CLUSTAL format seed alignment for MF_03181

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PAN3_ASHGO            --------------------------------------------MMMNKSKTDWA-----
PAN3_KLULA            --------------------------------------------MISSASGTNWNRPDSF
PAN3_CANGA            ----------------------------------------------MDKINPDWA-----
PAN3_YEAST            ----------------------------------------------MDKINPDWA-----
PAN3_CANAL            -----------------------------------------------MNINLDTA-----
PAN3_LODEL            -----------------------------------------------MNINLDSA-----
PAN3_DEBHA            -----------------------------------------------MNINLDSA-----
PAN3_PICST            -----------------------------------------------MNLNLDSA-----
PAN3_PICGU            -----------------------------------------------MNINLDSA-----
C0NEU6_AJECG          ------------------------------------------------------------
PAN3_COCIM            ------------------------------------------------------------
PAN3_NEOFI            ------------------------------------------------------------
PAN3_ASPFU            ------------------------------------------------------------
PAN3_ASPCL            ------------------------------------------------------------
PAN3_ASPOR            ------------------------------------------------------------
PAN3_ASPTN            ------------------------------------------------------------
PAN3_ASPNC            ------------------------------------------------------------
PAN3_EMENI            ------------------------------------------------------------
PAN3_PHANO            ------------------------------------------------------------
PAN3_CHAGB            ------------------------------------------------------------
PAN3_NEUCR            ------------------------------------------------------------
PAN3_MAGO7            ------------------------------------------------------------
Q17PM7_AEDAE          ------------------------------------------------------------
Q7Q6T6_ANOGA          ------------------------------------------------------------
PAN3_DROME            ------------------------------------------------MCSTYGLLSFEF
Q29E31_DROPS          --------------------------------------------------MSTFLNNFFP
A8XA39_CAEBR          ------------------------------------------------------------
PAN3_CAEEL            ------------------------------------------------------------
G3NFD9_GASAC          ------------------------------------------------------------
I3K9I0_ORENI          ------------------MNSGLSPSAAPLGGAG----------------IPNVKVKFCR
H2SNS4_TAKRU          ------------------------------------------------------------
E7EXP6_DANRE          ------------------MNSGLPASAAPLGGVG----------------IPGVKVKFCR
H2LXY8_ORYLA          ------------------------------------------------------------
F1P381_CHICK          ------------------------------------------------------------
H0ZN09_TAEGU          ------------------------------------------------------------
G1KIR2_ANOCA          ------------------------------------------------------------
PAN3_HUMAN            MNSGGG--LPPPS----AAASPSSSSLAAAVAVV--APPGVGGVPGG--AAVGVKLKYCR
H2RA81_PANTR          MNSGGG--LPPPS----AAASPSSSSLAAAVAVV--APPGVGGVPGG--AAVGVKLKYCR
PAN3_MOUSE            MNSGGGGGLPPPS----AAASPSSSSLAAAVAVAVAASSGVGGVPGGPAAAAGVKLKYCR
F1RSU6_PIG            MNSGGG--LPPPS----AAASSSSSSLAAAVAVV--APPGVGGVPGG--AAAGVKLKYCR
F1PKU0_CANLF          MNSGGG--LPPPS----AAASPSSSSLAAAVAVV--APPGVGGVPGG--AAAGVKLKYCR
G1QHX6_NOMLE          MNSGGG--LPPPT----AAASPSSSSLAAAVAVV--APPGVGGVPGG--AAVGVKLKYCR
H2NJI2_PONAB          ------------------------------------------------------------
F6Y6Y5_MACMU          ------------------------------------------------------------
G1U195_RABIT          ------------------------------------------------------------
D4ADM2_RAT            ------------------------------------------------------------
H0VNI8_CAVPO          ------------------------------------------------------------
F7FR09_MONDO          MISGSGGLPPPQPSPSSSAAASSTSSAAAAVVVAPPGVGGVPSVVGGAAAAAGVKLKYCR
PAN3_XENTR            ------------------MNSGLTPSPSPAVAAA------------GPAGVPGSKLKFCR
H3BC88_LATCH          ------------------MNSGLPSSAAPLAGIG----------------VAGGKVKYCR
Q4S571_TETNG          ------------------------------------------------------------
C3XW74_BRAFL          ------------------------------------------------------------
W4XCT7_STRPU          ------------------------------------------------------MRSFSE
PAN3_DICDI            ------------------------------------------------------------
F4P6Y9_BATDJ          ------------------------------------------------------------
A8NJ49_COPC7          ------------------------------------------------------------
PAN3_CRYNJ            ------------------------------------------------------------
A0A0D1E1J8_USTMA      -----------------------------------MYPYSQSQQPPYHHPHKQQSQPPPH
PAN3_YARLI            ------------------------------------------------------------
B6K186_SCHJY          ------------------------------------------------------------
PAN3_SCHPO            ------------------------------------------------------------
                                                                                  

PAN3_ASHGO            KDTPCKNITIYGYCKYENDGCIFNHGKP-----------------------------LST
PAN3_KLULA            KGTQCRNIIIHGYCKFENEGCQFNHGN---------------------------------
PAN3_CANGA            RDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQQPSKISVSS
PAN3_YEAST            KDIPCRNITIYGYCKKEKEGCPFKHSD---------------------------------
PAN3_CANAL            KDTLCKNILIYGYCKYENKGCAFSHNRQQPAQQQQ------------------------A
