CLUSTAL format seed alignment for MF_03178

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q7QK01_ANOGA      ------------------------------------------------------------
Q9VSJ5_DROME      ------------------------------------------------------------
A8XGQ2_CAEBR      ------------------------------------------------------------
G5EGH9_CAEEL      ------------------------------------------------------------
NDOR1_HUMAN       ------------------------------------------------------------
H2R066_PANTR      ------------------------------------------------------------
H2PU35_PONAB      ------------------------------------------------------------
I2CTQ1_MACMU      ------------------------------------------------------------
NDOR1_BOVIN       ------------------------------------------------------------
NDOR1_MOUSE       ------------------------------------------------------------
D4ABT4_RAT        ------------------------------------------------------------
H2T0C5_TAKRU      ------------------------------------------------------------
Q4SRM0_TETNG      ------------------------------------------------------------
NDOR1_DANRE       ------------------------------------------------------------
B1H2T7_XENTR      ------------------------------------------------------------
A7SZI6_NEMVE      ------------------------------------------------------------
B3RP54_TRIAD      ------------------------------------------------------------
B7Q688_IXOSC      ------------------------------------------------------------
H2Z1M3_CIOSA      ------------------------------------------------------------
F4PE90_BATDJ      ------------------------------------------------------------
A9UT33_MONBE      ------------------------------------------------------------
Q5JL61_ORYSJ      ------------------------------------------------------------
C5XJ39_SORBI      ------------------------------------------------------------
NDOR1_ARATH       ------------------------------------------------------------
NDOR1_CRYNJ       ------------------------------------------------------------
NDOR1_USTMA       ------------------------------------------------------------
E3K9U8_PUCGT      ------------------------------------------------------------
C0NDR4_AJECG      ---------------------------------------------------------MAC
J3K7C2_COCIM      -----------------------------------------------------------M
NDOR1_EMENI       -----------------------------------------------------------M
NDOR1_ASPFU       -----------------------------------------------------------M
D5GJW2_TUBMM      -----------------------------------------------------------M
NDOR1_GIBZE       -----------------------------------------------------------M
C7Z4K6_NECH7      -----------------------------------------------------------M
NDOR1_SCHPO       ------------------------------------------------------------
NDOR1_YEAST       ------------------------------------------------------------
NDOR1_CANGA       ------------------------------------------------------------
NDOR1_ASHGO       ------------------------------------------------------------
NDOR1_KLULA       ------------------------------------------------------------
NDOR1_CANAL       ------------------------------------------------------------
NDOR1_DEBHA       ------------------------------------------------------------
NDOR1_YARLI       MSFLLNLIPAISHTNHDEMHEPNQTHLHRHADTSPTNQHNTSHKMTTTEPIHVTTGSGES
NDOR1_DICDI       ------------------------------------------------------------
                                                                              

Q7QK01_ANOGA      ----------------MMERKLTILYGSQSGTAQDLAEQIWRESKMY-FFRGNVLPMDEY
Q9VSJ5_DROME      -------------------MRLLVLYGSQTGTAQDVAEQIWRESHQL-GFQGPVLPFDEY
A8XGQ2_CAEBR      -------------------MSILILYGSETGTAQDLAESLRREAQMR-HLAARVFELDEY
G5EGH9_CAEEL      -------------------MSIAILYGSETGTAQDIAESLRREAQQR-HLQARVHELDEY
NDOR1_HUMAN       ----------------MPSPQLLVLFGSQTGTAQDVSERLGREARRR-RLGCRVQALDSY
H2R066_PANTR      ----------------MPSPQLLVLFGSQTGTAQDVSERLGREARRR-RLGCRVQALDSY
H2PU35_PONAB      ----------------MPSPQLLVLFGSQTGTAQDVSERLGREARRR-RLGCRVQALDSY
I2CTQ1_MACMU      ----------------MPNPQFLVLFGSQTGTAQDVSERLGREARRR-RLGCRVQALDSY
NDOR1_BOVIN       ----------------MPSARLLVLFGSQTGTAQDVSERLGREARRR-QLSCRVEELDSY
NDOR1_MOUSE       ----------------MQVPQLLVLFGSQTGTAQDEAERLGREARRR-RLGCRVQALDSY
D4ABT4_RAT        ----------------MQVPQLLVLFGSQTGTAQDEAERLGREARRR-RLGCRVQALDSY
H2T0C5_TAKRU      ----------------MLKPILQVLYGSQTGSAQDTAHRVARQARRK-QIQVQVLPLDSY
Q4SRM0_TETNG      ----------------MLEPRLQVLYGSQTGSAQDTAQRIARQAQRK-RIQAQLLPLNSY
NDOR1_DANRE       ----------------MSGHTVLVLYGSQTGTAQDTAERIGRQAQRR-RLRVKVEALDTY
B1H2T7_XENTR      ----------------MPQRNLLILYGSQTGTAEDLAGRLGREAKRH-HFQCRMESLDEY
A7SZI6_NEMVE      ------------MAAAAGKKRLTVLYGSQTGTAQEVAERIGREGRRR-HISARVLALDDY
B3RP54_TRIAD      --------MGVDKVGDTQNRSLLVLYASQTGTACEVAERIGRDARRR-YFSVKVTSMDDY
B7Q688_IXOSC      ----------------MLGTRFLILYGSQTGTAQDVAERVGRYAKRY-RFRVSVQAMDEY
H2Z1M3_CIOSA      ----------------MERVRVVMLYGSQTGTAEEVTSNLVMQSRGS-LFKCTACALDDY
F4PE90_BATDJ      -----------------MSQRLLVLYGSQTGCAHETAERIAREGRRR-YFNVQVEAMDDY
A9UT33_MONBE      --------MAETAAAGAPRRRVVVLYGSQTGTAADAAEAVGRRLERY-WFETHVQPMDEY
Q5JL61_ORYSJ      -----------MAATPAADSRLLVIYASETGNAMDAAERVGRQAERGGCPAVDVLPMDSF
C5XJ39_SORBI      ----MAPSSAEADSPASASGRLLVLYASQTGNAMDAAERVGREAERGGCPAVDVLSMDSF
NDOR1_ARATH       --------------MGEKQRKLLVLYASQTGNALDAAERIGREAERRGLPA-SVVSTDEF
NDOR1_CRYNJ       -------------------MIPMILYASETGNAQDTAERVARAFRAN-GRAVTCLPMDQF
NDOR1_USTMA       ------MTSIRTSNCASEGRRLTILYMTQTGTSSDLALRISRQAQRK-RFHVTIADVCSY
E3K9U8_PUCGT      ---------MEQGPSSDDRRRLLILYASQTGTAEDVAQQIARGARRL-HFKTETTSMDDY
C0NDR4_AJECG      ANSNNSG--------HASARTAIILYGSETGNSQDVAEELGRLAERL-HFLAHVCELNAI
J3K7C2_COCIM      ASSKNS-----------VPRTALVVYASETGNSQEIAEELGRLTERL-HFETHVSELDAI
NDOR1_EMENI       SGSQSSGSPGSPGPPGPPGRSALVVYGSETGNAQDVAEEVGALAERL-HFTTQISELNHV
NDOR1_ASPFU       SESP---------AQEARTRTALVLYGSETGNAQEVAEELGALAERL-HFVTHVAEMNSV
D5GJW2_TUBMM      AGSL------------LAGSPVLILYASELGTAADLAKEVAHTLLRR-RLNVKCMEANEL
NDOR1_GIBZE       AVQD---------------RSVLVLYGSETGNAQDMAEELGRICQRL-HFKSRVEELDVV
C7Z4K6_NECH7      AVQD---------------RTVLILYGSETGNAQDVAEELGRVCQRL-HFKSRVEELDAV
NDOR1_SCHPO       ----------------MKNSHIYILYGSETGTAEGLAESLFRSLTRM-GYDVLVNSMDDF
NDOR1_YEAST       ---------------MSSSKKIVILYGSETGNAHDFATILSHRLHRWHFSH-TFCSIGDY
NDOR1_CANGA       ---------------MSSSK-IAVLYGSETGNAQDFAAILSHKLNRLHFKH-TFSSLADY
NDOR1_ASHGO       ---------------MAATR-IAILYGSETGTAQDFANILSHQLRRFHYKH-TVCSIGEY
NDOR1_KLULA       ---------------MQNKK-IVILYGSETGNAQDFAHILSHKLKRLHFSH-TLIKIGDY
NDOR1_CANAL       -----------------MTGEITILYGSETGNAEEYAKYLKQRLRSYNLKPINLASLDDY
NDOR1_DEBHA       ------------MSGISELSGVTILYGSETGNAQDYALFLAKRLKYFGLKP-SVVSLDHY
NDOR1_YARLI       RDHTEPRHVTPTSPNALDGRRITIAYATETGNAQDFATLLGNACTRLRFES-HVVQMNDL
NDOR1_DICDI       -----------------MNKKCTIIYATESGTSQEVAEKLSRDLVLYEIKPRLIDVTNYN
                                         : : :: * :   :  :                    

