4_ERECY          DNGVRTVHSSLLRNF-------------VLQNQGSFDE----------------------
C5DM92_LACTC          LAAEPHKSVLMGRKP-------------LFESQGSFDE----------------------
Q6CQY1_KLULA          VSPPVKALRTQSVLS-------------SLHSQGSFEE----------------------
A7TJ00_VANPO          SKTTISNRNVNSKSS------------MLFNSQGSFDEEC--------------------
G8BSI5_TETPH          SNQKATQ--LNKKSM------------LLFSSQGSFDEN---------------------
G0V6X7_NAUCC          PIDIDNNKFCPNRPILTKKPSL-----LLFESQGSFDEE---------------------
G0W9L4_NAUDC          PIDLD--RFSGQRPS------------LLFDSQGSFDEE---------------------
H2AVD6_KAZAF          TKKLDTSSFTSNKPY------------SLFQSQGSFDE----------------------
J7S460_KAZNA          VRTSSSALFSY--------------------SQGSFDE----------------------
J8PMR0_SACAR          TVPPRPRLVRNNSSI------------LFSQPQGSFGD----------------------
J6EEG6_SACK1          IVSPRPRLIRNNSSS------------LFSQTQGSFGD----------------------
A6ZST7_YEAS7          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
H0GH54_SACCK          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
B3LSF2_YEAS1          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
C8ZAA0_YEAS8          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
RRM3_YEAST            TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
N1P392_YEASC          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
G2WFA3_YEASK          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
C7GTU9_YEAS2          TAPPRPRLIRNNSSS------------LFSQSQGSFGD----------------------
G8ZVF0_TORDC          IIDLEMNESSSKKST------------LFCS-QGSFDE----------------------
Q6FPW0_CANGA          GTSFGSGRVMKQRSTLTKS--------NLFTFQGSFNDE---------------------
C5E0W3_ZYGRC          APRPNLKRISSSLTD-----------------SGSFEE----------------------
I2H165_TETBL          SISLKRQVVPPNRSIKLASRTSSNQGSSLFSSQGSFDE----------------------
K0KZ61_WICCF          EPLGKTSPSLLNRSE---------------STPPAFFKSKSSLSQMSSGSFDQDIDDGDL
W1QFA7_OGAPD          QPF--SALKLDKRSV---------------SNDEDFLQNK--------------------
C4R014_KOMPG          FFTSRSKNDRFSALK---------------RFKSDLGP-P--------------------
Q6BNW6_DEBHA          KVALNRSNSFLSKAV---------------VSSGTF------------------------
G8YJN4_PICSO          KDNRKKHESFISQTA---------------NSHDEFTN----------------------
C4Y757_CLAL4          KVVVARADSLLSEMA---------------SARSTF------------------------
H8WVI4_CANO9          SKNISRQNSVLSATD---------------NDD-GFGD----------------------
G8BBJ1_CANPC          NKHISRQNSILSATN---------------NDD-GFGD----------------------
A5DRR3_LODEL          NSKLQRQGSVLSSNT---------------DDDAGFEEEA--------------------
A0A1D8PRM6_CANAL      KPVFQRQDSVLTSLD---------------DDA-GFDD----------------------
C4YNB1_CANAW          KPVFQRQDSVLTSLD---------------DDA-GFDD----------------------
B9WKK1_CANDC          KPVE-RQESALQFMD---------------SDA-GFEE----------------------
                                                         :                        

Q756M1_ASHGO          --ATDDAYITSMLHEKPVHNFKTLSRSSS-------------VLAPAE---NGQRLASHG
G8JWH4_ERECY          --DSEDG-VGMILPEKPVQNFKNLADKRSFR---DAEGQLVGTVADGDECVNNKPAASTV
C5DM92_LACTC          --ENRDEELKHMLNEKPLNNFKSLSRSPS-------------SLSTSS----GQVTATQA
Q6CQY1_KLULA          --ESNDDFYSLLREKKPVKNFKPSSQTFLSSS--QFQCQSGSSFSSQTSTVSGYFSSTTA
A7TJ00_VANPO          ---DPDSEFKKLIKGQTFNNFKRS------G-----TPTRVPLLQRSNSSTVSHTMIQDE
G8BSI5_TETPH          ---DPDFEVKKLMNKPHLNHFKKSRLTGSFG-----TLCRTSSNSSVSSSTISHHLIQDE
G0V6X7_NAUCC          --CDPDAEINNLLNTPKLNNFKSLKP----------KLSTAPILQRSSSSISYHVTEIDT
G0W9L4_NAUDC          --CDPDAEIKKLINVPKLNNFKEVT------------LSRSPSFQRSTSSLSHHVVENDT
H2AVD6_KAZAF          --CDTDAEVKKLMDVPHINNFKQVT-----------TISRSPSFHRSPEKSQRSVLEDLA
J7S460_KAZNA          --ENRDEELKRLVTVPQLNNFKRTAS----------SLSRQPSFPRSNSSLSASSAASPT
J8PMR0_SACAR          --EDPEAEFKKLVNVPRLNSYKKTSK----------SSSVTTSLRKTTSSTSTTHKTYRY
J6EEG6_SACK1          --DDPDAEFKKLVSAPRLNSYKKPSR----------SSSMTNSLHKT-ASASTTQRTYHY
A6ZST7_YEAS7          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
H0GH54_SACCK          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
B3LSF2_YEAS1          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
C8ZAA0_YEAS8          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
RRM3_YEAST            --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
N1P392_YEASC          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
G2WFA3_YEASK          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
C7GTU9_YEAS2          --DDPDAEFKKLVDVPRLNSYKKSSR----------SLSMTSSLHKT-ASASTTQKTYHF
G8ZVF0_TORDC          --CDPDEEFKRLVSGPKLNTMKKAT------------ITRVPSLLRS-----NSSVSYSY
Q6FPW0_CANGA          -DCNPQNEFRKLMNPQEINNFKTPS------------LSRMPSFTRSNSSMSLSPVKRTT
C5E0W3_ZYGRC          --CDPDDELKRLVQTPELNNFKPCRK---------------ISVPRSVNSSQESLISRE-
I2H165_TETBL          --TDPSSELQSLLQKPKLASFKPIRR----------SLKAGPSSKSLVSTSSSTITSTSS
K0KZ61_WICCF          KPKSTAVNFKRSK---PIGTLGPQPDNDDDDDDVVEIVDVKRTLPSYKPPQPKPKSNTTT
W1QFA7_OGAPD          ENAYKRVKLDRSV---SCVGFG----------------QLETPVSDMSISQP-----SSF
C4R014_KOMPG          -KSSQHSSQEAST--EDVIDLS------------------EPQVRPSSFLSQEKRQAFDE
Q6BNW6_DEBHA          ---DEFASSDTSFDSPEINNFK------------------NPALARSFMGQESHRSQVVD