PAN3_LODEL            KDVLCKNILIYGYCKFQDKGCAFSHNKQLTTPQQQQ---------------QQQQIEEEE
PAN3_DEBHA            KDTFCKNVLIYGYCKYENKGCAFSHTVKPTSSVPG-------------------------
PAN3_PICST            KDTLCKNILIYGYCKFENKGCAFSHH-KPNVGQPP-------------------------
PAN3_PICGU            KGTLCKNILIYGYCKYENKGCAFSHRRNNNANSGP-------------------------
C0NEU6_AJECG          ------------------------------------------------------------
PAN3_COCIM            ------------------------------------------------------------
PAN3_NEOFI            ------------------------------------------------------------
PAN3_ASPFU            ------------------------------------------------------------
PAN3_ASPCL            ------------------------------------------------------------
PAN3_ASPOR            ------------------------------------------------------------
PAN3_ASPTN            ------------------------------------------------------------
PAN3_ASPNC            ------------------------------------------------------------
PAN3_EMENI            ------------------------------------------------------------
PAN3_PHANO            ------------------------------------------------------------
PAN3_CHAGB            ------------------------------------------------------------
PAN3_NEUCR            ------------------------------------------------------------
PAN3_MAGO7            ------------------------------------------------------------
Q17PM7_AEDAE          -----MDPIFFSPPNGVPSESKLATYMSRQNVSTPT---YGLSTGLSKLTLDSPIS--IK
Q7Q6T6_ANOGA          -----MDPIFFSPSNGVPSESKLATYM---------------------------------
PAN3_DROME            SDTAAMDPIFFSPTNGIPSESKLATYMNRQNVATPS--GYGLNNGFSLLNLDSPL---NK
Q29E31_DROPS          ADTAAMDPIFYSPTNGIPSESKLATYMNRQNVATPSSGGFGLNSGFSLLNLDAPLAAVNK
A8XA39_CAEBR          ----------MQSNEGYQFDG---------------------------------------
PAN3_CAEEL            ----------MQPGEGYHYDS---------------------------------------
G3NFD9_GASAC          ------------------------------------------------------------
I3K9I0_ORENI          YYAKDKTCFYGDECQFLHEDPSLASLPLHGGG--------GSPVPLSMAGGG-GTLCKQL
H2SNS4_TAKRU          ------------------------------------------------------------
E7EXP6_DANRE          YYAKDKTCFYGDECQFLHEDPSMASLSLHGGGTGAGGGGGGSPVSLSLAGGAVTAAGYVL
H2LXY8_ORYLA          ------------------------------------------------------------
F1P381_CHICK          --------------MLSPHIPHSGDCTASGANNATEENLRTSREAVQVTHRSLNEHTRCS
H0ZN09_TAEGU          ------------------------------------------------------------
G1KIR2_ANOCA          ------------------------------------------------------------
PAN3_HUMAN            YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVA-----GFPPGAVAG
H2RA81_PANTR          YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVA-----GFPPGAVAG
PAN3_MOUSE            YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAAAAGA-----AFPPGALPG
F1RSU6_PIG            YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPGA-----GFPPGAVPG
F1PKU0_CANLF          YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVA-----AFPPGAVPG
G1QHX6_NOMLE          YYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPPSLVGAPVA-----GFSPRAVAG
H2NJI2_PONAB          ------------------------------------------------------------
F6Y6Y5_MACMU          ------------------------------------------------------------
G1U195_RABIT          -------------------------------------------MPG-----FASGAAAPA
D4ADM2_RAT            ------------------------------------------------------------
H0VNI8_CAVPO          ------------------------------------------------------------
F7FR09_MONDO          YYAKDKTCFYGEECQFLHEDPVAGAVPGLGLHSNSVPLALAGGGAATPGPAGYPLGAGPG
PAN3_XENTR            YYAKDRTCFYGDECQFLHDDQLGGIHG-----NGNSPLSLPGGGPA-----------AVY
H3BC88_LATCH          YYAKDKTCFYGDECQFVHEDPAA----GLGLHSNSVPLPMAGSGGV-----------AGG
Q4S571_TETNG          ------------------------------------------------------------
C3XW74_BRAFL          -----MQWLAGEDGKVLGRVPLWCRRLCRGETATLSFPSSSSNALCK---------REEG
W4XCT7_STRPU          TIGKIDQVADPHMADHFFNAPFDSDNYGPQTSKLQHLMQRSHSVGSS-------LSTYTG
PAN3_DICDI            -MMYQQQPKNQKQCKNIALHGYCRNSDKCEFSHELTPQQQQQQQQQ------------QQ
F4P6Y9_BATDJ          ------------------------------------------------------------
A8NJ49_COPC7          -------------------------------------------------------MSYFV
PAN3_CRYNJ            ---------------------------------------------------------MLP
A0A0D1E1J8_USTMA      FNHTHHPPSLPHPSQQQHNQPYAQQTTSSTHLHSRPAMQQHHHSQHQIQSSAFNGALPPR
PAN3_YARLI            ------------------------------------------------------------
B6K186_SCHJY          ------------------------------------------------------------
PAN3_SCHPO            ------------------------------------------------------------
                                                                                  

PAN3_ASHGO            SSNTGGAAAGSAEDS------------------------AASGGVTVGN-TGKSTFNAKT
PAN3_KLULA            SKETEGQTTDEVPTQ------------------------RSMTPLNV-------KFNAKT
PAN3_CANGA            LPSLNSQPSSTAPTS------------------------APNATAHTGSKSQVPKFNAKA
PAN3_YEAST            --NTTATTINDVPPP------------------------IDVGEATTPTMTSVPKFNAKV
PAN3_CANAL            TNTSNNSTSVITPNS--------------------------ANSTASSADLSSKKKFNLN
PAN3_LODEL            ESIRQGGTAVGVPGSQRNKGAG----------AGTGAKAIQSNGMVNSQETQSKRRFDAN
PAN3_DEBHA            ---SQGSNATTNSSG--------------------------------NTNADMKKKFNFN
PAN3_PICST            ---VSASSSSGYSGN--------------------------------SSPAEAKRKFNLN
PAN3_PICGU            -----GATPAKSVAT---------------------------------TPTSDKRKFNVN
C0NEU6_AJECG          -------------------------------------------------MASAGKA----
PAN3_COCIM            -------------------------------------------------MASAGKP----