Q7QK01_ANOGA      DVS-------ELIG-ERFVVCVCSTYGQGEEPDNM---------KRFWKFLLRKSLPNDS
Q9VSJ5_DROME      DMT-------KLIE-ERLVVFVVATTGDGVEPDNM---------KLAWRFLLKRSLPAQS
A8XGQ2_CAEBR      DVG-------NLPS-EDVILFVVSTTGQGEMPPNM---------RKTWKSLLRKSLGMDF
G5EGH9_CAEEL      DVS-------QLPM-EKVVLFVVSTTGQGEMPPNM---------RKTWKLLLRKSLGADF
NDOR1_HUMAN       PVV-------NLIN-EPLVIFVCATTGQGDPPDNM---------KNFWRFIFRKNLPSTA
H2R066_PANTR      PVV-------NLIN-EPLVIFVCATTGQGDPPDNM---------KNFWGFIFRKNLPSTA
H2PU35_PONAB      PVV-------NLIN-EPLVIFVCATTGQGDPPDNM---------KNFWRFIFRKNLPSTA
I2CTQ1_MACMU      PVV-------NLIN-EPLVIFVCATTGQGDPPDNM---------KNFWRFIFRKNLPTTA
NDOR1_BOVIN       PVV-------NLIN-EPLVIFVCATTGQGDPPDNM---------KSFWRFIFRRSLPSTA
NDOR1_MOUSE       SVA-------NLIR-EPLVIFVCATTGQGDPPDNM---------KNFWRFIFRKSLPSSS
D4ABT4_RAT        SVA-------NLIR-EPLVIFVCATTGQGDPPDNM---------KNFWRFIFRKSLPSTS
H2T0C5_TAKRU      NVA-------NLIS-ETLVVFVCATTGQGDPPDNM---------KNFWRFIFKKSLPLGS
Q4SRM0_TETNG      NVA-------NLIS-ENLVVFVCSTTGQGDPPDNM---------KNFWRFIFKKSLPLGS
NDOR1_DANRE       NVV-------NLIS-ESLVVFVCATTGQGDPPDNM---------KKFWRFLFRKSLPADS
B1H2T7_XENTR      RVA-------DLIH-EPLVVFVCATTGQGDPPDNM---------KNFWRFIFRRNLPHNA
A7SZI6_NEMVE      NVA-------DLIK-EDLVVFVCATTGQGDEPDNM---------KKFWRFIMRRNLPAHS
B3RP54_TRIAD      DVT-------QLIH-QNLVIMVCATTGQGDEPDNM---------KQFWRFLLRRNLPTTS
B7Q688_IXOSC      SIN-------ELIN-ETLVLFVCATTGQGEEPDNM---------KGFWTFLLRKSLPVDS
H2Z1M3_CIOSA      LVK-------DLVN-EEMVVFVCSTTGQGEPPDNM---------KRFWKFIMRKNLPVTC
F4PE90_BATDJ      NKA-------LLPN-ESLVLFVCSVTGQGEEPDNM---------KRFWKFLLRKNLPNDS
A9UT33_MONBE      DIK-------NMLQ-ERYMVFVCSTTGQGETPDNM---------RRTWRFLLQKRLPATA
Q5JL61_ORYSJ      DPS-------CLPS-ERFVVFVVSTTGQGDPPDSM---------KGFWRYLLKKNLGARW
C5XJ39_SORBI      DPS-------RLPS-ERFVVFVVSTTGQGDPPDSM---------KGFWRYLLRKDLDRQW
NDOR1_ARATH       DTS-------SLPHHEEAVVFVVSTTGQGDSPDSF---------KAFWRFLLQRNLGNYW
NDOR1_CRYNJ       PIS-------ALPH-TYLLILLTSTHGRGDPPPAM---------LPLWTALLRSSLPEDI
NDOR1_USTMA       DPT-------DLVS-ESLMLFLVSTTGQGEFPTTS---------RPFWNFLLRKGIPEDI
E3K9U8_PUCGT      ERD-------KIFD-EDLVIFVCSTTGQGVQPQNM---------NKFWNALKLASLPNDF
C0NDR4_AJECG      LP--------ESLNDYDVTIFAISTTGQGDIPANA---------RSFWRSLLLKKLPPTF
J3K7C2_COCIM      EA--------ESLNGHSLTIFAVSTTGQGDVPANG---------KTFWRSLLLKRLLPTY
NDOR1_EMENI       KP--------ESLRSYTIVVFAVSTTGQGDLPANA---------RTFWRSLLLKKLPPTF
NDOR1_ASPFU       KATLLTILPQEMLRSFTFTIFVVSTTGQGEIPANA---------RSFWRSLLLKKLPPTF
D5GJW2_TUBMM      DPF-------TSLPIYKTIIFLASTTGQGEIPMNG---------KDFWRKFLVKRIPRDW
NDOR1_GIBZE       DL--------NALLQPKFVIFVISTTGQGDMPHNS---------LLFWKRLLRKKLPPGC
C7Z4K6_NECH7      DL--------NALLQHRFVIFVISTTGQGDMPHNS---------LLFWKRLLRKKLPPGC
NDOR1_SCHPO       NLE--------NLLRPLQCVFICSTTGQGEMPLNM---------RKFWRFLLRKKLPNTF
NDOR1_YEAST       DPQD--------ILKCRYLFIICSTTGQGELPRNV-NALKGERPVTFWSFLKRKNLPSNL
NDOR1_CANGA       KRED--------ILRCRYLFIVCSTTGQGELPRNVYETVTGDQKNTLWTFLKKKKLPADF
NDOR1_ASHGO       SAQN--------ILACQYLFVICSTTGQGALPQNARQSPQGKVEGTLWSVLKRSSLPPTL
NDOR1_KLULA       HPKS--------VLQCKYLFIICSTTGQGELPRNARENCNGRAQGTLWQFLKKSTLPADL
NDOR1_CANAL       PLKRL-------VTHTSYLIIICSTTGQGEIPRNG---------KKFMKFILKKKLPSDL
NDOR1_DEBHA       PLKNL-------VTDTKYLIVICSTTGQGELPRNS---------KKFMKFILKKKLPTDL
NDOR1_YARLI       SPETL-------AQDVSVLVIVCSTTGQGEIPLNG---------KKLWKFLLRKKLPPNL
NDOR1_DICDI       KLE---------LPMEKIVIFVLSTTGHGEVPDPM---------KPLWNFLLIKSLPSNS
                                     .   :. * *  *                  :    :    

Q7QK01_ANOGA      LQQVHFAVLGLGDSRYPKFNYVAKKLHKRLLQLGGSALL-PVGLCDDQHDLG--------
Q9VSJ5_DROME      LQGMQFACLGLGDSSYPKFNYAAKKLSKRLQNLGANSVC-PVGLCDDQHDYG--------
A8XGQ2_CAEBR      LRNTHCTVLGLGDSSYQKYNFAGKKLFRRLAQLGAKMMTKGAFLADDQHEIG--------
G5EGH9_CAEEL      LKNVNIGVLGLGDSSYQKYNFAGKKLYRRLVQLGAKMMC-GVHLADDQHEIG--------
NDOR1_HUMAN       LCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALL-PVCLGDDQHELG--------
H2R066_PANTR      LCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALL-PVCLGDDQHELG--------
H2PU35_PONAB      LCQMDFAILGLGDSSYAKFNFVAKKLHRRLLQLGGSALL-PVCLGDDQHELG--------
I2CTQ1_MACMU      LCQMEFAVLGLGDSSYTKFNFVAKKLHRRLLQLGGSALL-PVCLGDDQHELG--------
NDOR1_BOVIN       LRQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALL-PVCLGDDQHELG--------
NDOR1_MOUSE       LCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALL-PPCLGDDQHELG--------
D4ABT4_RAT        LCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGNALV-PPCLGDDQHELG--------
H2T0C5_TAKRU      LSQLDCAVLGLGDSSYAKFNFVAKKLYKRLVQLGASMLL-PVGLADDQHHLG--------
Q4SRM0_TETNG      LSQLDCAVLGLGDSSYAKFNFVAKKLYKRLVQLGASMLI-PVGLADDQHDLG--------
NDOR1_DANRE       LSRLDCAVLGLGDSSYPKFNFVAKKLHKRLLQLGANMLL-PVGLADDQHDLG--------
B1H2T7_XENTR      LCRMDYAVLGLGDSSYPKFNFIAKKLHKRLQQLGACPLL-PPALGDDQHDLG--------
A7SZI6_NEMVE      LQQLSFSVLGLGDSSYPKFNFIAKKLNKRLLQLGASVLQ-PVGLADDQHDLG--------
B3RP54_TRIAD      LCSLKFALLGLGDSSYQKFNFVAKKLYKRLMQLGAVPLI-HLGQADDQHELG--------
B7Q688_IXOSC      LRGMNYAVVGLGDSSYLKFNFTAKRLHRRLAQLGGECLL-EPLYADEQHEFG--------
H2Z1M3_CIOSA      LSGLKFGVLGLGDSSYAKYNFIAKKLFRRLQNLGGEILV-PLGLADDQHEWG--------
F4PE90_BATDJ      LQKVQFGVFGLGDSSYPKFNFPAKKLYKRLIQLGAAAIV-PRGDGDDQHDLG--------
A9UT33_MONBE      LAHLQFACFGLGDSSYAKFNFVAKKLHKRLQTLGAQPFV-PLGLADDQHPLA--------
Q5JL61_ORYSJ      LEGVRYAVFGLGDSGYQKYNFAAKKLDKRLLHLGAEPII-QVGLGDDQHPSG--------
C5XJ39_SORBI      LKGIHHAVFGLGDSGYQKYNFAAKKLDRRLLHLGAEPVL-EIGLGDDQHPSG--------
NDOR1_ARATH       LQQVRYAVFGLGDSGYQKYNFVAKKLDKRLSDLGATTII-EKGLGDDQHPSG--------
NDOR1_CRYNJ       LEDVHFALFGLGDSSYERFCYAGKMLLRRMEQLGATKMG-EPAWGDERSPNG--------
NDOR1_USTMA       LEDVTFAAFGLGDSTYPRFCWPVRLLSRRLRGLGAKELV-EHGEGDDMHYLG--------
E3K9U8_PUCGT      IDNIRFALFGLGDSSYPKFNWAAKKLFRRLTQIGAQVFY-ERGEADDQNPNG--------
C0NDR4_AJECG      LCGVNFALFGLGDSSYPKFNWASRKLYKRLLQLGAIELC-PCGEADEQHQEG--------
J3K7C2_COCIM      LQHVNFALFGLGDSSYPKFNWAARKMHKRLLQLGANEIF-PSGEADEQHPEG--------
NDOR1_EMENI       LSGVRFTWFGLGDSSYPKFNWAARKLYKRLLQLGADEIY-PGGEADHQHSSG--------
NDOR1_ASPFU       LSGVNYVSFGLGDSSYPKFNWAARKLHKRLLQLGANEIY-PRGEANAQHPEG--------
D5GJW2_TUBMM      LKGVEFTTFGCGDSTYLKYNAAARKIHGRFLQLGATQMV-ARGEGDEQHSEG--------
NDOR1_GIBZE       LASVNYTTFGLGDSTYLKFNWAARKLNRRLDQLGAATFI-DPYEADEQFPDG--------
C7Z4K6_NECH7      LSSVQYTTFGLGDSTYLK----------RLEQLGATTFI-ESFEADEQFPDG--------
NDOR1_SCHPO       LNDMQYAVFGCGDTSYTRFNWASKKLDSRLRQLGAQSFS-SRGEGDEQHPDG--------
NDOR1_YEAST       LNHIQTAMLGLGDSSYPKFNYGIRKLHQRIVTQLGANELFDRLEADDQAMAGSNKGTGLG
NDOR1_CANGA       LNHIKTAFLGLGDSSYPKFNYALRIIHNRMVNQLGAKEIFDRMEADEQSMAGSNKGTGLG
NDOR1_ASHGO       LDHLQVAFLGLGDSSYSKFNFAIRKLHNRIVGQLGAREIFPRLEADAIGLAGSNAGNGNG
NDOR1_KLULA       LDHVNVAMLGLGDSSYPRFNFGIRKLHERIVNQLGASEIFPRLEADELGLAGSNKDTGNG
NDOR1_CANAL       FQHLQLTTFGVGDSSYVKYNYAIKKIHTRLM-QLGCQLLSPRCEADEISPEG--------
NDOR1_DEBHA       LNHIELTTFGIGDSSYPKFNYAIKKIHARLL-QLGCSELCTRCEADEQTPEG--------
NDOR1_YARLI       LSHVTFTTFGLGDSSYPRFNWAIRKIHKRLS-QLGASEVGSRGECDDMSPDS--------
NDOR1_DICDI       LANTKFAILGLGDSSYTTYNFAAKKLYQRLQSIGGTPLL-RRGDADDQHDLG--------
                  :       .* **: *            *:    .          :     .        