G8YJN4_PICSO          ---DELYSSDAS---PEIVNFK------------------NPILKRSVT-LKRSISDYPE
C4Y757_CLAL4          ---DDFASSDTSFGSPEVTNFK------------------NPVLSRVSSNLTGSPP----
H8WVI4_CANO9          -DSSYDTSIDASM---EISNFR------------------DPTLESVLLQHRANQPLTSQ
G8BBJ1_CANPC          -DSSYDTSIDTSM---EMSNFK------------------NPTLESAVLQHRANQSLSSQ
A5DRR3_LODEL          -DDTFNSSMDTSM---EVSNFR------------------NSNLTMAVKKITNSQKKNSS
A0A1D8PRM6_CANAL      ---VD-VSYDTSV---EVVNLR------------------NTVLPTQTKRSA--------
C4YNB1_CANAW          ---VD-VSYDTSV---EVVNLR------------------NTALPTQTKRSA--------
B9WKK1_CANDC          ---NDDSSFDKSV---EIVNLR------------------SAMQ--QGKRRG--------
                                                                                  

Q756M1_ASHGO          VRKPPS-------------------GTSAPAVDSPP------------------------
G8JWH4_ERECY          VDLTRDEKIV-------------GEGTDLQPQQLPV------------------------
C5DM92_LACTC          SLTSFG-------------------SSQHFVKYSPF------------------------
Q6CQY1_KLULA          TATATAT------------------ATESSWQKPKL------------------------
A7TJ00_VANPO          ESGTFNS------ITSYTSNN---SSSRQLSFTRNLDLDS-----------------SDF
G8BSI5_TETPH          MSDSISS------ITSFTSIKG--SSPRKISFTRNISNDTFTQSALSSKNPNASPFEEDF
G0V6X7_NAUCC          DNDNNEDVA---SLREYTKV---SSGSRQLSFTSN-----------------------NK
G0W9L4_NAUDC          DDDND--------LKDITKI---KAGSRQLSFTSTQSATLASENT-----------QLNF
H2AVD6_KAZAF          DDMNN--------LREVTNI---KVGHRRLAFTST-------------------------
J7S460_KAZNA          KIERRVVQLEDEQFREVTNV---TTGRRQLSFTSTQ----------------------MD
J8PMR0_SACAR          GEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
J6EEG6_SACK1          DEDET--------LREVTSV---KSESRQLSFTSTI------------------------
A6ZST7_YEAS7          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
H0GH54_SACCK          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
B3LSF2_YEAS1          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
C8ZAA0_YEAS8          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
RRM3_YEAST            DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
N1P392_YEASC          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
G2WFA3_YEASK          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
C7GTU9_YEAS2          DEDET--------LREVTSV---KSNSRQLSFTSTI------------------------
G8ZVF0_TORDC          EKE--------------------TVSSTQLSFTNED------------------------
Q6FPW0_CANGA          TVLSSDD-----EFREVTTFQ-SQDAKRQLSFTSSV------------------------
C5E0W3_ZYGRC          -------------------------SSRDETINSPL------------------------
I2H165_TETBL          SIHSS-------------------SGKRHLSSTNHL------------------------
K0KZ61_WICCF          STTTTS-------------------SKLITPPTSTD------------------------
W1QFA7_OGAPD          KHSKPI-------------------EKLEFEKTEID------------------------
C4R014_KOMPG          VPSNIL-------------------PNLSQKTANNF------------------------
Q6BNW6_DEBHA          LTQEDE-------------------TDVQVIYQSLN------------------------
G8YJN4_PICSO          SSNEKN-------------------SGVRLVQQS--------------------------
C4Y757_CLAL4          ------------------------------------------------------------
H8WVI4_CANO9          RNPKIL-------------------GESNLVNAGQN------------------------
G8BBJ1_CANPC          RTLKIL-------------------GESNLVNTTQS------------------------
A5DRR3_LODEL          KSNNTS-------------------NNNNNNNNNFS------------------------
A0A1D8PRM6_CANAL      ------------------------------------------------------------
C4YNB1_CANAW          ------------------------------------------------------------
B9WKK1_CANDC          ------------------------------------------------------------
                                                                                  

Q756M1_ASHGO          --PRRIAGVRSHNPVPESTAA----REVP------PFTVA--------------------
G8JWH4_ERECY          --ARKLAGISDMDHASVAHKQ----ASVAGA-GYFPVSTT--------------------
C5DM92_LACTC          --SSSFTEGLDGGMVSSTQRA----PEKRPPPSHFSFSLN--------------------
Q6CQY1_KLULA          --ERTLSGVKRTYSDVSDGSQ----SSSSSN--ALSLSSV--------------------
A7TJ00_VANPO          SESQTSTQFSSSQDSTISGSN----PLKRHSFHGLNLSSH--------------------
G8BSI5_TETPH          GEMTTSTQFSLSASQSSERSNGSTSSLKRLTFQGLDLQT---------------------
G0V6X7_NAUCC          FQGSQSSILTQSTQRP-TVKRS-LSPTRTPSFQGLKLASAT-------------------
G0W9L4_NAUDC          SQSTQTSILSQSTQVQRSSKRS-ISPTRTSSFQGLKLSA---------------------
H2AVD6_KAZAF          --QIDTTDLVDTKPTK-----------RIGSFQDLKIHT---------------------
J7S460_KAZNA          NVPATSTQLSQPMVSL---------PEKRPLSGGLNLSN---------------------
J8PMR0_SACAR          --NIGDSGAGLPADLERPAKR----SKPSMEFQGLKLTV---------------------
J6EEG6_SACK1          --NIGGSSGESSVDLERPAKR----SKPSMEFQGLKLTV---------------------
A6ZST7_YEAS7          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
H0GH54_SACCK          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
B3LSF2_YEAS1          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
C8ZAA0_YEAS8          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
RRM3_YEAST            --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
N1P392_YEASC          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
G2WFA3_YEASK          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