PAN3_NEOFI            -------------------------------------------------MASAGKP----
PAN3_ASPFU            -------------------------------------------------MASAGKP----
PAN3_ASPCL            -------------------------------------------------MASAGKP----
PAN3_ASPOR            -------------------------------------------------MASAGKP----
PAN3_ASPTN            -------------------------------------------------MAS--------
PAN3_ASPNC            -------------------------------------------------MATTGKSA---
PAN3_EMENI            -------------------------------------------------MASVGKP----
PAN3_PHANO            -------------------------------------------------MATTFGS----
PAN3_CHAGB            -------------------------------------------------MAATRYP----
PAN3_NEUCR            -------------------------------------------------MAATRYN----
PAN3_MAGO7            -------------------------------------------------MATTRYN----
Q17PM7_AEDAE          KTQVTPQSPEFIPNNR---------------------------------LNTSSSPNFYS
Q7Q6T6_ANOGA          ---VTPQSPEFIPNNR---------------------------------LSTSSSPNFYS
PAN3_DROME            KSQVTPQSPEFIPTR------------------------------------LGSTPNFYA
Q29E31_DROPS          KSQVTPQSPEFIPTR------------------------------------INSSPNFYA
A8XA39_CAEBR          ---GPNQGPGQGQGQG---------------------------------LPAGSRLNQYL
PAN3_CAEEL            ---GPNN---AVHPHQ---------------------------------LPAGSRLNQYL
G3NFD9_GASAC          -------------------------------------------------MEGATLSD---
I3K9I0_ORENI          SLTDVGLASVLICKTLLLLSS------------------------TVPGMEGATLSD---
H2SNS4_TAKRU          -------------------------------------------------MDAATLSD---
E7EXP6_DANRE          GGSAASGVPASVSKKNDSLGPE-------------------GQLLSIPGMEGGALNE---
H2LXY8_ORYLA          -------------------------------------------------MEGATLSD---
F1P381_CHICK          VENHLSKATQPEDS-------------------------LQAEGNLVPGMDGGGLAD---
H0ZN09_TAEGU          -------------------------------------------------MDGGGLAD---
G1KIR2_ANOCA          ---------------------------------------MDGPRLAIPGIDGGALGE---
PAN3_HUMAN            GGAGPPPGPKKPDLGDPGTGAA--------AGGGGSSGGLDGPRLAIPGMDGGALTD---
H2RA81_PANTR          GGAGPPPGPKKPDLGDPGTGAA--------AGGGGSSGGLDGPRLAIPGMDGGALTD---
PAN3_MOUSE            GGAGPPAGPKKPELGVPGAATA--------GGG------LDGPRVAIPGMDGGALTD---
F1RSU6_PIG            GGAGPPPGPKKPDLGGPGAGAA--------VGGGGGSGVLDGPRLAIPGIDGGALTE---
F1PKU0_CANLF          GGAGPPPGPKKPDLGGPGAGAT--------AGGGGSSGVLDGPRLAIPGIDGGALTD---
G1QHX6_NOMLE          GGNRTPPGPKKPDLGDPGTGAA--------AGGGGSSGGLDGPRLAIPGMDGGALTD---
H2NJI2_PONAB          -------------------------------------------------MDGGALTD---
F6Y6Y5_MACMU          -------------------------------------------------MDGGALTD---
G1U195_RABIT          GGAGPLPGPKKPDLGGSGAGAASSSSSGGGGGGGGSSGGLDGPRLAIPGMDGSALTD---
D4ADM2_RAT            -------------------------------------------------MDGGALTD---
H0VNI8_CAVPO          -------------------------------------------------MDGGALTD---
F7FR09_MONDO          GGVGPPPGPKKPDMGGPGGGAGGAGGGAAAGGGG---GGLDGPRLTIPGIDGGALTD---
PAN3_XENTR            PQPVTPVGSKKLDLAG-----------------------LEAQRLAIPGLDGGAIPD---
H3BC88_LATCH          YPHGGVAGPKKSELGAPGGG-------------------LEGQLLTIPGMDGGALTD---
Q4S571_TETNG          -------------------------------------------------MDAASLSD---
C3XW74_BRAFL          WKKRGRNGGQ--------------------------------------VKKPTTLST---
W4XCT7_STRPU          SPGSSAPGGQKRDESPS----------------------------FQPGQPGVALSTNDL
PAN3_DICDI            QQQQQQQQQQQQQQQQ---------------------------------QQQQQQQNSNG
F4P6Y9_BATDJ          ---------------------------------------------------MESSPNRTA
A8NJ49_COPC7          RAQSTPVKIARPPTTEP--------------------------------ESPKQS-----
PAN3_CRYNJ            PPKSAAVQIVRPPSPSS--------------------------------EKAKEKE----
A0A0D1E1J8_USTMA      PTRSSAIPIVAPASTPA--------------------------------PPAAPSKSAIS
PAN3_YARLI            ----------------------------------------MQVCVNFIQRRATELQPKVI
B6K186_SCHJY          ------------------------------------------------------------
PAN3_SCHPO            ----------------------------------------------------MSVRKNSP
                                                                                  

PAN3_ASHGO            ATSFTP----------SVAIPDFNNIPSFTPERIVS-----------------SPAGDGA
PAN3_KLULA            SSSFTPGK------SPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMNSNA
PAN3_CANGA            SASFTPMSKAAD-GTQETQAPYLESPVAGSPGPILKAGTPVS--FMQPNIYSTTPVPSPA
PAN3_YEAST            SASFTPMTVGSDSLTTVTNTTSAATNATGNIAMAATSATASTVNPMINPIVNSSLVNNNN
PAN3_CANAL            TPSFQPSV--------SNLSNKFSTLSPKLKEIPVFKPEN----GVSEPDTVDS-----P
PAN3_LODEL            SPLFQPAVNNAKGTAVTNLASKFSNLSPRIRDAPVFKPENESPISQELNSKLAT-----S
PAN3_DEBHA            TPSFQPST-------VPNLTNKFSNLSPNLKEIPVFVPSGGM--SNADSGGMNE-----P
PAN3_PICST            TPSFQPSN-------VQNITSKFAALSPKVKEIPVFVPSGGS--GGAANTPNNG-----A
PAN3_PICGU            TPSFQPST-----APVQGLANKFAGLSPKVKDIPVFVPSGTPASPAQSTPSTGNQEQPMP
C0NEU6_AJECG          -------NFDDSRRTTGSPKLKGRENAKDTLCRNVTIYGRCRYEDKGCAFNHDPHRGNAP
PAN3_COCIM            -------NIDDGRRGTSSPKLKGRDHAKDTLCRNVTIYGRCRYEDKGCVFNHDPSRVNDA
PAN3_NEOFI            -------ALDDSRRGTGSPKIKARENAKDTLCRNITIYGRCRYEDKGCAFNHDPHKVNSS
PAN3_ASPFU            -------ALDDSRRGTGSPKIKGRENAKDTLCRNITIYGRCRYEDKGCAFNHDPHKVNSS
PAN3_ASPCL            -------ALDDSRRGTGSPKMKARENAKDTLCRNVTIYGRCRYEDKGCAFNHDPLKVNSA
PAN3_ASPOR            -------TLDDSRRATGSPKMKARENAKDTLCRNVTIYGRCRYEDKGCAFNHDPHKVNTT
PAN3_ASPTN            ----------DSRRGTGSPKMKGRENAKDTLCRNVTIYGRCRYEDKGCVYNHDPNKTNSA
PAN3_ASPNC            -------TLEDARHGTGSPKMKGRENAKDTLCRNVTIYGRCRYEDKGCAFNHDPHKVNSG