Q7QK01_ANOGA      YGAVFLPWINQLWDELGR----IVPLSAGTHKLPESPRE-FRWQVDIANEGHITKDISPD
Q9VSJ5_DROME      HLGVSLSWTKDLWTALKG----ISGLDES--KLSNSHQTTVKWSVKELPK---DSQIAPM
A8XGQ2_CAEBR      IDGAFIPWKQEIWTGIRD----LGIFEKMSEQIDPDVEIQTRYRIVAVGKG-VEEESED-
G5EGH9_CAEEL      IDGAFIPWKTECWKKIKEIAENLSIYREMTAEIDTSVQITTKYRFLELGGE-SGNDDDDS
NDOR1_HUMAN       PDAAVDPWLRDLWDRVLGLYPPPPGLTEIPPGVPLPSKFTLLFLQEAP--STGSEGQRVA
H2R066_PANTR      PDAAVDPWLRDLWDRVLGLYPPPPGLAEIPPGVPLPSKFTLLFLQEAP--STGSEGQRVA
H2PU35_PONAB      PDAAVDPWLRDLWDRVLGLYPPPPGLTEIPPGVPLPSKFTLLFLQEAP--STGSEGQRVA
I2CTQ1_MACMU      PDAAVDPWLRDLWDRVLSLLPPPPDLAEIPPGVPLPSKFTLLFLQEAP--RMGSEGQRVA
NDOR1_BOVIN       PDAAIDPWLQDLWEKVLGPHPVPLNLDLSPPGVLWPSKFTLQFLKDTP--SSGPEELCAA
NDOR1_MOUSE       PDAAIDPWVGDLWEKIMVMYPVPLDIPEIPHGVPLPSKFIFQFLQEVP--SIGAEELNIA
D4ABT4_RAT        PDAAIDPWVGDLWEKIMTMYPVPLDIPEIPHGVPLPSKFIFQFLQEVP--SIGAEELNLA
H2T0C5_TAKRU      ADAVIYPWLTALWDKFYALYPCFSDVIPLSEYEPLPPTYKFHFLEKKE--VCIPN-----
Q4SRM0_TETNG      SDAVIDPWLAALWDKVYALYPSLADVIPLSEYEPLPPTYTFHFLQEK---GGIPN-----
NDOR1_DANRE       PDGVIDPWLLSFWQKTLSLYPPPAGLAPLREEDKLPPRYIFHFLSEVP--NKLTEHL--Q
B1H2T7_XENTR      PDAAVDPWLKDLWSKILSIYPLPPGLNIISEDILLPPKYLLRLLEETIGQDDLSGEELER
A7SZI6_NEMVE      PDAVVDPWLKELWEKVFAVYPIPPGLEIISADERPP---------ARYKIIYTDSPAEES
B3RP54_TRIAD      PDAVIDPWLKNMWEVILQIRPLPQGKEIINENVLSPSPKYAVALSEGYRHSFENSSSEAK
B7Q688_IXOSC      PDGMLDPWLEQFWKTVLGRYPLPPGLQPVSEDVLPAPRYRVQQPLCTN------------
H2Z1M3_CIOSA      CDAVVDEWSRGLWQKLISIYPIKDGVRSAVVYSLDWPLVTVFCYLPAA------------
F4PE90_BATDJ      LDGALDPWLDQVWSVILNLYPIPIGKEMISADVLPPSSYEIMFLNANE---------VMD
A9UT33_MONBE      VEGALEPFVQSVLNHLLLVMPLAPGQVPVPLSRLLPPRYTITDTKPAP---------IWA
Q5JL61_ORYSJ      YEGALDPWLLSLWESLNQTTPSLLPRMYDIINPDLSVLGDAKVEVIYHSSDEAQQDSNLL
C5XJ39_SORBI      YEGALDPWLLSLWKSLNEINPSLLPRVSDINDSNLSILGDPKVHVIYYSSNEVPQDSVLS
NDOR1_ARATH       YEGTLDPWMLSLWRTLYQINPKYFPKGPDVKIPQDEVIDKPKYRILFHKQE--KLEPKLL
NDOR1_CRYNJ       IEDAFLPWLQQTLDLYLPYLPLISPTPKIIESTVLPPPIYKISPASTSKSVEHDLSLERL
NDOR1_USTMA       LEGELGPWMNRFWRKLDELCPLEAGVREVGRDELLPPSVTVTKVETEEGRLKEKHDGRDA
E3K9U8_PUCGT      IDSTLLPWLEGLWKKLIEIKPLPEHLTPIPPATCLPPSFRLEPTTTTPTPLLETIP----
C0NDR4_AJECG      LEGTFIPWSIDLRNNLLKKFPLAPDRHPLPDDVQLPPKWVLAHQDSKSIEGAIMYPSAAL
J3K7C2_COCIM      IDGTFVPWAQSLKKFLLDKFPLKPGQHPIPDDVRLPPKWALAPWGQGTGKEHQMTNGNSS
NDOR1_EMENI       LEGTFIPWLAGFRKHLLDKYPLPPGQDPIPDDVQLPPKWVLRLRDQEAASEDVSPPD-AM
NDOR1_ASPFU       LEGTFIPWITDFRSHLLDKYPLPEGLHPIPDDEQLPPKWVLRLQEPATTGDELTEGTLSS
D5GJW2_TUBMM      IDGSFFPWLEMLVDTLSMKYPLPDGVEPLPADHLLEPEHFVTLTSHRKVTYLV-------
NDOR1_GIBZE       LDGSFVRWTGRLYNHFLEHHPAPSGLEPIPDDVILPPKWSLETTIQNSTETNGHVPP---
C7Z4K6_NECH7      IDGSFVRWSETLSKHLLEHHPPPFGLKPIPDNVILPAKWSLSNALENSQVVNGHYSP---
NDOR1_SCHPO       VEGVFAYWCNHLYSQLAAIKTPSRPAFGEFDLLPPSFQIIIDESLGCKVKGFEDNNIVRH
NDOR1_YEAST       IESVYFEYEKKVLSFLLSKYPNRKVNGQIIKREELDPEVYLEPASYLQLS--DEHANEKF
NDOR1_CANGA       IESVYFEFEKRIITYLMDRFPTRKVGNEIIQREEIDKELYLEPITYLRID--DPHDQQSF
NDOR1_ASHGO       IELVYSEFEKRVLSFLNDQFPFMTVNGEQVPREPIATDIYLKPEYYLEAS----GNDKGT
NDOR1_KLULA       VESVYYEFEKRIIAYMLEKYPNRKHDGKMMPRVGLAEDVYLKPSNILEISTVNGSTNDQL
NDOR1_CANAL       VDGYYIEWEAELIAALLNKFPSASKISSEAVPMP-EYRISVSKSDTTIDP----KEVIDN
NDOR1_DEBHA       VDGYYSEWETNLLEALKSKIHGIPLTYDETVLLPADNPVEVSSNESDVPT----SNSPTE
NDOR1_YARLI       IETMYNEWQARFCESLLKAFP----LPEGVEVIPGEKLLPAKFPVKVLTN----KPKRDT
NDOR1_DICDI       IDYEVEKWSQELISKLLTIYPLSPNFNINNIKNQLNKSKYNIKIDKINENNKEIKYEIPT
                         :                                                    

Q7QK01_ANOGA      GIDLYADVKMPNG---------------------FQTVVVENRRTTAAEHFQDVRMITFE
Q9VSJ5_DROME      DNLLWSQKQTAHS---------------------FK--ILDNQRTTAVDHFQDVRFLRLQ
A8XGQ2_CAEBR      -----AEFSESDY---------------------EALRVASNVRVTSEAHFQDTRLVKFE
G5EGH9_CAEEL      DEDLEPQIEIPDY---------------------FPLKVLKNRRLTSAEHFQDTRLVDFE
NDOR1_HUMAN       HPGSQEPPSESKP---------------------FLAPMISNQRVTGPSHFQDVRLIEFD
H2R066_PANTR      HPGSQEPPSESKP---------------------FLAPMISNQRVTGPSHFQDVRLIEFD
H2PU35_PONAB      HPGSQEPPSESKP---------------------FLAPMISNQRVTGPSHFQDVRLIEFD
I2CTQ1_MACMU      HPGSQEPPSESKP---------------------FLAPMISNQRVTGPSHFQDVRLIEFD
NDOR1_BOVIN       GTDPQGPPSELQP---------------------FLAPMVSNQRVTGPSHFQDVRLIEFD
NDOR1_MOUSE       SSAPQTPPSELQP---------------------FLAPVITNQRVTGPQHFQDVRLIEFD
D4ABT4_RAT        SSAPQTPPSELQP---------------------FLAPVVTNQRVTGPQHFQDVRLMEFD
H2T0C5_TAKRU      TSLDQSFPTQSRP---------------------SPCRLLSNLRITEASHFQDVRLIEFD
Q4SRM0_TETNG      TSLDQRLPTPAQP---------------------HPCRLLSNSRVTGPSHFQDVRLIEFD
NDOR1_DANRE       TVDNKSSPTPLRP---------------------FPAPLVFNQRVTHTAHFQDVRHIEFD
B1H2T7_XENTR      DSNNTTPASESHP---------------------FPAPVVSNQRVTALDHFQDVRLIEFD
A7SZI6_NEMVE      SLEFGLPASQQAP---------------------FFATLISNDRVTASNHWQDVRLVKLD
B3RP54_TRIAD      RNE--TTPSKNQP---------------------FLAPLTSNTRVTSEDHFQDVRLIKFS
B7Q688_IXOSC      DKLNIVQEPNEQQ---------------------FLSPVLSNQRVTNPSHFQDVRLIKFD
H2Z1M3_CIOSA      ---NHLEFSKKNP---------------------YLAALTGNQRVTATEHFQDTRLISLD
F4PE90_BATDJ      TNVTKAGEIDEH-----------------------FATVRCNTRITSQDHFQDVRHVVFD
A9UT33_MONBE      PLTPDTVPTREQP---------------------LSTQFLWNKRVTPQSHFQDVRHVAVD
Q5JL61_ORYSJ      DFKNLIQRARSMSPSLQFYNN--------DKEPHYMLQMVSNRCLTKENSDRDVRHFELE
C5XJ39_SORBI      DPSKIISSARSMSPALRFHA---------DAEPAYMLQMVKNKCLTKEGSDRDVRHFELE
NDOR1_ARATH       SDSDIIQRARGMSPGKLFKD---------KSKPDCFLKMTRNEVLTKAESTKDVRHFEFQ
NDOR1_CRYNJ       SISFPIPNGKPAPVRVEDQARDKASTSRTKPDDWVWATLKKNIRLTSKDWWQDVREIELE
NDOR1_USTMA       LGRHLEDQGWSISILDKNQ-------RMTATDHFQDVRLLEFVRLNQTDVEEDKRQIGEN
E3K9U8_PUCGT      -----------------------------KSNQSIPAILTKNQRITAPDHWQDTRHLEFE
C0NDR4_AJECG      SEAQPRGQGSP-------SIPSNFSNDLRPIPNTISATLVANDRLTPQTHWQDVRHLILK
J3K7C2_COCIM      QPEKNNGTGKEQIV--QYPALQPRDHDTRPIPNSITATLIDNIRVTPESHWQDVRHLTLT
NDOR1_EMENI       GAAVTGD----------FPDSYRLDNDHRPLHDSLTATLVQNKRVTPQTHWQDVRHLILT
NDOR1_ASPFU       EQTVSDE----------YPGLTRLDHDVRPIPDALTATLVENRRVTPRTHWQDVRQISLT
D5GJW2_TUBMM      --------------------RDVMKDLHVQRPASRTCLIVRNKRVTAESHWQDVRHITIS
NDOR1_GIBZE       ------------------SLENIPSSTLLPIPDGWTATLVGNGRLTPEKHWQDVRLISFD
C7Z4K6_NECH7      ------------------QLSELPPASLLPIPNGWTATLADNVRLTPETHWQDVRLVSFD
NDOR1_SCHPO       SRGK------------------------------IEATLVHNKRISNIKHWQDVRHLAFK
NDOR1_YEAST       TSTKVIFEGDESLK---------------------VGRVNINKRITSEGHFQDVRQFKFS
NDOR1_CANGA       SGGPTTFVGDKLIK---------------------TGTITLNKRITAKDHFQDVRQFTFE
NDOR1_ASHGO       ASVPCTFEGDSSVK---------------------YGTVVTNKRITATDHFQDVRQLVFS
NDOR1_KLULA       PDSKIQFVGDETIR---------------------HGTVKKNNQITAKDHFQDVRQFVFE
NDOR1_CANAL       PIVSRLG--KDGLK---------------------LGTVLENNRLTSSNHFQDVRDFKFS
NDOR1_DEBHA       LSLTRMGDGSTNLL---------------------LGSVKANKRITKEGHFQDVRHLIIE
NDOR1_YARLI       SDADHVACTRKDVL---------------------QGTVVGNERVTAKGHFQDVRFFQID
NDOR1_DICDI       QF--------------------------------YKSKLKVNKRITVEEWEQDVRHIELD
                                                        .      .     .* * .   