C7GTU9_YEAS2          --NIEDSSMKLSTDSERPAKR----SKPSMEFQGLKLTV---------------------
G8ZVF0_TORDC          --EILK---------ERPAKR----GSP-QSFQGLRLTG---------------------
Q6FPW0_CANGA          ----DTSAMRQHNNLINTNND-------LANFSGLKFRK---------------------
C5E0W3_ZYGRC          -------------------------AETKSSLPGFKVTA---------------------
I2H165_TETBL          ----------SSTSNT---------PSLSSTFPNISLSI---------------------
K0KZ61_WICCF          ------GAKSTNATVSSNSRTSSRTPAKSAPKTSLSTSPGSSKSSQTTLNFGGKQLQPKR
W1QFA7_OGAPD          ------VSTRQDVSIGRSIKLPVRKPVSASRQRSLPWS---------NLNM---------
C4R014_KOMPG          ------KKIRIQKQENSVLDKQYGAPLKAASDQRKLPWEV--------------------
Q6BNW6_DEBHA          ------SPTSHIKTQKNETQKTGNPPLKRGHQDLLERLN---------------------
G8YJN4_PICSO          ---------------RSNDAANGPPKPAARSLSLLDSLN---------------------
C4Y757_CLAL4          ---------------RKNHGISGSSQEKRQFSRTFFDLD---------------------
H8WVI4_CANO9          ------KSN----------------SLKRSNSDILSTFD---------------------
G8BBJ1_CANPC          ------GKD----------------NLKRTNSDILSTFE---------------------
A5DRR3_LODEL          ------NNNSILNENEFLLNKREVPSLKRSSTDLLESIDV--------------------
A0A1D8PRM6_CANAL      --------------------------------DVLEVYQ---------------------
C4YNB1_CANAW          --------------------------------DVLEVYQ---------------------
B9WKK1_CANDC          --------------------------------DFLDAHQ---------------------
                                                                                  

Q756M1_ASHGO          ------------RRLKPVATH---RVAPARSPS---VSSA-------VVLSKEQEAVRDI
G8JWH4_ERECY          ------------RRLKMFHKK---QSSSTSNSSEQ-KRGA-------LKLTKEQVMVMDL
C5DM92_LACTC          ------------KKIKSSRAG---PSTSQSLTKASGSNPQ-------LDLTKEQRQVIDL
Q6CQY1_KLULA          ------------KRVKPIPRQSIVSHTSSKSSKSSSINGR-------IELTAEQRKVIEY
A7TJ00_VANPO          ------------KRIKPIKRE---KSILGGSVT-SARKPTTS----LVQLTKEQETVVEY
G8BSI5_TETPH          ------------KRIKPIKRH---KSSLSSSQNKNNLNNIFS----ELKLTKEQQHVIDL
G0V6X7_NAUCC          -----------SKRIKPITRK---NSSLASSSSSSFKNNSSLSS---IKLTKEQETVVDL
G0W9L4_NAUDC          -----------PKRIKPIVRQ---KSSLSSTAYGRLTQE--------FKLTKEQELVIDL
H2AVD6_KAZAF          -----------SKRIKPIQRT---TSNLKSN---KVTIQ--------LKLTKEQETVVDL
J7S460_KAZNA          -----------AKRLKPITNN---RGGAKHANGTSGSLQGAKNDQPMVRLTREQEYVVEL
J8PMR0_SACAR          -----------PKRIKPLLRK---TASNLESMNHRNAFLS------PVVLTKEQEMVVNL
J6EEG6_SACK1          -----------PKRIKPLLRK---TASNLESMNYRNALSS------PVVLTREQETVVDL
A6ZST7_YEAS7          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
H0GH54_SACCK          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
B3LSF2_YEAS1          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
C8ZAA0_YEAS8          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
RRM3_YEAST            -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
N1P392_YEASC          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
G2WFA3_YEASK          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
C7GTU9_YEAS2          -----------PKKIKPLLRK---TVSNMDSMNHRSA-SS------PVVLTMEQERVVNL
G8ZVF0_TORDC          -----------PKRIKPLSRK---SSSLAKEQE-------------IIRLTKEQEAVMEM
Q6FPW0_CANGA          --------------LKAPNQN---SNKKSTSSPYGKP---------LISLTKEQQTVVDY
C5E0W3_ZYGRC          -----------TKRLRTSRKP---TGVQSSSFGQFTP----------MALTKEQEQVVNL
I2H165_TETBL          -----------NKKLKSSPRK---LTASSSSNKHNSDSYY------EIKLSKQQQDVVNC
K0KZ61_WICCF          RMNPWDSAVIITKKMKNPRTAKEEALKQQKSSSNSYSYSNP-----KFSPSPEQQKVLDL
W1QFA7_OGAPD          ------------KKISNPRNQNKPSSQNGNSVSGSLSE--------------EQRKVIEM
C4R014_KOMPG          -----------PQFSWSRKKDASSGIKNPRMASKAIPTIAS-----KISLTKEQEKVLSL
Q6BNW6_DEBHA          ------------GQPRKVPR-----NFKLTSPSFTSLQHTS-----SIPLSEEQLKVIKY
G8YJN4_PICSO          ------------GYSRKIPK-----IEKHETPTRNSRRPTS-----NFLLNKEQLAVLKY
C4Y757_CLAL4          ------------ARPKKVPR-----RVPKAASPSLS---TS-----SVSLSVEQLAIIDA
H8WVI4_CANO9          -----------GGQAKKIAR-----STSNTAPVIL---HTE-----GTQLSAEQKEVIES
G8BBJ1_CANPC          -----------GGQAKKVAK-----LTNFKSPTIS---QTE-----GTQLSTEQKSVIDS
A5DRR3_LODEL          -----------GGQARKLPK-----YKSRTVTNLLS-RNTR-----DTILSEEQLEVIES
A0A1D8PRM6_CANAL      --------------PRKLTK-----VEPTKEVAPQ-----------EICLSPEQQMVVDT
C4YNB1_CANAW          --------------PRKLTK-----VEPTKEVAPQ-----------EICLSPEQQMVVDT
B9WKK1_CANDC          --------------PKKLTK-----KEP--EEVVT-----------EIFLSAEQQRVVDI
                                                                          :*  : . 

Q756M1_ASHGO          IVHDRLNVFYTGSAGTGKSVLLRELIRTLRAKYGTVAVAVTASTGLAAVNIGGMTVNRFS
G8JWH4_ERECY          ILKERLNVFYTGSAGTGKSILLRELVKALRAKYGASAVAVTASTGLAAVSIGGTTVNRFS
C5DM92_LACTC          IVSQRKNVFYTGSAGTGKSIVLRELVRQLRARYGDAAVAVTASTGLAAVNIGGMTVNRFS
Q6CQY1_KLULA          VCKDRLNVFYTGSAGTGKSVILRTMISTLNAKYGKDAVAVTASTGLAAVNIGGITINKFS
A7TJ00_VANPO          IVRRRMNVFYTGSAGTGKSIILRNVIERLTQLYGKEYVAITASTGLAATTIGGVTLHRWA
G8BSI5_TETPH          IIRKKFSVFYSGSAGTGKSIILRTIIGRLNGLYGKDTIAVTASTGLAASTIGGVTLHRWA
G0V6X7_NAUCC          IVKRRLNVFYTGSAGTGKSVILKTIIRQLRMLYGKEEVAITASTGLAATTIGGSTLHKWA
G0W9L4_NAUDC          IIRKRLNVFYTGSAGTGKSVILKTIISKLGSIHGKEAIAITASTGLAATTIGGTTLHKWA