PAN3_EMENI            -------SLEDARRGTGSPKMKARENAKDTLCRNVTIYGRCRYEDKGCAFNHDPHKNSNQ
PAN3_PHANO            -------PSGDSRRGVASPRPKGRE-AKNTFCRNVTIYGHCRYENSKCRPPHLPDHVLNQ
PAN3_CHAGB            --------PNDLRRQVGSPRSKGR-ENKDTLCRNILIYGNCRYEDQGCTFNHDQNKNPSP
PAN3_NEUCR            --------SGDLRRQVGSPRAKNR-DTKETLCRNVVIYGHCRWEDSGCTFNHDQNKASVS
PAN3_MAGO7            --------SNDFRRQLGSPRPKGRADTKDTLCRNILIYGHCRYEDAGCAFNHDQTKKS-P
Q17PM7_AEDAE          SYSILAG--SNGSGQVVGASGGAGNGNAVITSNNGTTVVVATPGSTGGSVPGPVPVQTQA
Q7Q6T6_ANOGA          SYSILSS--SNGSAGSNGSTAAVAAQPPSQQATVVPAAVLSSVVKSGGVVTNGGYVGPGR
PAN3_DROME            PYHNAPMQLSNGLNGVNGLTAAAAAAAAAAAAAAAAVPSSTSSASSASVTISKTANGGAS
Q29E31_DROPS          PYHNTPMQLSNGLNGVNGLAGSGAAAAAVAPASTAAAVAAASAA--AAVPISKSANGSSS
A8XA39_CAEBR          ANNSRQALLTGPSFGPGTPINVNAPIFIPKHQQPQPP--PPPPPAVNQFAQLAIHDVPVQ
PAN3_CAEEL            ANNNRQ----GPSFGPGTPINVNAPVFVPKHQQPQPAQVAAPPPMVNQFAQLSIHDVPHQ
G3NFD9_GASAC          -ANLTNSYFSSSFIGVNGFGSPAETKYSMMQ-RMTTSSSSPS-LNDCAKNFSRSTH-DPV
I3K9I0_ORENI          -ANLTNSYFSSSFIGVNGFGSPAEPKYSMMQ-RMTTSSSSPSLLNDGAKNFSHSTH-DPV
H2SNS4_TAKRU          -ASLTNSYFSSSFIGVNGFGSPAEPKYSMMQ-RMTTSSSSPSLLNEGVKNFSHSTH-DPV
E7EXP6_DANRE          -ASLTNSYFSSTFIGVNGFGGPAESKYSMMQ-RMTSSSSSPSLLNDGAKSYSHSTH-DPV
H2LXY8_ORYLA          -ANLNNSYFSSSFIGVNGFGSPAESKYSMMQ-RMTTSSSSPSLLNDGAKNFSHSTHADPV
F1P381_CHICK          -ASLTDSYFSTSFIGVNGFGSPAESKYPMMQ-RMTNSSSSPSLLNDSAKQYA--GH-DPL
H0ZN09_TAEGU          -ANLTDSYFSTSFIGVNGFGSPAETKYPMMQ-RMTNSSSSPSLLNDSAKQYA--GH-DPL
G1KIR2_ANOCA          -PSLTDSYFSTSFIGVNGFGSPAEAKYPMMQ-RMTNSSSSPSLLNDSAKPYA--GH-DHL
PAN3_HUMAN            -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYS--AH-DPL
H2RA81_PANTR          -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYS--AH-DPL
PAN3_MOUSE            -ASLTESYFSTSFIGVNGFGSPVETKYPLMQ-RMTSSSSSPSLLNDSAKPYT--GH-DLL
F1RSU6_PIG            -SSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYA--GH-DPL
F1PKU0_CANLF          -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYA--GH-DPL
G1QHX6_NOMLE          -TSLTDSYFSTSFIGVNGFGSPVDTKYPLMQ-RITNSSSSPSLLNDSAKPYS--GH-DPL
H2NJI2_PONAB          -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYS--GH-DPL
F6Y6Y5_MACMU          -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYS--GH-DPL
G1U195_RABIT          -SSITDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYT--GH-DPL
D4ADM2_RAT            -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTSSSSSPSLLNDSAKPYT--GH-DPL
H0VNI8_CAVPO          -TSLTDSYFSTSFIGVNGFGSPVETKYPLMQ-RMTNSSSSPSLLNDSAKPYT--GH-DPL
F7FR09_MONDO          -STLTDSYFSTSFIGVNGFGSPGENKFPMMQ-RMTNSSSSPSLLNDSAKPYA--SH-DPL
PAN3_XENTR            -TSLTDSYFSTSFIGLNGFGSPGEATYPRMQQRMTNSSSSPSLLNDSAKPYA--AH-DPL
H3BC88_LATCH          -ASLTNSYFSSSFIGVNGFGSPADAKYPMMQ-RMTNSSSSPSLL-DSAKPYA--SH-DPL
Q4S571_TETNG          -ASLTNSYFSSSFIGVNGFGSPAESKYSMMQ-RMTTSSSSPSLLNEGVKNFSHSTHGRCL
C3XW74_BRAFL          -LPLADAPSSTPSTPPRDASADDDSWESLPN---SNSSPNVNGAVQNARPFF-PAEGQAP
W4XCT7_STRPU          SSNFSNMHLNMALEGMEFVPGAQNTPKSEFQPRNSRGDFQPPPQQPPPSAMS-----VPP
PAN3_DICDI            NGSNNTATSNNPIISPNSNIASPLKKSPIDNLTTSFQNLSTNQQTNHHWADHFQSGIPEY
F4P6Y9_BATDJ          RTPTSAALHQSKNRQCRNVLIHGHCRFEGKGCQFLHSTSTAVAATTIKDSKHKPGSAAIP
A8NJ49_COPC7          -------------------AGQTRKDSVQRQCRNIVIYGHCKYQDKGCIYYHPPTEPEPP
PAN3_CRYNJ            -----------------KKHSPEKRETAQRICRNVMIYGYCKYQDQGCIYYHPPAGADPS
A0A0D1E1J8_USTMA      YGAATAVGTPPQSETPKSPIASNANASARKPCRNVAIYGNCKYQNDGCPFDHASASTSSS
PAN3_YARLI            LINRLSAHLSTSPSPPLPHPLVTTSHTPVGALTPKPPNTSFGSHHQVSIAMPKFNINSPS
B6K186_SCHJY          -MGSPNNQKQQEIRSP-------KLKNKKTLCRNILLYGHCKFSDKTCQFRHDISSPANS
PAN3_SCHPO            ASPKPTSRSRESSRSPSVTDLKDHSKAKRTLCRNILLYGSCKHSENGCAFRHDGPFIPSS
                                                                                  

PAN3_ASHGO            TAFTPSFNPYGSDSFNPSANVSGPGSA---------------------------------
PAN3_KLULA            TAFAPSFNPYASESFTPSVSAGGIPSS---------------------------------
PAN3_CANGA            SMAMPNVVMPPNDMGSPDLGLQQQSHM---------------------------------
PAN3_YEAST            NNSNISISIPTTASSSNYDPFNAPIFT---------------------------------
PAN3_CANAL            TTQRPFT-SKRFNVSTPSFTPTNFDFANNSNADGNRG-----------------------
PAN3_LODEL            GLGSIYS-SKKFNASTPSFTPTGFDFSVAAQVGNNPGS----------------------
PAN3_DEBHA            EMNDSVTPNKKFNASTPSFMPSNPYISNND------------------------------
PAN3_PICST            DANELLS-QKKFNASTPSFMPAG-------------------------------------
PAN3_PICGU            TSTVSNVPERKFNTSTPSFTPSQ-------------------------------------
C0NEU6_AJECG          HSTE---SKKRLNVDSPSFTPSL--LNGSAGPKKPA------------------------
PAN3_COCIM            QHPERSSSKKRFNVDSPSFTPSATPLNGSSGLKK--------------------------
PAN3_NEOFI            YQSDS---KKRFNVDSPSFTPSLLSSNGSSPTSTPAT-----------------------
PAN3_ASPFU            NQSDS---KKRFNVDSPSFTPSLLSSNGSSPTSTPAT-----------------------
PAN3_ASPCL            YQFDS---KKRFNVDSPSFTPSLLPSNGSSPTISSAT-----------------------
PAN3_ASPOR            YQSDS---RRRLNVDSPSFTPSLLSSNGSSPTTASVT-----------------------
PAN3_ASPTN            YQSDS---KRRLNVDSPSFTPSLLSSNGSSPTSSSAT-----------------------
PAN3_ASPNC            YQSDSN--KKRLNVDSPSFTPSILSSNGSSPTSQSAT-----------------------
PAN3_EMENI            SDNAS---KKRFNVDSPSFTPSLLPSNGSSPTSSSSS-----------------------
PAN3_PHANO            NENAK----KRFNVDSPSFTPLTTTPNGSVTASA--------------------------
PAN3_CHAGB            QADFS---KKTFNVDSPAFTPSSQPQVLAK------------------------------
PAN3_NEUCR            QTDLNSN-RRVFNVESPSFTPANQQQSAGK------------------------------
PAN3_MAGO7            KPDATT--RKTLNVDSAPFTPAVSSQ-PSK------------------------------
Q17PM7_AEDAE          AQLSSVATAIIPNGTGGLAGGGGGGGGGG-------------------------------