Q7QK01_ANOGA      -----K-----------------------------KAVPWCSGDVLYVRPHNS----KES
Q9VSJ5_DROME      C---QT-----------------------------EDLSWEPGDVLDVQPQNS----DEA
A8XGQ2_CAEBR      IPVESR-----------------------------IPMTYLPGDVLMVRPYNP----EET
G5EGH9_CAEEL      ISDRNR-----------------------------SKMGFQPGDVLMVRPYNP----EET
NDOR1_HUMAN       ILG--------------------------------SGISFAAGDVVLIQPSNS----AAH
H2R066_PANTR      ILG--------------------------------SGISFAAGDVVLIQPSNS----AAH
H2PU35_PONAB      ISG--------------------------------SSISFAAGDVVLIQPSNS----AAH
I2CTQ1_MACMU      ISG--------------------------------SGISFAAGDVVLIQPSNS----AAH
NDOR1_BOVIN       ISG--------------------------------SGISFAAGDLVLIQPENT----ASH
NDOR1_MOUSE       ITD--------------------------------SNISFAAGDVVFILPSNS----EAH
D4ABT4_RAT        ITE--------------------------------SNISFAAGDVVLILPSNS----EAH
H2T0C5_TAKRU      ITG--------------------------------TNIAFTAGDVVMMYPQNS----PED
Q4SRM0_TETNG      ITG--------------------------------SNIEFAAGDVVTMYPHNC----PED
NDOR1_DANRE       ITG--------------------------------SNIEFSAGDTVMMRPCNT----SED
B1H2T7_XENTR      ISG--------------------------------SALQFSPGDVAMVQPRNS----PPH
A7SZI6_NEMVE      ISG--------------------------------SGISYSPGDVVMVQPSNL----SDT
B3RP54_TRIAD      IKD--------------------------------SKIKYYPGDVVMIQPCNA----DEN
B7Q688_IXOSC      IKG--------------------------------SGITFVPGDVVLVFPENS----EED
H2Z1M3_CIOSA      ISAV-V-----------------------------DKMRYEPGDVVMVQPRNL----PHN
F4PE90_BATDJ      ITN--------------------------------SGLIYRTGDVMSIYPKNL----PCD
A9UT33_MONBE      ISQQ-------------------------------PGLTYRPGDVAYIMPQNR----RAV
Q5JL61_ORYSJ      NPS--------------------------------SGITYQVGDALEILPSQS----PSA
C5XJ39_SORBI      DPS--------------------------------SAISYKIGDTLEILPSQN----PSA
NDOR1_ARATH       FVS--------------------------------STIEYEVGDVVELLPSQN----SSV
NDOR1_CRYNJ       FDDP-------------------------------DTKPYTAGSICSLQPQSR----EDD
NDOR1_USTMA       EEIS-------------------------------RGSASALDGISIQTYRPGDILCLHP
E3K9U8_PUCGT      FD---------------------------------QTLEFQPGSVAEILPENC----AED
C0NDR4_AJECG      IS---------------------------------EPIRYVPGDILCVTPRNF----DSD
J3K7C2_COCIM      VP---------------------------------ESMQYIPGDILHITPKNF----AKD
NDOR1_EMENI       VS---------------------------------DPISYAPGDVLTITPKNT----AED
NDOR1_ASPFU       VP---------------------------------DAVTYAPGDMICITPKNF----DED
D5GJW2_TUBMM      VPG--------------------------------SSVRWAPGDTVTLLPKNF----PED
NDOR1_GIBZE       VPRRDG-----------------------------VKLACVPGDCLTIYPKNF----PQD
C7Z4K6_NECH7      IPRREG-----------------------------VKLQCNPGDCLTVYPKNF----PQD
NDOR1_SCHPO       IPN---------------------------------FERWKPGDVAVLYPWND----DMS
NDOR1_YEAST       NVDKIQE-------------------------------NYEPGDTVTIYPCNTD---EDV
NDOR1_CANGA       SCDDIK---------------------------------YKPGDTVALYSYNTD---QSV
NDOR1_ASHGO       SQDGEN---------------------------------YYPGDTVSIYPYNTD---ADV
NDOR1_KLULA       TEDHEA---------------------------------YHPGDTVSLYPENSD---NDV
NDOR1_CANAL       SNG----------------------------------LNYLPGDTVSLFPCNFD---EDV
NDOR1_DEBHA       GEN----------------------------------LSYIPGDTLALYPSNDN---ESV
NDOR1_YARLI       ANTEDNDMADLSRDFSKLNSDSRDLHDVSRAVSAGSSIDFSTGDTVSLFPQNSV---ADV
NDOR1_DICDI       ISECKELQ---------------------------VPIKYQSGDVAYVLPKNP----IKR
                                                            ..                

Q7QK01_ANOGA      VDQLFEIFHQHEFGLDKHTCV------QVKAIDSEMPVPSILQKPLPLAAIAEQYWDLTA
Q9VSJ5_DROME      VQTFFDLIREHSLNFDESTIV------EVSSAHQDMPLPIAYSNPLSLLQAAKFVWDLSA
A8XGQ2_CAEBR      VKIAIEALGYSEEMLHRTVKV------VKNDQFSKNPPYFLFGHRTTLLTLLQRYFDLQQ
G5EGH9_CAEEL      VKIAIEALGLTEEQLKKPLKI------VKNDRFSKNPPNFLVGTKTTLLTCLQRYFDLQQ
NDOR1_HUMAN       VQRFCQVLGLDPDQLFMLQP-------REPDV----SSPTRLPQPCSMRHLVSHYLDIAS
H2R066_PANTR      VQRFCQVLGLDPDQLFMLQP-------REPDV----SSPTRLPQPCSMRHLVSHYLDIAS
H2PU35_PONAB      VQQFCQVLGLDPDQLFTLQP-------REPDV----SSPTRLPQPCSMRHLVSHYLDIAS
I2CTQ1_MACMU      VQQFCQVLGLDPDQLFTLQP-------REPDV----SCPTRLPQPCSMRHLVSHYLDIAS
NDOR1_BOVIN       VQQFCQALGLDPEQHFTLQP-------REPGV----TCPTRLPQPCSVRRLVSQYLDIAS
NDOR1_MOUSE       TQQFCQVLCLDPNQFFTLKP-------REPGV----PDPPGLPQPCTVWNLVSQYLDIAS
D4ABT4_RAT        TKQFCQLLCLDPNQFFTLKP-------REPGV----PYPPGLPQHCTVWHLVSQYLDIAS
H2T0C5_TAKRU      VEQFRQLLSLDLEAIFTLQP-------THSTAG---RVPCRIPQPCTMLYLVENILDISS
Q4SRM0_TETNG      VQQFCQLLRLDLEASFTLKP-------AYNTA-----APCRIPQPCTMRSLVESFLDISS
NDOR1_DANRE       VEQLCQLLKLDPESYFTLTP-------TDSST----EVPARLPQPCSIRFLLEHFLDISA
B1H2T7_XENTR      VQQLCSLLRLDPRTRFVVEA-------SDPEA----AVPAQLAELQCIGQLAERYLDLCA
A7SZI6_NEMVE      AEEFMSFLHLDPDKNFTLQQ-------TNPDI----PVPRRLPRPCSIRFLVEHYLDIQG
B3RP54_TRIAD      VSEFLSYMNLDGSKAAILQQ-------NDPDI----PLPQ-LPANPTIRNLVKYFFDINS
B7Q688_IXOSC      VAEFFNLFHLDPNEVLQLVP-------TEPGT----SLPQLLAHPTTLETCVRKYFDLSH
H2Z1M3_CIOSA      VNALLELLPYKPDMLITFHS-------LDDDDD---STTSLPKQATTLREIATNYLDFMS
F4PE90_BATDJ      VQLAIEYLGWTAIADLPLRLI------PNRSDL---RQSKELKGILTIRELLECHLDIFG
A9UT33_MONBE      VDELLAWMGVDGDVVLELQQR------REDSPL---PTRLRGRPRATLREILTHDLDIQA
Q5JL61_ORYSJ      VDSFIERCKLDPDCYITVRA-------KDRVKISKGSLLK---DRIKLKTFVALTMDVAS
C5XJ39_SORBI      VDAFIERCNLDPDCYITVQV-------RSGDKVSNDSVVNSQMDRIKLRTFVALTMDVAS
NDOR1_ARATH       VDAFIERCGLDPESFITVGP-------RETENSSFSEEMITQ-IPIKLKTFVELTMDVTS
NDOR1_CRYNJ       VNMFLEMMELTSQADEVVTIE------SLLDEQPLPSHLPPAGTPTTLRSLLTNHLDIRY
NDOR1_USTMA       INDAASVTEMLSRLDLDADTL------VSLAGSTIPSTVPQSPAHMSVRDLLTHHLDFTS
E3K9U8_PUCGT      VEKLFKLMKWTDLSDQVYKLS------YYDSNQ--QDLPAGWTEYATLREIFTSRLDFMA
C0NDR4_AJECG      VNSLICMMGWESDADTPLCFVPNATYASANNAPSPEIPFLLKSPGFTLRILLTDYLDIMA
J3K7C2_COCIM      VNTLLSLMGWEADADIPLCFTPASK--SSLPSSSPPISFLQNSPGFTLRELLTNYLDIMA
NDOR1_EMENI       VQSLIEMMGWQEQADQLVSLVPRDSTRSTNELPSPPIHSLDSYPRLTLRELLINYLDIRA
NDOR1_ASPFU       VQALIDMMGWGEMADKLVSLAPGEKLQAAGELHAPPIPGLEKYPKLTLRALLMDYIDIRA
D5GJW2_TUBMM      VEEFLVCQGLIDVADHPLGFM-----RIPNPAVESPLPGRLVQP-LTLRTLLTHHLDLTS
NDOR1_GIBZE       VQRLITLMEWEDIADKPLDLS----------QCESLPTNLFTDSKSTLRELLLNNIDFTA
C7Z4K6_NECH7      AQKLITLMGWDDIADRPLDLS----------LCDSLPQNLYIDPKCTLREIILNNIDFTA
NDOR1_SCHPO       VNSFIECMGWESIKYSPLIIS----------SNVAERKLPWFPNILNVFNLVKYVLSIHS
NDOR1_YEAST       SRFLANQSHWLEIADKPLNFTSG------VPNDLK-DGGLVRP--MTLRNLLKYHCDFMS
NDOR1_CANGA       ERMLECQPQWIPLADKPLSFTNG------IPTHLL-DGGVVQP--LTLRNLLKYHCDFMS
NDOR1_ASHGO       QAFIDTQQHWASIADVPLQIKTP------TSARGICDGGLVSP--LTLRNLLKYHCDIVS
NDOR1_KLULA       ELFLEAQPHWKKVADELLTITDL------ENCDRFRDGGVVKP--LTLRTLLKYHFDIVS
NDOR1_CANAL       DALLQSQPQWLKIADKPLNLK----------NFPHLEGGFADI--LTLRTLFKYHLDIMS
NDOR1_DEBHA       ETLIQSQPHWIPIADKPLLIHG---------EIPFVEGGLIDKSKLTLRSLITHHLDIIS
NDOR1_YARLI       DLLLRDQ-GWEDIADYKLDAP----------SLPPIEGGYVTP--LTLRSLITHHLDIMG
NDOR1_DICDI       VNEFIELLGLHSNWIIESIEP---------IDKEITQSPTLLKLPITIYDLVRCYFDIMG
                                                                 :        ..  