H2AVD6_KAZAF          IVNKRLNVFYTGSAGTGKSVILQNIIEKLRSMYGKEAVAITASTGLAAATIGGVTLHKWS
J7S460_KAZNA          IVKRRMNVFYTGSAGTGKSVILRNIVSKLSKLYGEECVAVTASTGLAAATIGGVTLHKWS
J8PMR0_SACAR          IIKKRTNIFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
J6EEG6_SACK1          IIKKRANVFYTGSAGTGKSVILQTIIRQLSSLYGKETIAITASTGLAAVTIGGSTLHKWS
A6ZST7_YEAS7          IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
H0GH54_SACCK          IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
B3LSF2_YEAS1          IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
C8ZAA0_YEAS8          IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
RRM3_YEAST            IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
N1P392_YEASC          IVKKRTNVFYIGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
G2WFA3_YEASK          IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
C7GTU9_YEAS2          IVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWS
G8ZVF0_TORDC          VLRKRLNIFYTGCAGTGKSVILKTLISKLGGLYGKEAIAVTGSTGLAAATIAGTTLHKWS
Q6FPW0_CANGA          VVKKNMNVFYTGSAGTGKSVILRTIIDKLSSMYGKESIAITASTGLAANTIGGSTLHKWS
C5E0W3_ZYGRC          VVNNRLNVFYTGSAGTGKSVILRTLIDRLSSVYGREAVAVTASTGLAAATIGGTTFHRWS
I2H165_TETBL          VIKKRQNVFYTGAAGTGKSIILRTIISKLHGLYGKDAIAVTASTGLAANNIGGCTLHKWA
K0KZ61_WICCF          VVDEKKSIFYTGSAGTGKSVLLKELVARLIRRYGPNAVAVTASTGLAAVNIGGVTINKFS
W1QFA7_OGAPD          VLYERKNIFYTGSAGTGKSFLLREIIKRLRNRYGSSSIAVTASTGLAATNIEGTTINRFA
C4R014_KOMPG          VVDDGLNIFYTGSAGTGKSVVLRELVQRLNNLYGPDKVGVTASTGLAAVNIGGQTINRWA
Q6BNW6_DEBHA          IVSDGLNVFYTGSAGTGKSIVLRELVSSLHSKYGASRVGVTASTGLAACNIGGQTIHRFL
G8YJN4_PICSO          VES-GYNVFYTGSAGTGKSIVLKEIVKLLHSVYGTYRVGITASTGLAACNIGGQTIHRFL
C4Y757_CLAL4          VVSRGENVFFTGSAGTGKSVVLREMVSRLYAKHGASHVGVTASTGLAACNIGGSTVHKFL
H8WVI4_CANO9          VLAGR-NVFYTGSAGTGKSVVLRELVRILKGKYGDN-MGVTAPTGMAACNIQGQTIYKFL
G8BBJ1_CANPC          VLAGC-NVFYTGSAGTGKSVVLRELVRILKSKYGDN-MGVTAPTGMAACNIQGQTIFKFL
A5DRR3_LODEL          VVKRRQNVFYTGSAGTGKSVVLRQLVQELRAKYREN-VGVTAPTGLAACNIQGQTIFRFL
A0A1D8PRM6_CANAL      VVHAKESIFFTGSAGTGKSVVLKEMVKACKGVYGDN-FGVTASTGLAACNIQGQTVHRYL
C4YNB1_CANAW          VVHAKESIFFTGSAGTGKSVVLKEMVKVCKGVYGDN-FGVTASTGLAACNIQGQTVHRYL
B9WKK1_CANDC          VVQKKESIFFTGSAGTGKSVVLKEIVKACRGVYGDN-FGVTASTGMAACNIQGQTLHRYL
                      :     .:*: *.******.:*: ::      :    ..:*..**:** .* * *. :: 

Q756M1_ASHGO          GIGIGSGSLEALAARAKKKREVYERWKRTRVLIIDEVSMVDARFLDKLDYVARQLRGKPD
G8JWH4_ERECY          GIGIGAGVLDKLVERAKKKKEVFERWKRTRVLIIDEISMIDGRFLDKLDYVARSLRKNAD
C5DM92_LACTC          GINIGIGSVQKLAAQVKRNKTNSERWKRTSVLIIDEVSMIDGRFLDKMDFVARDVRRVHD
Q6CQY1_KLULA          GVGIGQGDANRLINMVKRNKTSLNRWKRTKVLIVDEISMIDGYFLDKLDAIGRGLL-NRT
A7TJ00_VANPO          GIGIGTGAIDRILSRIQRKFDLLASWRNTRVLIIDEISMIDGKFLDKLEELARRIR-KNN
G8BSI5_TETPH          GIGLGGGSLDSLVNKIQKNHELNASWKNTRVLIVDEISMVDGKFLDRLEEIARRVR-KIN
G0V6X7_NAUCC          GVGLATQHADMLVNRIKNKKDVYNVWRNTRVLIIDEISMVDGLFLNKLEYIARVIR-RSD
G0W9L4_NAUDC          GVGLGDRSADQLANSIQRRKDVLNSWKNTRVLIIDEISMIDGLFLTKLETVARTVR-RSN
H2AVD6_KAZAF          YAGIGNRPPDVTVKKIQRLKEALAVWKNTKVLIIDEISMIDGKFLNMLEYIARAVR-KND
J7S460_KAZNA          SIGIGNRPLDVYVKKLTRQRESLMVWRKTKVLIVDEVSMIDGNFLTKLEFIARALR-RNE
J8PMR0_SACAR          GIGIGNKTIDQLVKRIQSQKDLLAAWRYTKVLIIDEISMIDGNLLDKLEQIARRIR-KTD
J6EEG6_SACK1          GIGIGTKTIDQLVKRILSQKDLLAAWRYTKVLIIDEISMIDGNLLDKLEQIARRIR-KND
A6ZST7_YEAS7          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
H0GH54_SACCK          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
B3LSF2_YEAS1          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
C8ZAA0_YEAS8          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
RRM3_YEAST            GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
N1P392_YEASC          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
G2WFA3_YEASK          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
C7GTU9_YEAS2          GIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIR-KND
G8ZVF0_TORDC          GVGIGNGTAEQLVKKVEKQRNMLAIWRNTRVLIIDEVSMIDGHFLDKLEYIARRLR-KND
Q6FPW0_CANGA          SCGIGNKSVDHLVRQIRRYHDQYAIWRHTKVLIIDEISMLDGHYLDKLEAVAKQLR-NND
C5E0W3_ZYGRC          GIGLGNQSVDYLVKHIKKQRQIFSVWRFTKALIIDEISMLDGRMLDKIEEVARRVR-QND
I2H165_TETBL          GIGLGKATAEKCIQSLSKKYDTLALWRRTRVLIIDEVSMIDGDFLDKLDVIAQHLR-NSK
K0KZ61_WICCF          GMGIGAGDQRTVAARVSKNSQSVERWKRTKVLIIDEISMIDGSFLDKLEYTARYVT-KKP
W1QFA7_OGAPD          GTGLGSEPVNKLVSRIKSRRSIVERWKGTKVLIIDELSMIDSIFFDKLNEIAKQIR-GSN
C4R014_KOMPG          GIGIGKQTPVALAGLIKKNGNTYARWRNVKVLIMDEVSMIDGVLFSKLNEVAQIVR-KNQ
Q6BNW6_DEBHA          SIGLGTGSAFELSKRIKKNPANLKKWKNLKVLIIDEISMIDGKLFTKLDELAKIIR-SSQ
G8YJN4_PICSO          SIGLGTGSPMELSSRIKKNPMNLKKWKALKVLVIDEISMIDGRLFTKLEELARILR-GNN
C4Y757_CLAL4          HIGIGTGSPQEIAVKIKRNGSARKKWTSLAVLIIDEISMIDGILFEKIDKIAQILR-NST
H8WVI4_CANO9          EIGLAMKSAPELANMIRKNHHKLNKWIRLRVLIIDEISMIDGALFDKLEHVARLVR-KSD
G8BBJ1_CANPC          EIGLAFKSAPDLANMIRKNHHKLSKWTRLRVLIIDEVSMIDGALFDKLENVARLVR-KSD
A5DRR3_LODEL          EIGLGKDPVDILVTRIRKNQQKFRKWQLLKVLIIDEISMVNGDLFDKLEEIARKVR-QSP
A0A1D8PRM6_CANAL      GIGFGRDPVDKLAAKVRKNVMLLRKWQQMRLLIIDEISMIDAGLFDKIEEVARIVR-NNE
C4YNB1_CANAW          GIGFGRDPVDKLAAKVRKNVMLLRKWQQMRLLIIDEISMIDAELFDKIEEVARIVR-NNE