Q7Q6T6_ANOGA          NMLRNESPQSTNTSPRITPQPSPPPITTN-------------------------------
PAN3_DROME            MLALQKTA-SIASVTIAQQQPQHPQKQQQ-------------------------------
Q29E31_DROPS          MLSLQKSAPSIVTIAQQQQQQQQQQQQQQKQ-----------------------------
A8XA39_CAEBR          MIPFNQINAGPQHYGPPPHMSHRPSMQHH-------------------------------
PAN3_CAEEL            MIPFGQIN-GPPTFGPGQHMNHRASHHHQ-------------------------------
G3NFD9_GASAC          NSPTSSLFSDFGALSISQRRKVSS------------------------------------
I3K9I0_ORENI          NSPTSSLFSDFGALSISQRR----------------------------------------
H2SNS4_TAKRU          NSPTSSLFSDFGGLSMSHRRKVSSQSSTQI-------------------------VTKTS
E7EXP6_DANRE          NSPTSSLFSDFGALSISQRR----------------------------------------
H2LXY8_ORYLA          NSSTSSLFSDFGALSISQRRKHGRFKINAVG------------------------VYFLM
F1P381_CHICK          TSPNSSLFNDFAALSVSQRRKPRKYRLGMLDERIVPVGSKARKSKNPIGCLTDRCKTGVP
H0ZN09_TAEGU          TSPNSSLFNDFAALSVSQRRKPRKYRLGMLDERIVPVGSKARKSKNPIGCLPDRCKTGVP
G1KIR2_ANOCA          TSPGSSLFNDFAALSLSQRRKPRKYRLGMLEERIVPVGSKARKSKNTIGCLADRCKTGVP
PAN3_HUMAN            TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
H2RA81_PANTR          TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
PAN3_MOUSE            TSSASSLFNDFGALNISQRRK---------------------------------------
F1RSU6_PIG            ISPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
F1PKU0_CANLF          TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
G1QHX6_NOMLE          TSPASSLFNDFGALNISQRRKTRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
H2NJI2_PONAB          TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
F6Y6Y5_MACMU          TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
G1U195_RABIT          TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
D4ADM2_RAT            TSSASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSKARKAKNPIGCLADRCKSGVP
H0VNI8_CAVPO          TSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPVGSKARKAKTPIGCLADRCKSGVP
F7FR09_MONDO          GSPGSSLFNDFGALSISQRRKPRKYRLGMLEERLVPVGSKARKAKNPIGCLADRCKSGVP
PAN3_XENTR            GSPASAMFNDFGGLTMSQRRK---------------------------------------
H3BC88_LATCH          SSPVS-LFNDFAALSISHRRKKNLKRYRIEILKKVPVTPKKKKARNRLGMCAVRCQWHID
Q4S571_TETNG          TPPCEVVQANPSLYVKLQACLFLLDRP---------------------------------
C3XW74_BRAFL          PQEAPAVLNNFSSLSISSNKGG--------------------------------------
W4XCT7_STRPU          PPLPVTPTKDAGPLSLNEFKPQSK------------------------------------
PAN3_DICDI            IPKQQLQQLQQQQLLQQQQQQALLLQQQQ-------------------------------
F4P6Y9_BATDJ          ILSRPMSSTGSSADTSITTKSP--------------------------------------
A8NJ49_COPC7          --------AQAPPPSTGGTRPE--------------------------------------
PAN3_CRYNJ            TPQNSSPVAHAPTPSAPTPLAG--------------------------------------
A0A0D1E1J8_USTMA      AVQQLKSPASQNASALSAASPANSPNKTRGA-----------------------------
PAN3_YARLI            FTPSVVDKAAIDSTGPAAPAAAPAFVP---------------------------------
B6K186_SCHJY          P--SLSATKKKLNAASASFQPNKS------------------------------------
PAN3_SCHPO            ENLEQYSVKKKLNAASASFQPVRA------------------------------------
                                                                                  

PAN3_ASHGO            -------------------VFAAASGNAGASATAAPRSQSV-------------------
PAN3_KLULA            -------------------QELAGTLHGSNPSIPSPVPSNP-------------------
PAN3_CANGA            -------------------VNLDGSIQQNYQERPNVLMRDSSMPL---------------
PAN3_YEAST            -------------------PSSTSSIHTNANAHSFPFPSIA-------------------
PAN3_CANAL            ------------GASTPIGISSAPLVQNQQQQQQQQQQQQ--------------------
PAN3_LODEL            ------------TAPANLQLQQKQPQQPQQPQQPQQHQQQQQLGLQNLNQ----------
PAN3_DEBHA            ------------------QISAPSPVMAQSVSTPGAKANGNI------------------
PAN3_PICST            -------------------------FGSEYPSSPNTSGAGQ-------------------
PAN3_PICGU            ----------------------------PIPAPPPQNTSSP-------------------
C0NEU6_AJECG          ----------ATTTISPKAASAAPFLPKGIISRSNASTPPVLQDT---------------
PAN3_COCIM            -----------SATISPKAANAAPFLPKGVLSRSNAATPQSQPET---------------
PAN3_NEOFI            --------TKKMTTISPKAANAAPFQPRSVVSRSNASTPGLRQDT---------------
PAN3_ASPFU            --------TKKMTTISPKAANAAPFQPRSVVSRSNASTPGLRQDT---------------
PAN3_ASPCL            --------MKKMATISPKAANAAPFQPRSVASRSNTSTPNSRQEN---------------
PAN3_ASPOR            --------AKKAATISPKAANAAPFQPRNITSRSNTSTPSGRAET---------------
PAN3_ASPTN            --------LKKTTTISPKAANAAPFQPRGISSRSNASTPSARAES---------------
PAN3_ASPNC            --------MKKMATISPKAASAAPFQPRSISSRSNSSTPTTRPGT---------------
PAN3_EMENI            --------LKKSSTISPKAANAAPFQPRTAASRSNTSTPGVRQDA---------------
PAN3_PHANO            ----------RNAAISPKAANAAVFTPK--SQRSAVSTPNLHNKE---------------
PAN3_CHAGB            -----------KTTLSSQAANAAPFTPRGAGT------PNLQQTA---------------
PAN3_NEUCR            -----------KSTFSSQAASAAPFTPRGVGTS----TPTLQQAN---------------
PAN3_MAGO7            -----------KTFSSSHAASAAVFTPRATAATP-TGTPTAQETDIPPAA----------
Q17PM7_AEDAE          --------------TAGANGNGTGNGSGVKSQ-----ASSYGSSILGSSL-------SNS
Q7Q6T6_ANOGA          --------------IHQVNYHYSTFAFAVLLLFFLMWPSFFLNPFVKDCI-------NQE
PAN3_DROME            ----------HPPSVGGGAVSAASAPIAISGAPPNPAAAPFVSSMSAQTP-------LKG
Q29E31_DROPS          ---------QQSPLVHSTSGSAPSAPIAISGAPPNPSAAPFVSSMSAQTP-------LKG
A8XA39_CAEBR          ------------------------------------------------------------
PAN3_CAEEL            ------------------------------------------------------------
G3NFD9_GASAC          ---------------QTPNPAASEFIPKG--APRMATMVQSTVQAFPSP-----------