Q7QK01_ANOGA      I-PRARAFAVLAKNCSNELE-----------REKLIEFSRYE-------------GQEEL
Q9VSJ5_DROME      K-PRQRFLEVLAQNCCDEME-----------KEKLLEFSSAE-------------GIDDL
A8XGQ2_CAEBR      I-PKRSFFEMMAYYSKDPSE-----------KERLRELSSPE-------------GLDDL
G5EGH9_CAEEL      V-PKRSFFEMLGYYSTNPPE-----------KERLQELASPE-------------GLDDY
NDOR1_HUMAN       V-PRRSFFELLACLSLHELE-----------REKLLEFSSAQ-------------GQEEL
H2R066_PANTR      V-PRRSFFELLACLSLHELE-----------REKLLEFSSAQ-------------GQEEL
H2PU35_PONAB      V-PRRSFFELLACLSLHELE-----------REKLLEFSSAQ-------------GQEEL
I2CTQ1_MACMU      V-PRRSFFELLACLSLHELE-----------REKLLEFSSAQ-------------GQEEL
NDOR1_BOVIN       V-PRRSFFELLACLSPHELE-----------REKLWEFGSAR-------------GQEEL
NDOR1_MOUSE       V-PRRSFFELLACLSQHALE-----------REKLLELSSAR-------------GQEEL
D4ABT4_RAT        V-PRRSFFELLACLSPHALE-----------REKLLEFSSAR-------------GQEEL
H2T0C5_TAKRU      V-PRRSFFELLSTFATNELE-----------REKLLEFSSPA-------------DQEEL
Q4SRM0_TETNG      V-PRRSFFELLSTFATNELE-----------REKLVEFSSPA-------------GQEEL
NDOR1_DANRE       V-PRRSFFELLATFATDELE-----------QEKLLEFSSAA-------------GQDTL
B1H2T7_XENTR      V-PRRSFFQLLSHFAPDELE-----------REKLREFGSAG-------------GQEEL
A7SZI6_NEMVE      V-PRRYFFELLSHFTPSELE-----------KEKLQDFASAE-------------GQEDL
B3RP54_TRIAD      I-PRRYFFELLSYFSTDELE-----------QEKLQEFASPE-------------GQEDR
B7Q688_IXOSC      I-PKRSFFELFWHFGDNELE-----------RERLREFGTTS-------------GQEDL
H2Z1M3_CIOSA      V-PRRCFFQLLSHFSTDENE-----------KEKLVELGQPE-------------GTDER
F4PE90_BATDJ      R-PRRYFFELLAFFASNEQH-----------VEKLREFASAA-------------GQNDL
A9UT33_MONBE      V-PFRYFFELLSCFAPAEHE-----------VERLRELLLPQ-------------GQDEL
Q5JL61_ORYSJ      ASPRRYFFEVMSFFATAEHE-----------KEKLQYFASPE-------------GRDDL
C5XJ39_SORBI      ASPRRYFFEVMSFFATSERE-----------KERLQYFASPE-------------GRDDL
NDOR1_ARATH       ASPRRYFFEIMSFYATAEHE-----------KERLQYFASPE-------------GRDDL
NDOR1_CRYNJ       S-PRKSFFEWLRRLSTNEME-----------RERLDEFISDP---------------DEI
NDOR1_USTMA       V-PTNSFFEQIRLFSPTGSQE----------REKLDEYCGIFPEEELAKGANPQDGIDEM
E3K9U8_PUCGT      V-PGRSFIDWLSHFTSDPME-----------TERLQEFCSIE-------------GQDDL
C0NDR4_AJECG      I-PRRSFFSNIAHYTEDPMH-----------KERLLEFANPE-------------YIDEF
J3K7C2_COCIM      I-PRRSFFSQISHFTDDTMQ-----------KERLLEFTNPE-------------YIDEY
NDOR1_EMENI       I-PRRSFFAAIAHYTTYEMH-----------KERLLEFTNPE-------------YLDEF
NDOR1_ASPFU       I-PRRSFFSAIAHYTSNEMH-----------KERLLEFTNPE-------------YLDEF
D5GJW2_TUBMM      I-PRRAFFGMIANFTDNKVH-----------KERILEFTNPE-------------YLDEL
NDOR1_GIBZE       I-PRRSFLKNMSYFSTNPDH-----------KERLLEFTMAE-------------YLDEY
C7Z4K6_NECH7      I-PRRSFLKSMSYFSTNPDH-----------KERLLEFTMTE-------------YLDEY
NDOR1_SCHPO       V-PSRTFFEMASHFSNNKMH-----------KERLQEFSSYK-------------NIDDY
NDOR1_YEAST       I-PRTSFFLKIWTFATDVTKMERGQEQLNDQREKLRQFATDQD-------------MQDL
NDOR1_CANGA       I-PRSSFFLKIWTFATDVTRMERGEEQMKDQRQKLYEFATDED-------------MQEL
NDOR1_ASHGO       I-PMRSFFMKTWTFAVDHERLPDGKDQLQQQRDKLREFAESED-------------MQDI
NDOR1_KLULA       I-PRQSFFMKTWTFANAHEDRPTDQELLEQQRDKLRQFGYGQD-------------LQDL
NDOR1_CANAL       I-PRRSFFALLWHFVDPST------EDGEREQEKLKEFGSLDE-------------PEEL
NDOR1_DEBHA       I-PRRSFFMTLAHFSDSTT------EDGEREQEKLREFSKIEE-------------SEEL
NDOR1_YARLI       I-PRQSFFTYVFHFATS-----------ERQKERLQEFSQPGEG------------LEDL
NDOR1_DICDI       S-PRRYFFELLSHFVTNPIE-----------KERLEFFSSTE-------------GQDDL
                    *    :                         ::                      :  