B9WKK1_CANDC          GIGLGRDPVDKLAKRINKNSVVLRRWQQMRLLIIDEISMIDAALFDKIEAVARVVR-KSD
                        .:.                    *     *::**:**::.  :  ::  .: :     

Q756M1_ASHGO          AVFGGIQLVFTGDFFQLPPVTDRS--AGNEGPLFCFESRAWQQGIQKTLCLSQVFRQQDT
G8JWH4_ERECY          VPFGGIQLVFTGDFFQLPPVSDRN--PNSPKPLFCFESKAWQQGIQKTICLQRIFRQKDN
C5DM92_LACTC          KPFGGIQLVMTGDFFQLPPVADRD--RSVPKPPFCFESKVWRQAIDKTICLTQVFRQKDQ
Q6CQY1_KLULA          KPFGGIQLVFTGDFFQLPPVPDRD--SNKAGPIFCFESNVWKYAIHKTILLQQVFRQTDN
A7TJ00_VANPO          KPFGGIQLVLTGDFFQLPPVPKRE---INELSQFCFESKMWPTCIQKTILLTKVFRQQDN
G8BSI5_TETPH          RPFGGIQLVLTGDFFQLPPVSKKE---YNEPPLFCFESNMWKLCVQKTILLTKVFRQQDN
G0V6X7_NAUCC          KPFGGIQLVFTGDFFQLPPVAKRD---AKEVTMFCFESSMWKRCIQKTLLLNKVFRQQDG
G0W9L4_NAUDC          RPFGGIQLVLTGDFFQLPPIQKRD---SPVLSQFCFESKMWSQCIQRTILLTKVFRQQDN
H2AVD6_KAZAF          KPFGGIQLVLTGDFFQLPPVQKKD---DVKASIFCFESEMWKRCIHKTILLTKVFRQHDS
J7S460_KAZNA          RPFGGIQLVFTGDFFQLPPVTKRD---AQVVSQFCFETEAWRRCIEKTILLKKVFRQQDD
J8PMR0_SACAR          DPFGGIQLVLTGDFFQLPPVVKKD---EDKVVKFCFESDMWKRCVQKTILLTKVFRQQDN
J6EEG6_SACK1          DPFGGIQLVLTGDFFQLPPVAKKD---ENNVVKFCFESNMWKRCVQKTILLTKVFRQQDN
A6ZST7_YEAS7          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIQKTILLTKVFRQQDN
H0GH54_SACCK          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIQKTILLTKVFRQQDN
B3LSF2_YEAS1          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIKKTILLTKVFRQQDN
C8ZAA0_YEAS8          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIKKTILLTKVFRQQDN
RRM3_YEAST            DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIQKTILLTKVFRQQDN
N1P392_YEASC          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIQKTILLTKVFRQQDN
G2WFA3_YEASK          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIQKTILLTKVFRQQDN
C7GTU9_YEAS2          DPFGGIQLVLTGDFFQLPPVAKKD---EHNVVKFCFESEMWKRCIQKTILLTKVFRQQDN
G8ZVF0_TORDC          KPFGGIQLVLTGDFFQLPPVQKRDS-PKNDMAVFCFESQMWKTCIHRTILLTKVFRQQDN
Q6FPW0_CANGA          RPFGGIQLVLTGDFFQLPPVSKKD---DDKNVVFCFDSKMWKKCIQKTILLTKVFRQQDN
C5E0W3_ZYGRC          QPFGGIQLVLTGDFFQLPPVSKDG-------IVFSFESQMWKNCIQKTILLTKVFRQRDD
I2H165_TETBL          QPFGGIQLVLTGDFFQLPPVNKNR--AENSKTAFCFQSRMWKNCIERTILLTEVFRQRDD
K0KZ61_WICCF          QPFGGIQVVLTGDFFQLPPVPDRNGPP----PRFCFQAECWSKCINQTILLVQVFRQK-E
W1QFA7_OGAPD          KPFGGIQLVLTGDFFQLPPVSLSKMGA----AKFCFDAVSWKECIDETILLTKVFRQQND
C4R014_KOMPG          LPFGGIQVVLTGDFFQLPPVPDKDTK-----MTYCFQSECWDSVINKTILLKQVFRQT-D
Q6BNW6_DEBHA          LPFGGIQVICTGDFFQLPPVNKDGS------SEFCFQSAAWDKVIQKTILLTRVFRQKGD
G8YJN4_PICSO          LPFGGIQVICTGDFFQLPPVMSDSQ------CQYCFQSSQWDRVIQKVVLLKQVFRQKGD
C4Y757_CLAL4          APFGGIQLVCTGDFFQLPPVSKNQS------ARFCFLSDSWRKAIRNTFILTTVFRQKGD
H8WVI4_CANO9          KPFGGIQIVCTGDFYQLPPVAVNRS------ALFCFQSKSWSKVINKNIVLKQIFRQKGD
G8BBJ1_CANPC          KPFGGIQIVCTGDFYQLPPVAVNRT------AQFCFQSKSWSKVINKNIVLKQIFRQKGD
A5DRR3_LODEL          RPFGGIQIVCTGDFFQLPPVGNRQNP-----AKFCFQSKAWSKVIERTIVLKTVFRQQGD
A0A1D8PRM6_CANAL      KPFGGIQIVACGDFYQLPPVNKDGK------ARFCFEGKSWHKVIKKSIVLKQVFRQKGD
C4YNB1_CANAW          KPFGGIQIVACGDFYQLPPVNKDGK------ARFCFEGKSWHKVIKKSIVLKQVFRQKGD
B9WKK1_CANDC          RPFGGIQVVACGDFYQLPPVNKEGR------PKFCFEGNSWGRVIKRAIVLKQVFRQRGD
                        *****::  ***:****:             :.*    *   : . . *  :***   

Q756M1_ASHGO          -ELVDLLNAIRFGEVTPQVAAQMRQFEREVVYGDGIEPTELFPTRREVEQANRRRLERLP
G8JWH4_ERECY          -DLIDLLNAIRFGEVTPQLTALVRTFEREVHYPDGIEPTELFPTRKEVDTANKRRLERLP
C5DM92_LACTC          -ELVDLLNSIRFGVINTKVAQQIRSFEREVNYSDGIMPTELYPTRREVEMSNKRMLDRLP
Q6CQY1_KLULA          -ELIDLLNGIRMGNTSGDTIKLIKKFEAPVEYDDGIEPTELYPTRREVELSNKRRLERLP
A7TJ00_VANPO          -ELIEILNSIRFGEIQPAMVKTIRSLNREINYEDGIRPTELYATRREVEASNSRQLQSLP
G8BSI5_TETPH          -ELVDILNKIRFGEIEDHMVQRLRSLRNEKRYSDGIKPTELYATRREVESSNSRQLDLLL
G0V6X7_NAUCC          -DLVSILNSIRFGEVNDEMIRTIRKLSREVKYDDGIDPTELYATRREVEQSNIRQLRNLP
G0W9L4_NAUDC          -ELVDILNSIRFGEIDQTMAAQVYNLKRKVNYDDGIAPTELYATRREVEISNSRQLKELP
H2AVD6_KAZAF          -ELIDILNSIRFGELQPHMISTVKNLQREVDYSDGIYPTELYATRREVELSNSRQLGLLP
J7S460_KAZNA          -ELIDILNSIRFGEIEKDMTRAIRSLEREVKYEDGIMPTEIYATRREVESSNARQLHNLP
J8PMR0_SACAR          -ELIDILNAIRFGELTVDMTKTIRNLNRDIGYPDGIAPTELYATRREVESSNVRKLQSLP
J6EEG6_SACK1          -ELINILNAIRFGELTVDMTKTIRNLSRDIDYPDGIAPTELYATRREVELSNVRKLQSLP
A6ZST7_YEAS7          -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
H0GH54_SACCK          -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
B3LSF2_YEAS1          -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
C8ZAA0_YEAS8          -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
RRM3_YEAST            -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
N1P392_YEASC          -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
G2WFA3_YEASK          -KLIDVLNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
C7GTU9_YEAS2          -KLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLP
G8ZVF0_TORDC          -ELIDMLNAIRFGEVTPQLTQTIRQLSRTITYSDGIAPTELYATRREVESSNARQLSSLP
Q6FPW0_CANGA          -ELVDILNAIRYGELQNDMIKRIKSLGRDVYYPDGISPTELFPTRREVDISNSRQLEALP
C5E0W3_ZYGRC          -NLVDMLNAIRYGEPTPELVGNIAKLRREVRYSDGIEPTELYATRKEVELSNGRQLQTLP
I2H165_TETBL          DELVSILNSIRLGEINPKMSSVLKSLERNIAYPDGISPTELYPTRREVDLSNSRQLNQLP