I3K9I0_ORENI          ---------------KAPNPAASEFIPKG--APRMANMAQSTVQAFPSP-----------
H2SNS4_TAKRU          TGCVQCDSTSLVSCFKAPNPAASEFIPKG--APRMATMAPSAVQAFPSP-----------
E7EXP6_DANRE          ---------------KAPNPAASEFVPKG--APRMASMSQTTVPAFASP-----------
H2LXY8_ORYLA          NLTLRFFLALFILKAVAPNPAASEFIPKG--TPRMATMVQSAVLAFPSP-----------
F1P381_CHICK          INMVWWNRVTENN-LQTPNPTANEFIPKGGSTSRLSNVSQSSMSAFSQA-----------
H0ZN09_TAEGU          INMVWWNRVTENN-LQTPNPSANEFIPKGGSTSRLSNVSQSSMSAFSQA-----------
G1KIR2_ANOCA          INMVWWNRVTENN-LQTPNPTANEFIPKGGSTSRLSNMSQSNISAFSQA-----------
PAN3_HUMAN            INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
H2RA81_PANTR          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
PAN3_MOUSE            ----------------TPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
F1RSU6_PIG            INMVWWNRVTENN-LQTPNPTASEFIPKGGSASRLSNVSQSHMSAFSQ------------
F1PKU0_CANLF          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
G1QHX6_NOMLE          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
H2NJI2_PONAB          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
F6Y6Y5_MACMU          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
G1U195_RABIT          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
D4ADM2_RAT            INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
H0VNI8_CAVPO          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQ------------
F7FR09_MONDO          INMVWWNRVTENN-LQTPNPTASEFIPKGGSTSRLSNLSQSNISAFSQA-----------
PAN3_XENTR            ----------------TPNPTASEFIPKGGSTSRLSNMSQSSMSAFSQA-----------
H3BC88_LATCH          INKMSWLRNTINTCLSTPNPAATEFIPKGGSASRLSNVSQSTMSAFSQA-----------
Q4S571_TETNG          --------------LFTPRRSPPTPRPLPAGAATLPTPPTTWCPPAPR------------
C3XW74_BRAFL          ---------------KIKGVDAHEFIPGNRMSAASSVPSMTGLGVSMSSP-------SLS
W4XCT7_STRPU          --------------LKSLTPGVPEFVPRPLSQGSSMLPTPVTQGQVASA-----------
PAN3_DICDI            ---------------QQNYDDDQHLYPYGDNSVDDYEQHQYEPQPQPNN----------G
F4P6Y9_BATDJ          ----------------KINVDSPVFTPSRMPATTYTDHPSTSIQPSLYS-----------
A8NJ49_COPC7          ------SPV-VTGTLSAQAVNAPVFVPKSASAIAAGIASAASTPAATT------------
PAN3_CRYNJ            ------TPAREKPTLSIEHLAAPVFVPKGLDSSPRASTPSVPTPSAPT------------
A0A0D1E1J8_USTMA      ---LNPPSSPLKGSLSARNVAAAVFVPKVNGSSSPSLSVASPAPASRSTLDAVTSELSDL
PAN3_YARLI            ---------------GKSPIDLEQIKNKLTISKDKKENAKSALPKLNPA-----------
B6K186_SCHJY          --------------LSIQNANAPVFVPRSRESSSMSLHSMGSVSS---------------
PAN3_SCHPO            --------------LPVKAAGAAVFVPKSQEKS-LFLSRERTPVA---------------
                                                                                  

PAN3_ASHGO            ------------------------HVGTGGY---------LPLAG---------------
PAN3_KLULA            ------------------------YVNSAGLPSGGMLGVGHPMQGLPPPPPPGA------
PAN3_CANGA            ------------------------TMGTSGSRP-MLDQQIHSISGLSNTSGPQPPG----
PAN3_YEAST            --------------------------NSGGININATDDNSNNMSMANNVPPPMQP-----
PAN3_CANAL            ---------------------------------KQPLAVPSPLASGAQPPT------MQH
PAN3_LODEL            -----------------------TQLGRNLNVLLQPQISQPFIPANAIPPSSAAGQLQLH
PAN3_DEBHA            -------------------------------------QHNPYLPGNAGTPQ---------
PAN3_PICST            -------------------------------------PPNPYLTGNG-------------
PAN3_PICGU            -------------------------------------PTNPYLMNQPGPP----------
C0NEU6_AJECG          ---------------------STPEWIVADIPDFVPQGFDTGQVDTLQGNGNG-GIPAGA
PAN3_COCIM            ---------------------STPEWSIGEIQDFVPQGFDTSHVESIHGHGNG-VLSTPA
PAN3_NEOFI            ---------------------VTPDWTVAEVQEFVPQGFDNSHLATLQGNGNGPITSTSP
PAN3_ASPFU            ---------------------VTPDWTVAEVQEFVPQGFDNSHLAALQGNGNGPITSTSP
PAN3_ASPCL            ---------------------INPDWTVAEVQEFVPQGFDVAHMTALQGNGNGTITPTNA
PAN3_ASPOR            ---------------------MTPDWSVAEVQEFVPQGFDTAHMASLQGNSNGGVPSTSP
PAN3_ASPTN            ---------------------AAPDWSVAEVQEFVPQGFETSHMASLQGNGNGPVPSTSP
PAN3_ASPNC            ---------------------MTPDWSVAEVQEFVPQGFDTAHIGSLQGNGTAGVPSTSA
PAN3_EMENI            ---------------------VAPDWSVAEAQEFIPQGFDPTHMSPLHGNGNPGVASANA
PAN3_PHANO            ---------------------PALDWHAPDFQEFVPETFGGPMVDSNAS------ASYSG
PAN3_CHAGB            ---------------------EASVFNPAAIREFTPQNYDIGNTNSNG----VPQENGIY
PAN3_NEUCR            ---------------------DSTIFNPAAIREFTPQNYDVGNTISQNGAQHVTQDGGLY
PAN3_MAGO7            -------------------NTPSAFSNIAAIREFTPQQQNYDLTTNGAAA--ATQDASLN
Q17PM7_AEDAE          STYAVTPIKGKWRSLLRNE--SPQSTNTSPRITPQPSPPPITTNIHQENVGGT-----TY
Q7Q6T6_ANOGA          LNLMFRGLLSKVVHPLGSNLLGLTCGNQNLNLTLANVFKTYTATIFQENVGGT-----TY
PAN3_DROME            RGAMMRQESPTAAMISGAGPGEKSPPHGMTPHGASPIPSALPTSVHQENVGGT-----IY
Q29E31_DROPS          RGPMLRQESPTAAMLAG-GPGEKSPPHGMTPHGASPIPTTLPTSVHQENVGGT-----IY
A8XA39_CAEBR          --------------------------HPQPMAPPPPHVQVPYDRYHQESRGGT-----TY
PAN3_CAEEL            --------------------------SPQMAQQPPTLQQSAYDRYQLENRGGT-----TY
G3NFD9_GASAC          ---LFPHPGLPTSTAAALAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
I3K9I0_ORENI          ---LFAHPGLSGSTAAALAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
H2SNS4_TAKRU          ---LFPHPGLSSSTAAVLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
E7EXP6_DANRE          ---IFPHPGLSSSTASALAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPNPNPANY
H2LXY8_ORYLA          ---LFAHPGLGSS--SALGPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
F1P381_CHICK          ---LFSHPSMGSPAAAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
H0ZN09_TAEGU          ---LFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