Q7QK01_ANOGA      FAYANRPRRTILEVLLDFPHATKSLTLEALFELFQPIKPRAFSIASAM----ESGK----
Q9VSJ5_DROME      VAYVNRPRRNLLEVLEDFRHATSSLTLQQLFEMMPLIQPRSFSIASDV----SALS----
A8XGQ2_CAEBR      LDYANRCRRTTAETFRDFPATSKKLGLNHLFEILTVIRPRAFSIASAP----SGSH----
G5EGH9_CAEEL      LDYANRSRRTTAEALRDFVATSKNLKPDYLFEILTTIRPRAFSIASAP----SPFH----
NDOR1_HUMAN       FEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASS--LLTHPSR----
H2R066_PANTR      FEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPAIRPRAFSIASS--LLIHPSR----
H2PU35_PONAB      FEYCNRPHRTILEVLCDFPHTAAAIPPDYLLDM-RAIRPR-FSIASS--LLTHPSR----
I2CTQ1_MACMU      FEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPAIRPRAFSIASS--MLAHPSR----
NDOR1_BOVIN       CEYCTRPRRTALEVLCDFPHTAAAVPPDYLLDLLPLIRPRAFSIASS--LRAHPSR----
NDOR1_MOUSE       WEYCSRPRRTILEVLCDFPHTAGAIPPDYLLDLIPRIRPRAFSIASS--LLAHPRR----
D4ABT4_RAT        WEYCNRPRRTILEVLCDFPHTAGAIPPDYLLDLIPRIRPRAFSIASS--LLAHPRR----
H2T0C5_TAKRU      HSYCNRPRRTILEVLADFPHTTAELRVDYLLDLFPEIQPRSFSIASS--LQSHPHR----
Q4SRM0_TETNG      YSYCNRPRRTALEVLADFPHTTAELRVDYLLDLFPEIQARSFSIASS--LRTHPRR----
NDOR1_DANRE       HSYCNRPRRTALEVLTDFPHTTAELSIGRLLDLFPEIQPRSFSIASS--LLEHPNR----
B1H2T7_XENTR      FSYCNRPRRTLLEVLVDFPHTTRCIPATYLLELIPRMRPRAFSIASS--MQALPNA----
A7SZI6_NEMVE      YSYCYRQKRSTLEVLQDFPQASANLPFEYLLDLIPAIQPRAFSIASA--QKAHPDE----
B3RP54_TRIAD      YSYCNRPRRTILEVLQDFPNSAPHVPFEYLFDLIPPIQARAFSIASS--LKMYPDE----
B7Q688_IXOSC      IDYVIRPRRTVLEVFTDFHQTTSKVPLAYLFDLIPPIRPRSFSIANS--PLAHPGE----
H2Z1M3_CIOSA      YSYANRPRRTILEVLQDFHLTASKISLERIFDIFPPIQPRAFSIASS--PTRHRGK----
F4PE90_BATDJ      YAYCHRVRRTIMEVLMDFTSVI--IPVKYLFDLIPHLSPRSFSIASSLPETVHSEQP---
A9UT33_MONBE      LDYCHRMRRTSLEVLRDFPSTQGHLPLEYLFDLFSPLQPRAFSIASN--PVVHAGR----
Q5JL61_ORYSJ      YQYNQKEGRTILEVLDDFPSVQ--MPFEWLVQLTPPLKKRAFSISSS--PLAKPNQ----
C5XJ39_SORBI      YQYNQKESRTVLEVLEDFPSVQ--MPFEWLVQLTPPLKKRAFSISSS--PLAHPNQ----
NDOR1_ARATH       YNYNQKERRSILEVLEDFPSVQ--IPFDWLVQLVPPLKPRAFSISSS--PLAHPAA----
NDOR1_CRYNJ       HTYATRPSRTIVETLADFRFTR--IPMSHILEILPPLRRRQFSIASSWEDH---------
NDOR1_USTMA       YEYAQRPRRTIKEVLDEFKSVQ--VPLAYIADVLPWIKPREFSIASAPPANSEREKR---
E3K9U8_PUCGT      FEYTKRPRRTILEVLSEFKSAT--IPLDYIHDVFPQIRPRQFSIASSPKLF---------
C0NDR4_AJECG      YDYTSRPRRSILEVLHEFESVK--IPWQNVCTVFPTLRGRQFSLASGGKLKTLRSLPGDS
J3K7C2_COCIM      YDYATRSRRSILEVLYEFDTVK--VPWQQVCNVFPILRGRQFSIASGGRLKK--------
NDOR1_EMENI       WDYTTRPRRSILEILHEFDTVK--IPWQHATSTFPIIRARQFSIASGGELKR--------
NDOR1_ASPFU       WDYTSRPRRSILEVLHEFHSVK--IPWQHVTTVFPVFRGRQFSIASGGELKR--------
D5GJW2_TUBMM      YDYTTRPRRSILEVLQEFSSVK--IPINRLIDVIPVMRARAFSVASSNTGHS------PG
NDOR1_GIBZE       FDYATRSRRSILEVLEEFSSVK--LPAERLFDIFPLIRGRDFSIANGGVHQS------HP
C7Z4K6_NECH7      FDYATRSRRSILEVLEEFTSVK--LPAERVLDIFPLIRGRDFSIANGGIKLN------HP
NDOR1_SCHPO       YDYTTRPRRTVLETLQEFKSVQ--IPIEYALDAFPVIRGRQYSIANRCDNSTGI------
NDOR1_YEAST       YDYCNRPRRSILEVLEDFI-SVK-LPWKYVLDYLPIIKPRYYSISSGPGDPN--------
NDOR1_CANGA       YDYCNRPRRSILEVMEDFL-SIR-LPLEYLLDFFPPIKPRLYSISSTANCNN--------
NDOR1_ASHGO       YDYCNRPRRSILEVVQDFM-SLR-LPWEYILDYLPHIKPRFFSISSQPCNKD--------
NDOR1_KLULA       YDYCNRPRRSVLEVIQDFE-FLK-LPWEFALDYLPMIKPRFYSISSAPSDPN--------
NDOR1_CANAL       YDYANRPRRSILETLLEFENNLT-IPVSYILDLFPLIRPRMFSIASCPSSKE--------
NDOR1_DEBHA       YNYANRPRRSILETILEFQQNLT-IPVEYILDLFPIIKPRLFSIASRPSPNS--------
NDOR1_YARLI       FDYANRPRRSILEVVTEFD-SLK-IPLKYVLDVFPLMRPRLFSISQKAHTMP--------
NDOR1_DICDI       RTYNQKEKRNYIDVLKEFPSIE--IPFEYLFDLIPPIKPRPFSISSSSLLNPNT------
                    *  :  *.  : . :*      :           :  * :*::.              

Q7QK01_ANOGA      -------LQILVAVIEYKTKLSVP-RRGLCSHWLKDLQPGN--------MVNAWVRKSTF
Q9VSJ5_DROME      -------LDLLVAVVEYKTIMHTP-RLGLCSNWLKTLKSGT--------ELSGVVKRGTM
A8XGQ2_CAEBR      -------VELLVAKVEYKSRMADR-RRGLCSTFIARLKEGD--------EVFCKIRAGTF
G5EGH9_CAEEL      -------LELLVAKVEYKSRMADK-RRGLCSTFISRLKPGD--------EVFCKIRPGTF
NDOR1_HUMAN       -------LQILVAVVQFQTRLKEP-RRGLCSSWLASLDPGQ-----GPVRVPLWVRPGSL
H2R066_PANTR      -------LQILVAVVQFQTRLKEP-RRGLCSSWLASLDPGQ-----GPVRVPLWVRPGSL
H2PU35_PONAB      -------LQILVAVVQFQTRLKEP-RRGLCSSWLASLDPGQ-----GPVRVPLWVRPGSL
I2CTQ1_MACMU      -------LQILVAVVQFQTRLKEP-RRGLCSSWLASLDPGQ-----GPVRVPLWVRPGSL
NDOR1_BOVIN       -------LQILVAVVQYQTRLREP-RRGLCSSWLASLDPAQ-----GPVRVPLWVRSGGL
NDOR1_MOUSE       -------LQILVAVVKYQTRLKEP-RHGLCSSWLASLNPGQA----GPVRVPLWVRPGSL
D4ABT4_RAT        -------LQILVAVVKYQTRLKEP-RRGLCSSWLASLTPGQA----GPVRVPLWVRPGSL
H2T0C5_TAKRU      -------LQILVAVVWYKTKLFKP-RRGLCSTWLASLDPIQ-----GETYVPLWVKKGTL
Q4SRM0_TETNG      -------LQILVAVVQYKTKLYKP-RRGLCSSWLASLDPKQ-----GEVVVPLWVKRGTL
NDOR1_DANRE       -------IQILLAVVKYKTMLVKP-RKGLCSSWLASLDPSK-----GDVYVPLWVKKGSL
B1H2T7_XENTR      -------LQILVAVVQYRSKLIEP-RRGLCSTWLASLPPRG------RERVPIWVKRGSM
A7SZI6_NEMVE      -------IEILMAVVKYQTKISKP-RRGLCSTWLSSL-PSR-------SRVPVWVKRGTI
B3RP54_TRIAD      -------IHILMAVVKYKTKLQKP-RQGLCSTWLASLNPSKE-----STKIPLWTRKGTI
B7Q688_IXOSC      -------IHILVAIVNFRTKLKKP-RRGLCTTYLAGLKVPELYMVADLPKVSIAVKKGSL
H2Z1M3_CIOSA      -------LQILVAVVRYKTRLQLP-RQGVCSTWLASLQPND--------RVPVWLKRGGI
F4PE90_BATDJ      -----VELHLAVGIVTYQTRLKEK-RHGVCTKWISQLKEND--------SVRFNILPGLF
A9UT33_MONBE      -------LEFCIAIVNYKTRMTVP-RVGVMTSWLAALNSEEQL---ASTTVAVWVQAGTL
Q5JL61_ORYSJ      -------IHLTVSIVSWRTPFKRM-RRGLCSSWLAGLNPNEE------NLIPCWVHHGSL
C5XJ39_SORBI      -------IHLTVSIVAWVTPFKRT-RRGLCSTWLAGLNPNKD------NLIPCWIHQGSL
NDOR1_ARATH       -------VHLTVSIVSWITPYKRT-RKGLCSSWLASLAPEQE------VNIPVWFHKGSL
NDOR1_CRYNJ       ----PGKVQLLVALIEYKTNLKIP-RKGLCSSWLNGLPVGT--------RIPIHIASPTL
NDOR1_USTMA       VSEEPHAIQLSVAMVKYKTRLRKA-RTGLCTRWLSSLPLGS--------RVPVVIKPGYL
E3K9U8_PUCGT      ----PNQIQLLVAVVNYKTRLSVP-RKGLCTSYLSKLEIGT--------RIHIGISGGYV
C0NDR4_AJECG      PTNSGTRFDLLVAIVKYQTVIKKI-RQGVCTRYLAVLRPGS--------TLKVQVQKGGL
J3K7C2_COCIM      TVEGKTKFELLVAIVKYQTVIKKI-REGVCTRYLAVLQPGS--------TMKVQLHRGGL
NDOR1_EMENI       TSVGGARFELLIAIVKYRTVIKKI-REGVCTKYISNLRPGS--------TLKIQLQRGGL
NDOR1_ASPFU       TSGGGAKFELLIAIVKYQTVIKRI-REGVCTRYLSVLRPGS--------TLKVQLQRGGL
D5GJW2_TUBMM      SFDEKIDLEILVAIVKYKTIIKKT-RQGVCTRWLASLKEGD--------PISVVFQHGTL
NDOR1_GIBZE       TDENKTRIELLVALVKYRTVLRKP-REGLCSRYLDNIPMNS--------TLTVTR-KPVL
C7Z4K6_NECH7      TDENITRVELLVALVKYRTILRKP-RQGLCSRYLENLPVGS--------SLTVTH-KPVL
NDOR1_SCHPO       -------LELAVALVKYQTILKSP-RQGICSRWICDLHENT--------SFNIDILPGFL
NDOR1_YEAST       -------IELTVAIVKYKTILRKI-RRGICTNYIARLQEGE--------QIRYKLQNNHI
NDOR1_CANGA       -------IELTVAIVKYKTILRKI-RTGVCTDFISKLKVGD--------KIRYKIQQNDL
NDOR1_ASHGO       -------IELTIAIVRYKTILRRI-RRGLCTNYISDLSEGS--------IIRYKVQYNDL
NDOR1_KLULA       -------VELTIAIVRYKTLLRKV-RKGLCTNYLLTLTEND--------TVRYKLQNNHL
NDOR1_CANAL       -------VELVVAIVEYKTIIRKI-RRGVCTRWLKNLKPGD--------QFLFSIQRSSF
NDOR1_DEBHA       -------VELIVAVVVYKTILRRV-RRGLCTKWIKSLQDND--------RIVFSIHKSNL
NDOR1_YARLI       -------IQLCVAIVKYQTIIKRI-REGVLTRWLGGLAIGQ--------KIVFTKHSTPI
NDOR1_DICDI       -------IHLTVGINTYTTPFRRLFRTGLCSQYFSSFLNDND-----NNIVPIFIKESGA
                         ..: :.   : :      * *: : ::  :             .         