K0KZ61_WICCF          NEFVELLNCLRLGEVSDKMSTLFKSLSREITYEDGIQPTELFCTRYEVDQANTKRLQKLP
W1QFA7_OGAPD          SDLIEMLNALRIGKLSDDLKRKFKRLERPLQYNDGIYPTELYPTREEVDRANLERLNSLP
C4R014_KOMPG          MDLIDMLNALREGHVYPEIIQQFSKLGKEVVYTDGIEPTELYATRNEVEAANKSRLAKLE
Q6BNW6_DEBHA          TELIDMLNALRYGSMNDDMIAKFYKLSRNVVYDDGLEPTELFPTRDEVKRANQTRLSQIP
G8YJN4_PICSO          NELIDMLNALRHGEMDDTMIEKFYKLSRKVKYEDGLEPTELYPTRDEVKRANQHRLQQIK
C4Y757_CLAL4          SELIEMLNSLRKGKLDDAMVAKFRQLGRKVVYDDNIEPTELYPTRQEVKAANQQRLRFLP
H8WVI4_CANO9          NDLIEMLNALRTGELTNEIVAKFKSLARMVNYTDGIEPTQLFPTRREVSEANSLRLEKLS
G8BBJ1_CANPC          HDLIEMLNALRTGELGDAIVAKFKDLSRTVHYDDGIEPTQLFPTRKEVHSANSDRLKKLS
A5DRR3_LODEL          TELIDMLNALRLGNLTQDIVTKFQALKRDLVYDDGIEATELFPLREEVCRANEWRLKNLP
A0A1D8PRM6_CANAL      TEFIDMLNALRLGNLNAAVLEKFATLQREIHYEDKLEPTELFPTLNEVRQANSSRLARLP
C4YNB1_CANAW          TEFIDMLNALRLGNLNAAVLEKFATLQREIHYEDKLEPTELFPTLNEVRQANSSRLARLP
B9WKK1_CANDC          SEFIDMLNALRVGKMDAAAIAGFACLQREIDYPDKLEPTELFPTVNEVRMANQSRLQRLP
                       .::.:** :* *         .  :     * * : .*:::    **  :*   *  : 

Q756M1_ASHGO          GFGMTFEAYDSGNVGG---RFSSYFDAVMAERTLALKEGAQVMMLKNK--DDQ-LVNGSV
G8JWH4_ERECY          GFEVTYEALDSGDVEK---KFSSYFDAIIAERTLVLKENTQVMMLKNK--DDT-LVNGTV
C5DM92_LACTC          GDVKVFHAQDQATSDNP--YLLKILDSLMVEKNIALKEDAQVMMIKNM--DET-LVNGSV
Q6CQY1_KLULA          GYEILYKAVDFIPPNI----NSNILNNVMAEKEIKLKEDAQVMMLKNI--DDT-LVNGSL
A7TJ00_VANPO          GKLYEFVSIDVAPKEY----MDLLDSSVMVEKVITLKEDAQVMMLRNK--PESELVNGSL
G8BSI5_TETPH          GEKHEYVADDTGPKEL----HNLIDSSVMVERKITLKENAQVMMLKNK--VESELVNGSL
G0V6X7_NAUCC          GKKYLFNSIDIGAPEH----LKLLDSSLMVEKQIILKEDAQIMMLRNK--PEVDLVNGSL
G0W9L4_NAUDC          GIERRYESDDAGTPEL----IKLLDSSLMVEKIITLKEDAQVMMLKNK--PEVNLVNGSL
H2AVD6_KAZAF          GDLHQFESVDLARKDQ----IQLLDSSVMAERVVTLKENAQVMMLKNK--PEVDLFNGSL
J7S460_KAZNA          GSTYKYDAEDVAPREM----MPMLDSVVMAEKVLVLKEDAQVMMLKNR--PDVDLVNGTL
J8PMR0_SACAR          GDLYEFKAVDNAPERY----QALLDSSLMVDKVVALKEDAQVMMLKNR--PDVELVNGSL
J6EEG6_SACK1          GDLYEFKAVDNAPERY----QALLESSLMVDKIVALKEDAQVMMLKNR--PDVELVNGSL
A6ZST7_YEAS7          GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
H0GH54_SACCK          GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
B3LSF2_YEAS1          GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
C8ZAA0_YEAS8          GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
RRM3_YEAST            GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
N1P392_YEASC          GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
G2WFA3_YEASK          GDLYEFKAVDNAPERY----QAILDSSLMVEKVVALKEDAQVMMLKNK--PDVELVNGSL
C7GTU9_YEAS2          GDLYEFKAVDNAPERY----QAILDSSLMVEKFVALKEDAQVMMLKNK--PDVELVNGSL
G8ZVF0_TORDC          GEAYEYHSIDAAPKEY----MALLDSSVMVEKLVTLKVDAQVMMLKNK--PESELFNGSL
Q6FPW0_CANGA          GEAKIYESVDVAPPSY----QNMLDNSVMAEKKLTLKEDAQVMMLKNK--PESELFNGTL
C5E0W3_ZYGRC          GEPRVFKSLDVGPTEL----LPLLDSITRVDKILTLKVDAQVMMIRNK--PESELVNGTL
I2H165_TETBL          GKLYTYKSSDLVQSHM----KDMLNASVLAEENVYLKDNAQVMMLKNK--PESELVNGSL
K0KZ61_WICCF          GKYQEFEAID----SGN-EFQRKALDNLMAVKKLVLKEDAQVMMIKN--K-DDTLVNGSV
W1QFA7_OGAPD          GRVYTFQSRDNFPPNGNPAMFIKQLDGLMCAKTLQLKEGAQIMYLKNDLE-DPQLVNGSI
C4R014_KOMPG          GPLVTYTAKDVSDRPDTPPYIMKLLNDVMAPSGLQLKEGCQVMMLKNK---DEELVNGTL
Q6BNW6_DEBHA          SRPLRFKAEDNISD----VNHIKMLDNLMCEKELELKEGAQVMYLKNL---DDQIVNGSI
G8YJN4_PICSO          SKSFKFMAEDNVKD----SYLSKMLDNLMCEKELELKEGAQVMYLKNL---DEQIVNGSI
C4Y757_CLAL4          GQSNIYKAQDSEKD----QFKRKLYDNLMCEEILELKKGAQVMYLKNH--PDNLVVNGSI
H8WVI4_CANO9          SKAYKYTAQDSHKG----EQYKAQYAQLLCDESLVLKEGAQVMNIKNI---NDDLVNGTL
G8BBJ1_CANPC          SKAYEFMAKDSHKG----EHVKKQYDQLLCEETLVLKEGAQVMNIKNI---NDHLVNGTL
A5DRR3_LODEL          SDAITFVATDNNASN---EASRALLDQLMCEKVITLKEGAQVMNIKNV---DEELVNGSL
A0A1D8PRM6_CANAL      GKERVFVATDRGDP-----RQHKMLDNLMCEKVLRLKEGAQVMNIVNY---SEDIVNGSL
C4YNB1_CANAW          GKERVFVATDRGDP-----RQHKMLDNLMCEKVLRLKEGAQVMNIVNY---SEDIVNGSL
B9WKK1_CANDC          GKDFKFVARDRGDP-----KQHHLLDYLMCDKVLRLKEGAQVMNIVNY---SDSIVNGTL
                      .    : : *                       : ** . *:* : *    .  :.**::

Q756M1_ASHGO          GRVLFFTTAALWG-RVEREHMHAL--EDPEFVLDMRLVCQAIGISESARSPELLQAIAAR
G8JWH4_ERECY          GRVLFFTTANLWN-FIQRDHINML--DNAEFVMDMKLVCKAIGVPENCRPLQLQQEINSR
C5DM92_LACTC          GKLLFFTTELLHQKMLELFPATKL--SDPDLVLDMRLVSRCIGVASQNYPPDIKAAINQR
Q6CQY1_KLULA          GRVLFFCTSALFL--EASKIFPDL--SDPEVVQDMRCVCRAIGVPPSGRSSDLQRDINLR
A7TJ00_VANPO          GKVLFFIPQKLEKKMNDLYRY-----MDEEAIRDMRLVSKVIGKPVYRESNEFKNELNQR
G8BSI5_TETPH          GIVLFFIPQTLEKKMNEIYRI-----MDEEAINDMKLVSKVVGNPRARLSKEFQEELNMR
G0V6X7_NAUCC          GKVLFFTTEKLLLKMKELYGS-----IDDELVADMRLISQVIGNRRAIEDKTFRQDLQCR
G0W9L4_NAUDC          GKVLFFTTERLYRKMMELYRG-----VDDDVIIDMKMVSRAIGERTILDNKQFSQDVASR
H2AVD6_KAZAF          GKVLFFTTERLHRKMLELFKV-----IDDNVIADMRLVSQVIANPLRRQSKEFIQDFNAR
J7S460_KAZNA          GKVLFFTTERLSRKFIEMFKT-----IDEDTVLDMRIVSQAIAKRQIHESQGFQQALQQR
J8PMR0_SACAR          GKVLFFVTESLVVKMKEIYKI-----IDDDVVMDMRLVSRVIGNPLLKESKEFRQDVNAR
J6EEG6_SACK1          GKVLFFITESLVIRMKEIYKI-----IDDEVVMDMRLVSRVIGNPLLKESKEFRQDVNAR
A6ZST7_YEAS7          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
H0GH54_SACCK          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