G1KIR2_ANOCA          ---LFSHPSMGGPANAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
PAN3_HUMAN            ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
H2RA81_PANTR          ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
PAN3_MOUSE            ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASF
F1RSU6_PIG            ---VFSHPSLGTPAAAALAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
F1PKU0_CANLF          ---VFSHPSMGSPAAAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
G1QHX6_NOMLE          ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
H2NJI2_PONAB          ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
F6Y6Y5_MACMU          ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
G1U195_RABIT          ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
D4ADM2_RAT            ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASF
H0VNI8_CAVPO          ---VFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ASY
F7FR09_MONDO          ---LFSHPSVGSPAAAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
PAN3_XENTR            ---LFSHPSMGGPTGAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
H3BC88_LATCH          ---LFSHPSMNNPS-AGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP----ANY
Q4S571_TETNG          --------SRAPKSSRRRLWGGPLTFTRTTRRPPWRGWYVLRAAHRRQDGGSS----CSF
C3XW74_BRAFL          TMLFTAQPHTPAAAGAAVPSGASLSAGASPLGSPLSSP---GANRRKPPYSGS----YDF
W4XCT7_STRPU          ----IPRTNAGGLMSNDFVSG-SLSAGASPLHSPGGSPNTSRKEFRRAQAPSA-----IE
PAN3_DICDI            IDPNMNNQFQINNFVAAQMRNASPQSYQQQFQQPNPSPQSSSQQQQQQQQQQQQ---AVY
F4P6Y9_BATDJ          --------SQNDYKLVAEDSEFEPFIQQPVMHFTPDHAYQYTDHEQFQHQQYE------Y
A8NJ49_COPC7          ------------DGSTYDGASQSEMGYQEYDQSGYENYTEDSQMEGVTQKMED-----LS
PAN3_CRYNJ            ------------PPVWPSLPSTGLLPRQDVQVSAQPSHAQLSATASPMAYDDP-----SH
A0A0D1E1J8_USTMA      RVDSSTTNQVSPSAYTHNGPSTPNMYTSSYDVDPLSSSFDPTHPSSTAAHDQQ-----IA
PAN3_YARLI            ----VAGFTPGASASGSTTPKMATAPSFQPNQTSAINTNSNSSASATSQSGPP-----GA
B6K186_SCHJY          --------------------------KNIPNAPSGSYMTSSLLVNSQYPDDLS-------
PAN3_SCHPO            --------------------------LSPGSHAINPYNNASMLVNEPFHDDSG-------
                                                                                  

PAN3_ASHGO            ------------------------------------------TAFPTVYPPSHSILQYHL
PAN3_KLULA            ------------------------------------LPVNPITQFPTVYPPTHSVLQYHL
PAN3_CANGA            -------------------------LLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHL
PAN3_YEAST            -----------------------------------PPIESSNLKYPRIYPPPHSLLQYHL
PAN3_CANAL            RILSMGVSQSSPSTNPYFANNLDMSAPTPGSETPGPVLPGSAGAAAAAANQPMYPLQYHL
PAN3_LODEL            MQVQQPQAQTQPPSHLTPSSIMSSAPMSAGFYTSALPIPQGGGMRNQPPSASMYPLQYHL
PAN3_DEBHA            -------------------------------PTSAVAAPNSADVFFQQP-TSSYPLQHHL
PAN3_PICST            -------------------------------HPASMAQSSGADVYYQQQ-AASYPLQYHL
PAN3_PICGU            -----------------------------------------TDMYYQSA----YPLQYHL
C0NEU6_AJECG          FDPYIGPSTAQLTTQSAVGPQVTPNPYAHDPTALGAA---AYFGPQN---TFQQPVQYHL
PAN3_COCIM            YDPFVSSSTP-LGASGAVTHQVQPNPYSHDPSAIGGA---AFFGAHN---AFQQPVQYHL
PAN3_NEOFI            FDPFVTTSTP-LSAGGAVGP-VQPNPYSHDTAAALGG--AAFFPGAA---GFQQPVQYHL
PAN3_ASPFU            FDPFVTTPTP-LSAGGAVGP-VQPNPYSHDAAAALGG--AAFFPGAA---GFQQPVQYHL
PAN3_ASPCL            FDPFVTASTP-LSAGGAVGP-VQPNPYSHDSAA-LGG--AAFFPGSS---GFQQPVQYHM
PAN3_ASPOR            FDPFVTASNP-LSAASAVGP-VQANPFAHDTAAAAAALGGAFFAGQS---GFQQPVQYHL
PAN3_ASPTN            FDPFVTTSNP-LAAANAVGP-VQANPFSPDTAAAALG-GATFFTGQT---GFQ-PVQYHL
PAN3_ASPNC            FDPFVTAPNP-LSAANAVGP-VQANPFSHDTAAALNG--AAFFANQS---GFQQPVQYHM
PAN3_EMENI            FDPFVSTPNP-LAAPGAVGP-VQANPFSHDAAAATLG--GAYYANQA---GFQQPVQYHL
PAN3_PHANO            YDPYTSSANL-ASIAGQGHQSSAMNPYAQGHSGLEAS----YYQNPS---AFQTSPAYHL
PAN3_CHAGB            SDPFTT----MGSLGSTLPSAGQYNLYASDHNSLGGPGAQFYPQHGSFPAGPLQPPNYHL
PAN3_NEUCR            SDPFS-----ISSLGQTMPPQGQYNPYANDPNNLAGAGAGLY-QPAGFGNGLVHPPNYHL
PAN3_MAGO7            YDPFT-----MSSVASALPAA-QYNPYASTDHTGLVAHGGAYFPSAQAGYQSLIPPSFHL
Q17PM7_AEDAE          FYPTAANHQL---------TPSSTVNTTENTFVHV--SELSNASSFGKGPFHQLFISGHV
Q7Q6T6_ANOGA          FYPTAANHQL---------SSSSTVNTTDNSFVHIASSQINITLICTHSPLLSFLAAGHV
PAN3_DROME            FYPTANAQNS---------QPVVNSMVVDGTHPALHGVSAVAPMSA--GVPAAMMYTGHV
Q29E31_DROPS          FYPTANAQGN---------QPVVNSVVVDATHPAHHGVSSVPTMSSVGGVPSSLMYTGHV
A8XA39_CAEBR          FYNEPSDQPL---------DAEHYHEVDGNEGGIVVNTSGVFCYNAPLPLAHMTRFRGKP
PAN3_CAEEL            FYTEPTEAGP---------DDEQYTEAEAPDGSILVNTPGAFGYNAPLPISHMARFRGKA
G3NFD9_GASAC          MVPTSAADQ----------GPHMIQKETVGGTTYFYTDNT----PAP--MAGMVFPTYHI
I3K9I0_ORENI          MVPTTASDQ----------GAHIIQKETVGGTTYFYTDNT----PAP--MAGMVFPTYHI
H2SNS4_TAKRU          MVPTTASEQ----------NTQVIQKETVGGTTYFYTDNT----PAP--MAGMVFPTYHI
E7EXP6_DANRE          MVPTTAPDQA--------GGAHIIQKETVGGTTYFYTDNT----PAP--LAGMVFPTYHM
H2LXY8_ORYLA          MVPTTASDQ----------GAHIIQKETVGGTTYFYTDNT----PAP--MTGMVFPTYHI
F1P381_CHICK          MVPTSASASVANAVSQPPSTGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
H0ZN09_TAEGU          MVPTSASASVTSAVSQPPSTGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
G1KIR2_ANOCA          MVPTSASTPVTNAVSQPSATGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
PAN3_HUMAN            MVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
H2RA81_PANTR          MVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
PAN3_MOUSE            MVPPSASTPANNPAPQPPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
F1RSU6_PIG            MVPSSASTPVNHPVPQTPSSGQVIQKETVGGTTYFYTDST----PAP--VSSVVFPNYHI
F1PKU0_CANLF          MVPSSASTPVNNPVSQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