Q7QK01_ANOGA      ---QLPADNKTPLVMIGPGTGLAPFRGILQER--ELSETPTSA---------PLVLFFGC
Q9VSJ5_DROME      ---VWPKDLSIPLIMVGPGTGIAPFRSIIQNRLYAQSKGATIG---------PLVVFFGC
A8XGQ2_CAEBR      ---RFPTP-DAPVICIGPGTGVAPFRSLFGQR----SQISPNS---------TGFLFFGC
G5EGH9_CAEEL      ---KFPSP-EAPVICIGPGTGVAPFRSLFGHR----SLFSAHF---------PGILFFGC
NDOR1_HUMAN       ---AFPETPDTPVIMVGPGTGVAPFRAAIQER---VAQGQTG-----------NFLFFGC
H2R066_PANTR      ---AFPETPDTPVIMVGPGTGVAPFRAAIQER---VAQGQTG-----------NFLFFGC
H2PU35_PONAB      ---AFPETPDTPVIMVGPGTGVAPFRAAIQER---VAQGQTG-----------NFLFFGC
I2CTQ1_MACMU      ---AFPETPDTPVIMVGPGTGVAPFRAAIQER---VAQGQTR-----------NFLFFGC
NDOR1_BOVIN       ---TFPKTPDVPVIMVGPGTGVAPFRAAIQER---VAQGETG-----------NVLFFGC
NDOR1_MOUSE       ---VFPKTPDTPIIMVGAGTGVAPFRAAIQER---VAHGQTG-----------NFLFFGC
D4ABT4_RAT        ---VFPKTPGTPIIMVGPGTGVAPFRAAIQER---VAHGQMG-----------NVLFFGC
H2T0C5_TAKRU      ---KFPKDKDIPVIMVGPGTGVAPFRSALQER---IPEGKHI-----------NVLFFGC
Q4SRM0_TETNG      ---KFPEDKDTPVIMVGPGTGVAPFRSALQER---IAEGKHS-----------NVLFFGC
NDOR1_DANRE       ---KFPQDPESPVIMVGPGTGVAPFRSAIQER---VAQGKMA-----------NVLFFGC
B1H2T7_XENTR      ---TFPLEPGTPLVMVGPGTGVAPFRAAVQER---AANGKRW-----------SCLFFGC
A7SZI6_NEMVE      ---SLPLDHTVPLLMIGPGTGVAPFRSFIEER---LVPVHEGS---------KCVLFFGS
B3RP54_TRIAD      ---TFPKTPT-SIILIGPGTGAAPFRSVIQDR---VIDGIKG----------KTVFFFGC
B7Q688_IXOSC      ---RMP-ANGAPTIMVGPGTGCAPFRAMIQDR---CWREVDG-----------NLLFFGG
H2Z1M3_CIOSA      ---RFPAKQH--CILIGPGTGIAPFRSAAHER---TSNGNAG-----------TTVFFGC
F4PE90_BATDJ      ---RLPVSIDTPIICIG--TGIAPIRSLLFSR---LAKGATE-----------NILFLGV
A9UT33_MONBE      ---RVPPP-EQRLICIGPGTGVAPFRSLLLDP---LRQAAAKH----------NVLIFGN
Q5JL61_ORYSJ      ---PPPHP-STPLILIGPGTGCAPFCAFVAERA-AQSTSEATA---------PILFFFGC
C5XJ39_SORBI      ---PPPRP-LVPLVLIGPGTGCAPFRAFVEERA-AQAAAEPTA---------AVMFFFGC
NDOR1_ARATH       ---PAPSQ-SLPLILVGPGTGCAPFRGFIAERA-VQAQSSPVA---------PVMFFFGC
NDOR1_CRYNJ       ---FLPQDPEVPIILVGPGTGVAPMRAFVEIR---VRQG----------AAKNTSLYFGC
NDOR1_USTMA       ---TLPP-AQAPLILIGPGTGCAPLRSLVIDR---LSNSTL--------ARSEIHLFLGF
E3K9U8_PUCGT      ---TFPQDPSQPVICIGPGTGIAPFRALIQDR---STHHISDVS-----SRPNALVFFGC
C0NDR4_AJECG      --TSSMRQFLEPTVLIGPGTGVAPLRSILWEKASMATTYREKHGLDVPVPIGPIILLYGG
J3K7C2_COCIM      --SPSVEQLLEPSVVIGPGTGVAPIRSLLWEKAALVEAYRNKHGPNVPSPVGPVILLYGG
NDOR1_EMENI       --NSSVGQLVGPTMLIGPGTGVAPLRSMLWEKAAIVKSYQEKN-PGVDPPIEPTILVYGG
NDOR1_ASPFU       --SSSVNQLVGPTVLIGPGTGVAPLRSMLWEKAAFVKAYREEH-PDANPPIGPTILLYGG
D5GJW2_TUBMM      VPHSTTELYNKPTVMIAPGTGVAPMRALLRERIFDKGHYLKNT------------LIFGC
NDOR1_GIBZE       SPIHGAQNAQRPLVAIATGTGLAPIRALLHERLTQPSPG-------------PMYLFFGN
C7Z4K6_NECH7      SPIHGPQNAQRPLVAIATGTGLAPIRALIHERLTHPSRA-------------PMHLFFGN
NDOR1_SCHPO       ---NLSYQSNKPLIMVGPGTGVAPLRALIQERIYNGLKEN--------------LLFFGC
NDOR1_YEAST       -IKKE--FLNKPMILVGPGVGLAPLLSVVKAEIS----KDIKL-------------LFGC
NDOR1_CANGA       -IKEE--YRSNPFVMVGPGVGLAPLLSAVRSKVS----PEMSL-------------YFGC
NDOR1_ASHGO       -LPAG--KQDRPVIMISPGVGLAPMKCLIYAQLF----NPMLL-------------FFGN
NDOR1_KLULA       -LHED--IIGKPIIMTSPGVGLAPMKCLIESNLF----KDQYL-------------FFGN
NDOR1_CANAL       -KYK---DDNSPIIMVAPGTGIAPMKSLIDEVIQNNSKQELYL-------------FFGC
NDOR1_DEBHA       -KFELPTTKYPPILMVSPGTGVAPMKSLIEHITSLGIQQHLYL-------------FYGC
NDOR1_YARLI       -PDL----DNYDVIMVAPGTGVAPMRSLILSRES---EKETVL-------------FFGN
NDOR1_DICDI       ---RLPKSNEIPIIMVGPGTGCAIFRSFMQERLYFKNNSDNNN------KLGDALFYFGC
                               :  .  .* * :                                 * 

Q7QK01_ANOGA      RSSTADFHCEEDLKRMEQSG-------MLQLFCAFSRDQP--EKVYVQHLIKK--EGMLL
Q9VSJ5_DROME      RNKAADFHFGNDFSTWTDAK-------QVEAHTAFSRDQD--QKVYVQHLIAK--NGAHL
A8XGQ2_CAEBR      RGEHDDFYFSEEWNKMEC----------VEVVAAFSRDTE--KKVYVQHKMGE--RARDI
G5EGH9_CAEEL      RSEHHDYYFSDEWPELSG----------VAVIPAFSRDTDG-RKVYVQHKMGE--NAGKI
NDOR1_HUMAN       RWRDQDFYWEAEWQELEKRD-------CLTLIPAFSREQE--QKVYVQHRLRE--LGSLV
H2R066_PANTR      RWRDQDFYWESEWQELEKRD-------CLTLIPAFSREQE--QKVYVQHRLRE--LGSLV
H2PU35_PONAB      RWRDQDFYWEAEWQELEKRD-------CLTLVPAFSREQE--QKVYVQHRLRE--LGSLV
I2CTQ1_MACMU      RWRDQDFYWEAEWQELEMRD-------CLTLVPAFSREQE--QKVYVQHRLRE--LGSLV
NDOR1_BOVIN       RRRDQDFYWEAEWEQLQARG-------CLTLVTAFSREQE--QKVYVQHRLRA--LGPLV
NDOR1_MOUSE       RQRDQDFYWQTEWQKLEQKG-------WLTLVTAFSREQE--QKVYVQHRLRE--LGPLV
D4ABT4_RAT        RQRDQDFYWQTEWQELEQRG-------CLTLVTAFSREQA--QKVYVQHRLRE--LGPLV
H2T0C5_TAKRU      RSESKDFYFRSEWEKAEKMG-------HLTLYTSFSRDQQ--EKVYVQHRVLE--NAKLL
Q4SRM0_TETNG      RSESKDFYFRSEWERAKQMG-------HLTLFTAFSRDQQ--EKVYVQHRVTE--NARLL
NDOR1_DANRE       RSESKDFYCGSEWQEKVQAG-------QMILVTAFSRDQE--DKVYVQHRVKE--QGKLL
B1H2T7_XENTR      RGKSKDFYFEKEWEDLVTGG-------FLTLFTAFSRDQE--DKVYVQRRIRE--NSALL
A7SZI6_NEMVE      RNKNADFFFENQWKELSETG-------CLSVFTAFSRDQD--DKIYVQHRIRE--QSSLI
B3RP54_TRIAD      RNQKKDFFCADEWHDFQNKG-------FVTIFTAFSRDQE--SKVYVQHKMLA--NGQLA
B7Q688_IXOSC      RSMKGDFFFEEEWSGLVARG-------LLELVTAFSRDQD--HKIYVQHRIAE--HKDRV
H2Z1M3_CIOSA      RKSSSDFYFRDEWEDLD-----------VDLHVACSRDQE--DKIYVQHRIKE--QGEKI
F4PE90_BATDJ      RGKHTDYLFGNEWDEMVANG-------TLQLFTAFSRDQD--HKVYIQHRIVD--QGALL
A9UT33_MONBE      RNREADFLFGDEWLAQAREH-------GLHLLLAFSRDEG--KKQYVQHVMAE--HEALL
Q5JL61_ORYSJ      RNQENDFLYKDFWYAHAHDQGVLSSKNGGGFFVAFSRDQP--QKVYVQHRIRE--QSARV
C5XJ39_SORBI      RNQDNDFLYKDFWLTHAQDEGVLSSKKGGGLFVAFSRDQP--QKVYVQHKIKE--HSSRV
NDOR1_ARATH       RNKDTDFLYRDFWESHAREGGMLSEGKGGGFYTAFSRDQP--KKVYVQHKIRE--MSKRV
NDOR1_CRYNJ       RSSTTDYFFESEWDVHRE--------KGVKIQVAASRDQE--ERIYVQHLIKR--DKEYV
NDOR1_USTMA       RYRTKDYLFQHDWQHLQQSY-----ANQFHLHTAFSRDGE--AKTYVQDLIVKPDNAHVL
E3K9U8_PUCGT      RAQDSDFYYREQWTQFVD-------LQICNFFWAASRDQE--NKRYVQDLIVE--NSALV
C0NDR4_AJECG      RNRRADFFFEEEWEALKDVL-------DLTVLTAFSRDQK--QKIYVQDRIRE--HARLI
J3K7C2_COCIM      RNRAADFFFQEEWNKLKETL-------DLTVFTAFSRDQK--HKFYVQDAIRQ--NKDAF
NDOR1_EMENI       RNRAADFFFEDEWQQLSDLI-------KLKVLTAFSRDQK--QKVYVQDVIRE--NSSLV
NDOR1_ASPFU       RNRAADFFFEEEWQELSDLI-------GLQVFTAFSRDQR--HKIYVQDIIRR--NFGLF
D5GJW2_TUBMM      RGKDTDFFFQEEWVELVRRD-------FLRLNTAFSRDQP--AKRYVQHVILE--QAGHL
NDOR1_GIBZE       RNREADYFFQQEFDALVTEG-------QLNVFLAFSRDQR--NKIYVQDRLLE--EAKRI
C7Z4K6_NECH7      RNRDADYFFHDEWDAAVRDG-------NLDVFLAFSRDQR--TKIYVQDLLRE--EAKRL
NDOR1_SCHPO       RNKSMDFLFEKDWEKYTEEG-------TLKLFCAFSRDQE--KKKYVQHSIQE--NGELV
NDOR1_YEAST       RYKDKDYIYKDMLEDWFRKGK-------IALHSSFSRDEEN-SPGVKYVQDYLWRLGEEI
NDOR1_CANGA       RFKDKDYLHGKELEDMANQGL-------IKFYPVFSRDREN-SPDTKYVQDVLWKFGEEV
NDOR1_ASHGO       RYKDKDFLYADTLQKWADENR-------IKLFVCFSRSPDD-SPGLKYVQDAVWENAREV
NDOR1_KLULA       RMKDKDFLYEDTLSMWKKEGK-------INLFTCFSRDPIN-SPHAKYVQDQLWNQSSLI
NDOR1_CANAL       RFKEKDNLIESFWHGNENQN--------LHLVSAYSRD--S-NSKYRYVQDALFAHSELI
NDOR1_DEBHA       RNKENDYLFGDLWASLKSQNK-------LSIYPCFSRD--Q-DSKIKYVQHKIYEQHELV
NDOR1_YARLI       RFREKDFLFQADLEKAVGDKK-------LNLFTSFSRD--E-NS-GGYVQQEMYRQKELV
NDOR1_DICDI       RSESKDYYYRDEFESNLEKGI------ISKLSVAFSRDGKDGKKVYVQQYIEN--DSDLI
                  *    *                             **.                      