B3LSF2_YEAS1          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
C8ZAA0_YEAS8          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
RRM3_YEAST            GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
N1P392_YEASC          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
G2WFA3_YEASK          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
C7GTU9_YEAS2          GKVLFFVTESLVVKMKEIYKI-----VDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNAR
G8ZVF0_TORDC          GKVLFFITERLERVMKEHYSV-----TEDDVILDMRLVSRAIGKPLIMDSQEFLQDFYAR
Q6FPW0_CANGA          GRVLFFSTEKLIRRMKELYGSSP---LDEDLITDMRLVSRVIARPDIASSERFMKEVNMR
C5E0W3_ZYGRC          GKVLFFTTERLERAMKKFYQT-----VDDELVQDMRLVSEAIANHTVHQNVEFHHAFQSR
I2H165_TETBL          GKVLFFSTERLIKKMIELYGFY----FDDEIVNDMRLVSNCIENPSFVNSDVYANGFKNR
K0KZ61_WICCF          GIVVTFFTAMLYGQFRSFYKDYE--LVDDSTMKQAKYISSCIAADT-IPEDVLQFASRLP
W1QFA7_OGAPD          GKIVCFCSIALWTLFTNTFKEYERPMHTDLLVMASRFTGNEPTAQD-EALYNEFLATNYN
C4R014_KOMPG          GKVQCFMTSDMWHYIQTQLTTVDLLQ--EDVIKELNLVSKFMNNP--QPDESLFRQLDTV
Q6BNW6_DEBHA          GTVTCFMSSKLWEKVNDVY-KGNLYDIDDQIADELRLLSSRVGCVA-NWSPEETEKYDRI
G8YJN4_PICSO          GTVMFFMTGKLWEKVNDIY-KLYLLDNDEQVIEEIRLLSHRVGSSE-SWSGEEQKVLDRI
C4Y757_CLAL4          GTVVGFITENLFKTLFDVLGEQTFCNMSEEYQQLLTLLCDLIGN-R-SMTSDQTRVFNNL
H8WVI4_CANO9          GTVLFFSTQRLFLKILEIYSPLEAMD--AQMLKEVKFVTSRVGSVK-EWKDDERMLFQQV
G8BBJ1_CANPC          GTVMFFTTLKLYLKILDIYGAIEAMD--SQMLKEVKFITSRIGSVK-SWTDDDRLVFQQV
A5DRR3_LODEL          GTVLFFVTPNLYVKILTTYDEIDVND--EQLMSELRLLRHRVGSTE-EWSEKHKRVVENV
A0A1D8PRM6_CANAL      GVVLFFATRELYYKFIQHYGPINAND--EDAIKEMRFICHRIDES--EYTAEEKEYYEGL
C4YNB1_CANAW          GVVLFFATRELYYKFIQHYGPINAND--EDAIKEMRFICHRIDES--EYTAEEKEYYEGL
B9WKK1_CANDC          GTVLFFVTRRLYYKFIQQYGGIDASD--AESIKEMRFICHRIGET--EYSNEEKEYFEGL
                      * :  * .  :                                                 

Q756M1_ASHGO          PALRRPHLQEFLSRAPHEPRD------GLLPVVRFVV---AGRARFELVQREEFPVEVPA
G8JWH4_ERECY          PILTKSYLHQYLTLAQRESSD------LLYPLVRFSV---SNKYRYELIQREEFLVDLPI
C5DM92_LACTC          PLHRTEQLSLLLKVAEREDKG------LAFPFIRFTTP--SNGFRYELILPAEFTIDVPA
Q6CQY1_KLULA          PTNRQEVLNFVLDKASKIVNGPGILSTIMFPVVKFIDKQDIRGYQIKLVEPEEFSVGETE
A7TJ00_VANPO          PMSRLERLETMINIAVT-ISEKE----PVFPLIRWTIT-TT-RFHHELMLPDNFVVDLPG
G8BSI5_TETPH          PFARMERLENILFYATTRVSPKD----IKFPYVKWTLP-LG-RFHHELMLPDNFVVDLPG
G0V6X7_NAUCC          PSNRLEILETMINYAIE-EDEKV----HVYPFVRWTIG-KN-KYYHDIVLQERFPVDIPG
G0W9L4_NAUDC          PRKRLPILQELINLAMT-ETRRE----EVLPFVRWSVG-QG-KVHHDIVLRDVFPVDVPG
H2AVD6_KAZAF          TLSRAEILEELVNVAIL-ESPVE----TAWPYVRWSTG-KN-RYYHELVLPDRFPVDIPG
J7S460_KAZNA          PLSRYQRLQTMINHAMN-ESPSE----RVYPFVRWSTG-KS-KRYHELVLPDVFAVDLPG
J8PMR0_SACAR          PLARLERLKILINHATK-ISPHK----EKFPYVRWTAG-KN-KYIHELMVPERFPIDIPR
J6EEG6_SACK1          PLVRLERLKILINHALK-ISPHK----ERFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
A6ZST7_YEAS7          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
H0GH54_SACCK          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
B3LSF2_YEAS1          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
C8ZAA0_YEAS8          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
RRM3_YEAST            PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
N1P392_YEASC          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
G2WFA3_YEASK          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
C7GTU9_YEAS2          PLARLERLKILINYAVK-ISPHK----EKFPYVRWTVG-KN-KYIHELMVPERFPIDIPR
G8ZVF0_TORDC          PLARQEVLQTMINHAKK-TSPKE----SVYPYVRWSLD-NNNRFHHELMLPERFPVDLPG
Q6FPW0_CANGA          PMERFHKLQTMINDAVT-TSIKE----QVFPYVKWSLN-HG-RYNYELMLPERFPVDIPG
C5E0W3_ZYGRC          PRTRQGPLQSLVAQATSTLVGQE----PIYPYVRYTIG-PN-RYHYELTLPEPFVVDIPA
I2H165_TETBL          PIIRHEKLSILTNFAVKTNTKLE----KIYPYVRWTIG-PN-KYHNELMMDEIFPVDVPG
K0KZ61_WICCF          NRSQFMQLCTSAQTQS---------RAMLLPLVKFSTVNG---SRLELVDREDFSLDNDG
W1QFA7_OGAPD          SPPQVELAKEMIRTAK---------NSKLSEVLPLVKFSH---SSLRLIEPVPFSTESN-
C4R014_KOMPG          SPHRKQIMDELITIAR-------TRSDEVLPLVQFAIGSRR--ARFELIQREEFPIDVKN
Q6BNW6_DEBHA          PNERKSNFTKLAAVAS------SELVSDLYPVVNFKTATG---NTLIRVTREDFSIEAGR
G8YJN4_PICSO          PHSRKANFTKLINLAA------VESTADLYPVVKFKTPIG---DSLIRVSREEFSIDAGK
C4Y757_CLAL4          PPDLHAKASRLIMEAYK-----QDPNEERMPLVSFLVDGY---PTVLYVRREEFTVDQGQ
H8WVI4_CANO9          PSERKTQFESLVQFAA------LESTENILPVVLFKLNGS---DEAVLVDKQEFPIEIGK
G8BBJ1_CANPC          PDERKTHFESLVQMAV------LETTANILPVVLFKLNGY---DEAVLVDRQEFTVETGH
A5DRR3_LODEL          PASRRSKFEALVQYAA------QDSKDRLLPVVNFNFNGR---YEAKIVPKHEFKLDESK
A0A1D8PRM6_CANAL      SNERKEWVQNATNVAV------RGTGVECFPVVNFKTRGS---DVVALVDKQDFKMEKAS
C4YNB1_CANAW          SNERKEWVQNATNVAV------RGTGVECFPVVNFKTRGS---DVVALVDKQDFKMEKAS
B9WKK1_CANDC          SNERKEWVQQATNIAM------QETTAECLPVINFSTHGP---DVVTMVERHDFKIERAN
                                                      :                    *      

Q756M1_ASHGO          GPHAAGDA-----SRLQVPLVPCWALSIHKAQGQTIPRLKVDLRRTFEAGQAYVALSRAV
G8JWH4_ERECY          NGHGVGEG-----SRHQIPLVPCWALSIHKAQGQTIDRLKVDLRRIFEAGQVYVALSRAV
C5DM92_LACTC          QKTSV--------SRTQLPLILCWALSIHKAQGQTIDRLKVDLKKVFEEGQVYVALSRAV
Q6CQY1_KLULA          KDSAV---------RKQLPLMLCWAISIHKSQGQTIDRLKVDLKRTFESGQVYVALSRAV
A7TJ00_VANPO          SNTGLQ--------RTQLPIMLCWALSIHKSQGQTIQRLKVDLSNIFEAGQVYVALSRAT
G8BSI5_TETPH          SHSALQ--------RSQIPIMLCWALSIHKSQGQTLQRLKVDLRNIFEAGQIYVALSRAI
G0V6X7_NAUCC          DKVGLE--------RSQLPIMLCWALSIHKSQGQTIQRLKVDLRNIFEAGQVYVALSRAV
G0W9L4_NAUDC          DKVGLQ--------RTQLPIMLCWALSIHKSQGQTIQRLKVDLKNIFEAGQVYVALSRAV
H2AVD6_KAZAF          DKTGIE--------RTQVPIMLCWALSIHKAQGQTIQRLKVDLKNIFEAGQVYVALSRAV
J7S460_KAZNA          NHTGLQ--------RTQLPVMLCWALSIHKAQGQTIPRLKVDLRNIFEAGQVYVALSRAV
J8PMR0_SACAR          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
J6EEG6_SACK1          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
A6ZST7_YEAS7          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
H0GH54_SACCK          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
B3LSF2_YEAS1          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
C8ZAA0_YEAS8          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
RRM3_YEAST            ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
N1P392_YEASC          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
G2WFA3_YEASK          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
C7GTU9_YEAS2          ENVGLE--------RTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
G8ZVF0_TORDC          AKTGLE--------RNQLPLMLCWALSIHKAQGQTIQRLKVDLRNIFEAGQVYVALSRAV
Q6FPW0_CANGA          DKLGLE--------RNQLPLMLCWALSIHKAQGQTIQRLRVDLKNIFESGQVYVALSRAI
C5E0W3_ZYGRC          EKTAIE--------RTQLPITLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAV
I2H165_TETBL          DNIGMQ--------RTQIPVMLCYALSIHKAQGQTIQRLKVDLKNIFEAGQVYVALSRAV
K0KZ61_WICCF          E---------TGASRSQLPLLLSWALSIHKSQGQTLDRVKVDLTKVFEMGQVYVALSRAV
W1QFA7_OGAPD          ----------SDLSREQLPILLSWALSIHKSQGQTLERVKVDLTKIFEKGQVYVALSRCV
C4R014_KOMPG          N--------NVRITRIQLPLLLSWALSIHKSQGQTLDRVKVDLRRTFADGQVYVALSRAV
Q6BNW6_DEBHA          IRNYTGGE-ADKITRSQLPLLLSWAISIHKAQGQTIDRLKIDLRKIFEKGQVYVALSRAT
G8YJN4_PICSO          AKSYSTDG-PEKITRSQVPLLLSWALSIHKAQGQTIDRLRIDLKKVFEIGQVYVALSRAT
C4Y757_CLAL4          AKKDGQG---NEMTRSQLPLLLAWAMSIHKAQGQSIDRLRVDLRKIFERGQVYVALSRAT
H8WVI4_CANO9          ENTAA-----GNPYRTQLPLLLSWAMSIHKAQGQTLPRVKIDLDRVFENGHAYVAISRAV
G8BBJ1_CANPC          ENRAD-----GNPYRAQLPLLLSWAMSIHKAQGQTLPRVKIDLNRVFENGHAYVAISRAV
A5DRR3_LODEL          KNANE-----LLPIRIQLPLILAWAMSIHKSQGQTLPRVKIDLNRSFENGQAYVALSRAV
A0A1D8PRM6_CANAL      KKVTDQLDDLNVLAREQLPLLLAWAMSIHKSQGQTLDRVRVDLGRSFADGQAYVALSRAT
C4YNB1_CANAW          KKVTDQLDDLNVLAREQLPLLLAWAMSIHKSQGQTLDRVRVDLGRSFADGQAYVALSRAT
B9WKK1_CANDC          KKVNE--DESNVLAREQLPLLLSWAMSIHKSQGQTLDRVRVDLGRSFADGQAYVALSRAT
                                    * *:*:  .:*:****:***:: *:::** . *  *: ***:**. 

Q756M1_ASHGO          SKDHLQIINFDPKKIKADPKVKQFYHTLELLPTA---------
G8JWH4_ERECY          SKDQLQIVNFNPKRIKADPKVKQFYQNLITTPP----------
C5DM92_LACTC          SKERLQIVNFDPRVIKANEKVKSFYQTLEVL------------
Q6CQY1_KLULA          SKDRLQITNFDPHKIKVNEKVKDFYQNLHKLKT----------
A7TJ00_VANPO          SKENLQVVNFNPKRIRANEKVKTFYKKLDVVK-----------
G8BSI5_TETPH          SMDTLQVLNFDPSKIKVNEKVKEFYQKLETVS-----------
G0V6X7_NAUCC          SQDQLQVLNFNPSRIRADDKVKEFYKHLETV------------
G0W9L4_NAUDC          SKEQLQVLNFSPSKIRSNDKVKEFYKKLETVTP----------
H2AVD6_KAZAF          SKDQLQVLNFNPKKITTNEKVKDFYKQLETVKA----------
J7S460_KAZNA          SRDSIQVTNFNPSKIRANEKVKQFYRNLETVN-----------
J8PMR0_SACAR          AMDNLQVLNFDPGKIRTNEKVKDFYKHLETLK-----------
J6EEG6_SACK1          TMDSLQVLHFDPGKIRTNGKVKDFYKHLETLK-----------
A6ZST7_YEAS7          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
H0GH54_SACCK          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
B3LSF2_YEAS1          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
C8ZAA0_YEAS8          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
RRM3_YEAST            TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
N1P392_YEASC          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
G2WFA3_YEASK          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
C7GTU9_YEAS2          TMDTLQVLNFDPGKIRTNERVKDFYKRLETLK-----------
G8ZVF0_TORDC          SKDKLQVLNFNPKRIRANDKVKGFYKALEVLS-----------
Q6FPW0_CANGA          SMDSLQVLNFNPKKISIDPKVKEFYRQLEILDT----------
C5E0W3_ZYGRC          SMDNLQVLNFDPRKIRANGKVKDFYKNLETVA-----------
I2H165_TETBL          SKDSLQILNFNPKKIKADEEVKKFYHKLEKLD-----------
K0KZ61_WICCF          SKDRLQLINFDKSKIRSSGIVKQFYEQLRSF------------
W1QFA7_OGAPD          DTKNLEIVNFDEKRIRVSEDVVQFYENLKRLK-----------
C4R014_KOMPG          SKERLQIVGFHPSKIRASAVVKGFYEKLESV------------
Q6BNW6_DEBHA          NKDHLQILNFDPRRITASQDVKQFYHKLETTPNL---------
G8YJN4_PICSO          NKDHLEILNFHPRRITASNEVKSFYKKIENDIAAN--------
C4Y757_CLAL4          NKEHLEVINFDPRRITVAEEVLQFYSQISPVDVKREKSLAEVH
H8WVI4_CANO9          SRETLQVRHFDIGKVKASPVVKQFYQSLEK-------------
G8BBJ1_CANPC          SRETLQVKHFSIGKVKASPIVKQFYQHLEK-------------
A5DRR3_LODEL          DKDNLKVTGFSEHKVKTSEVVRRFYESIGCL------------
A0A1D8PRM6_CANAL      SKDRLELRHFRPDKVTTSNAVRMFYQSLEQV------------
C4YNB1_CANAW          SKDRLELRHFRPDKVTTSNAVRMFYQSLEQV------------
B9WKK1_CANDC          SKDRLELRNFRPHKVTTSEAVRRFYATLE--------------
                        . :::  *    :     *  **  :