Q7QK01_ANOGA      KKLLIENGGYVLVSGSSKNMPQAVKEALIEAI-G--------------------------
Q9VSJ5_DROME      ARLIKDLNAYIYVAGNSNNMPKSVKEAFIEILDG--------------------------
A8XGQ2_CAEBR      KKMLD-SGASVFIAGSSGDMPKAVASVLAQIQ----------------------------
G5EGH9_CAEEL      KRMLD-LGAQVFIAGSSGDMPKAVSAVLAQIQ----------------------------
NDOR1_HUMAN       WELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEG-G----------------------
H2R066_PANTR      WELLDHQGAYFYLAGNAKSMPADVSEALMSIFQEEG-G----------------------
H2PU35_PONAB      WELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEG-G----------------------
I2CTQ1_MACMU      WELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEDG-G----------------------
NDOR1_BOVIN       WELLDGRGAHFYLAGNAKYMPADVCDTLLSIFREEG-G----------------------
NDOR1_MOUSE       WELLDGQGAYFYLAGNAKYLPTDVSEALMSIFQEEG-R----------------------
D4ABT4_RAT        WELLDGQGAYFYLAGNAKYMPTDVSEALTAIFQEEG-R----------------------
H2T0C5_TAKRU      WDLIASKNGCFYIAGNAKQMPASVCDALSKVFQQEG-G----------------------
Q4SRM0_TETNG      WELITKKKGCFYIAGNAKQMPASVRSALKEVFQQEG-T----------------------
NDOR1_DANRE       WDLIAKKNAFFYIAGNAKQMPTSVCDALKAVFQKEG-G----------------------
B1H2T7_XENTR      WDLLANRQGYFYIAGNAKSMPNEVTDALKWVLQSEG-G----------------------
A7SZI6_NEMVE      WDLINNHRAICYLAGNSKRMPIDVKEALIEVFCK-G-E----------------------
B3RP54_TRIAD      FKNIYEDRAYIYVAGNSKRMPTDVTDTLVAIVKKYG-N----------------------
B7Q688_IXOSC      LKLLS-EGGVIYIAGNAKDMVPDVRSTFRALLKEAG-S----------------------
H2Z1M3_CIOSA      WRLVSDENASVFVAGNSKSMPDDVKSTFLEIFRVHG-A----------------------
F4PE90_BATDJ      WNLIDHQDAVVFLSGNAKQMPSDVADAFRQVFRTHG-K----------------------
A9UT33_MONBE      WESL-QAGASILLAGNANQMPKAVRDAFLDTVRRKG-G----------------------
Q5JL61_ORYSJ      WNLLK-SGAAIYIAGSSTKMPADVTAALEEVICQET-G----------------------
C5XJ39_SORBI      WNLLL-SDAVIYIAGSSTKMPADVTAALEEVICKEG-G----------------------
NDOR1_ARATH       WDLLC-DGAAVYVAGSSTKMPCDVMSAFEDIVSEET-GG---------------------
NDOR1_CRYNJ       KEWIVDKKGWLFISGSSNAMPREVREAVAWCISKEGAGD---------------------
NDOR1_USTMA       WEAITERNAWIVVAGASGKMPEQVRGAFESIARSQ--GG---------------------
E3K9U8_PUCGT      WEYMAVRNASIFISGSAGEMPKGVRSALKKVCVGQ--GG---------------------
C0NDR4_AJECG      SRILHDLGGTVYICGSSGKMPQAIREALIEGFQELGQENESGE-----------------
J3K7C2_COCIM      FRVLHDMQGAVFICGSSGRMPQAVREALIETFETRGS-----------------------
NDOR1_EMENI       FNLLHDKGGAVFVCGSSGRMPQAVRETLTEAFQYGNDAG---------------------
NDOR1_ASPFU       FRLLHDMNGSVYICGSSGRMPQAVREALIEAFEHGGQAD---------------------
D5GJW2_TUBMM      WERIFKQGAVVYVCGSSGNMPIAVREALIKVFQEKGE-----------------------
NDOR1_GIBZE       EEVIFD-NGIFCVCGGSTKMADAAKKAVFEPFSEDVK-----------------------
C7Z4K6_NECH7      EGPIMD-NGIFCVCGGSTKMADAAKRAVFDPFSEGAE-----------------------
NDOR1_SCHPO       YNLLNEKDGMFFVSGSSGKMPSSVKDAIAGIVSKYSGC----------------------
NDOR1_YEAST       TNLVVNKDAVFFLCGSSGKMPIQVRLTFIEMLKKWGNF----------------------
NDOR1_CANGA       TNLLVERKGIFFLCGASGKMPIQIRLTLLEMLKKWGGF----------------------
NDOR1_ASHGO       ARLITEENAVVYVCGSSGKMPVQVRLTLCEVLKKWGNF----------------------
NDOR1_KLULA       ADLILKKSAIVYICGSSGKMPVQVRLTIVEILKKHGNF----------------------
NDOR1_CANAL       GKLLIEQNAKVFVCGSSGKMPREVKITFVEIVKKFTGM----------------------
NDOR1_DEBHA       GDLILNQNAIVFICGSSGAMPREVRITLVEILMKFGKM----------------------
NDOR1_YARLI       ARVLCSKQGVLYVCGSSGKMPREVRITVVTCIQEVNGW----------------------
NDOR1_DICDI       WDIINNRNGYFYISGSSGRMPKDVKQSLLTIIKSNLLKNNNNNNNNNNNNNNNNNNNNNN
                     :    .   :.* :  :       .                                

Q7QK01_ANOGA      ------------DAQHIEKMIQTNRYQEETWA
Q9VSJ5_DROME      ------------DADYVELMIKQRRYQEETWA
A8XGQ2_CAEBR      ------------GGEWTKKAEETGRIQYETWS
G5EGH9_CAEEL      ------------GDEWTRRAEETGKIQYETWS
NDOR1_HUMAN       -------LCSPDAAAYLARLQQTRRFQTETWA
H2R066_PANTR      -------LCSPDAAAYLARLQQTRRFQTETWA
H2PU35_PONAB      -------LCSPDAAAYLARLQRTRRFQTETWA
I2CTQ1_MACMU      -------LCSPDAAAYLARLQRTQRFQTETWA
NDOR1_BOVIN       -------LSDPDAAAYLAQLQRTLRFQTETWA
NDOR1_MOUSE       -------LSTADASAYLARLQQTLRFQTETWA
D4ABT4_RAT        -------LSTTDAAAYLARLQQTLRFQTETWA
H2T0C5_TAKRU      -------LSSEDAIQMLAIMEKSGRLQCETWS
Q4SRM0_TETNG      -------LSSEAAEQMLVVMENSGRLQCETWS
NDOR1_DANRE       -------MSENQAQEMLDGMEKNGRFQSETWS
B1H2T7_XENTR      -------LSAPDAEQYVVAMEKSRRFQSETWS
A7SZI6_NEMVE      -------MSESEAEALFAELERTRRYQAETWS
B3RP54_TRIAD      -------KSESEAEEYIRNLQQSKRLQMDTWS
B7Q688_IXOSC      -------LTEDAAEELLKNFERSRRLQIEAWS
H2Z1M3_CIOSA      -------MTSQEADDYCRTMQSVKRYQQETWS
F4PE90_BATDJ      -------LNQADADRYMVELEKTRRYQQECWA
A9UT33_MONBE      -------LDGAAAEAYVAQLEKTGRYQVETWS
Q5JL61_ORYSJ      -------CSEEEASIWLRKLERNGKFHTETWS
C5XJ39_SORBI      -------VKQEDASKWLRDLERAGRLNIETWS
NDOR1_ARATH       -------GSKEVASRWLKALEKTGRYNVEAWS
NDOR1_CRYNJ       -------MTEEESKAYVEQMFEDKRGGEESW-
NDOR1_USTMA       -------MDEEQAKRFMDALERQRRWQEECWG
E3K9U8_PUCGT      -------LDQTGADEFIERLEALGKLQEDTWS
C0NDR4_AJECG      ----RKKYSREEAEKYLMDMEKVGRYKQETW-
J3K7C2_COCIM      --------SREEAEKYLIDMERVGRYKQETW-
NDOR1_EMENI       ----TQPFSRREAEDYLVGMEKTGRYKQETW-
NDOR1_ASPFU       ----GPQLARRGAEEYLIGMEKSGRYKQETW-
D5GJW2_TUBMM      -------WEKEVAVAYLAHMEKEGRFRQETW-
NDOR1_GIBZE       --------DVEERKKMLASLT----WWQEIW-
C7Z4K6_NECH7      --------DVEERKKVLSTLT----WWQEIW-
NDOR1_SCHPO       --------SISDGYSFVTSLEKKNRYYQETW-
NDOR1_YEAST       -------SDEETAKKYLKEMEKSDRYIQETW-
NDOR1_CANGA       -------KDDASAKEYLRSMEKEYRYIQETW-
NDOR1_ASHGO       -------PDDKASEEYLKDMENSDRYLQETW-
NDOR1_KLULA       -------ENAEEAEHYLKEMERTDRYMQETW-
NDOR1_CANAL       -------DEG-DAQKYIIGLEDNGRYKEDAW-
NDOR1_DEBHA       -------KDT-EADDYLMDMENGGRYLQETW-
NDOR1_YARLI       -------TEE-QAEEWVKGMEKSGRYLQETW-
NDOR1_DICDI       NNNDDENNIDEIVNNYFEKLEVEKRFITETW-
                                              : *