G1QHX6_NOMLE          MVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
H2NJI2_PONAB          MVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
F6Y6Y5_MACMU          MVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
G1U195_RABIT          MVPSSASTPANNPVSQNPSSGQVIQKETVGGTTYFYTDTT----PAPAPLTGMVFPNYHI
D4ADM2_RAT            MVPPSASTPANNPVPQTPSSGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
H0VNI8_CAVPO          MLPSSASTPVNNPVSQTPSSGQVIQKETVGGTTYFYTDTA----PTP--LTGMVFPNYHI
F7FR09_MONDO          LVPSSASTPLNNPVSQTSSTGQVIQKETVGGTTYFYTDTT----PAP--LTGMVFPNYHI
PAN3_XENTR            MVPTSASTPVTNSVSQPPSTGEIIQKATVGGTTYFYTDTT----PAP--LTGMVFPNYHI
H3BC88_LATCH          LVPTSASTSVSDVVSQPPSAGQVIQKETVGGTTYFYTDTT----PVP--VSGMVI-NTRL
Q4S571_TETNG          ERALSFLSMRKLFFSHFVPGVSYLPYLSLHCTPRGLHAAQ----SER------SVLLYGR
C3XW74_BRAFL          IPGQTSTPGGTMQQQAMGPASSAPAMHDFGGTTYFYTAGS----QHARHSPLPAALLPGG
W4XCT7_STRPU          IDGKGASKGG--------ANYPGVTQENIGGTTYFYTDDQGPAVPQAPANAGIVLPTFHV
PAN3_DICDI            QQQQQQQPSSQ-------PLAQNPSLQNNNNKLLQLQLQQHLQQIQAAQQQAQINQSYTP
F4P6Y9_BATDJ          NYYEQGNQYSDIQMMQVGMESMGLGSQQRMHDQYQDKASLETYFMHQHDGSPYLPLHYHH
A8NJ49_COPC7          TQYYGDYSDAAAAA------------------------AAAAYYAAAPPVFLRQPLNYHL
PAN3_CRYNJ            IALSAAHAHAQAQALTHGILD---------------PHAHAPPVDQSMYLPPRQPLDYNL
A0A0D1E1J8_USTMA      TATPSAHASRPYNPYEHMNEFGDPSPGQGPPGIGLSAGIDYYSAAANGAAKIRQPLHYHL
PAN3_YARLI            SFQPNQSFQPGAASFQPRFQSGPSQIEPGYDNYYDEMSNGAVMAAAQNQQFPLQYHLYAP
B6K186_SCHJY          --------------------------------------------LFYNQQSHFQPTNYHL
PAN3_SCHPO            --------------------------------------------VYYTRQNQFKPTLYNL
                                                                                  

PAN3_ASHGO            YAPDPPPHLQVPLKANERTPETLFIPNNLREH----------LLKRNLSALQVFPSD-GN
PAN3_KLULA            YAPDPPPHLKIPLKPNERTPETLFINNHLRDR----------LVKNNQTALQVFPR--GS
PAN3_CANGA            YAPDPPPQLEIALKENERTPRMLFIPNDLREE----------LVKRNLASLQLFPSG-GN
PAN3_YEAST            YAPEQPSSLKSLLKPNERSADQLFIPNNIRED----------LTKKNLSILQVFPSSGKV
PAN3_CANAL            YAPAPPPRLTIPLQPYETNSQAMFIPNDLREY----------LHKKNEASLQSLSHS--N
PAN3_LODEL            YAPAPPPRLAVPTKEYETDSQQLFLPNELRES----------LHRKNEASLQTMQHL--S
PAN3_DEBHA            YAPAPPPRLTIPLPPHEINVNSMFIPNDLRET----------LLKRNEATLQTLPRS--N
PAN3_PICST            YAPAPPPRLTIPLPPHETNANSMFIPNDLRET----------LQKKNEATLQTLPRS--N
PAN3_PICGU            YAPAPPPRLAITHSSHQVDAHSLFIDSELRET----------LQKRNEATLQSYPGG---
C0NEU6_AJECG          YAP--IGPHNSNILGYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNSQ--
PAN3_COCIM            YAP--IGPHNQNILGYQRNIHDLFLPNSFREE----------LQKKAAATLQTLPNSQ--
PAN3_NEOFI            YAP--IGPHSQNTLGYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNTQ--
PAN3_ASPFU            YAP--IGPHNQNTLGYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNTQ--
PAN3_ASPCL            YAP--IGPHNQNTLGYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNTQ--
PAN3_ASPOR            YAP--IGPHSQNTLGYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNTQ--
PAN3_ASPTN            YAP--IGPHSQNTLGYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNTQ--
PAN3_ASPNC            YAP--IGPHSQNTLGYQRNVHDLFLPNDLREE----------MQKKAAATLQTLPNTQ--
PAN3_EMENI            YAP--IGPHNQNALAYQRNVHDLFLPNDFREE----------LQKKAAATLQTLPNTQ--
PAN3_PHANO            YWP--VGPQPTSLLGYQRTAHDFFIPDALRED----------LQKRAEVARQVMPNST--
PAN3_CHAGB            YQP--HDSYRQELQPWQRATYDFFIPAKMREE----------LQKKMFATQQVMPNSG--
PAN3_NEUCR            YQPP-SELYRPSLQPYQRTTYDFFIPKDRREN----------LQKKLFHMQQLLPNSG--
PAN3_MAGO7            YAP--IGPYREDLQPWQRSTYDFFMPENLRLE----------LQNKSHAALQTMTGTAAL
Q17PM7_AEDAE          YPG--PASHVVNMQAKAQLSMAYFLQDELRNDILS-------RNE----IVNSIETECQD
Q7Q6T6_ANOGA          YPG--PASHVINMQSKAQVSAAFFMQDELRNDILA-------RNE----LINSIESDGQD
PAN3_DROME            YPG--PSSNVVTMQPKTLLESAFFMPDEMRAEVLA-------RNEISNLIMDAAEAAQHA
Q29E31_DROPS          YPG--PASNVITMQPKTHLESAFFIPDEMRADILA-------RNEISNLIMDAAEAAQHA
A8XA39_CAEBR          NST--QQTQFISPELRMELLNRQLAFDTKVDPNL-----------------------YPE
PAN3_CAEEL            NAN--LQTQFISPEIRMELINRQLAYDTKADSAI-----------------------IGD
G3NFD9_GASAC          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDHSENTD
I3K9I0_ORENI          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDHSENPD
H2SNS4_TAKRU          YPS--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDHSENTD
E7EXP6_DANRE          YPQ--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQSENPG
H2LXY8_ORYLA          YPS--NPPNVAYMQPKANAPS--FFMADELRQQ-------ELINRHLITMVHIDHSENPD
F1P381_CHICK          YHP--AAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQVDQADIPA
H0ZN09_TAEGU          YHP--AAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADIPA
G1KIR2_ANOCA          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
PAN3_HUMAN            YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
H2RA81_PANTR          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
PAN3_MOUSE            YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
F1RSU6_PIG            YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
F1PKU0_CANLF          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
G1QHX6_NOMLE          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
H2NJI2_PONAB          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
F6Y6Y5_MACMU          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
G1U195_RABIT          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
D4ADM2_RAT            YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADLPA
H0VNI8_CAVPO          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPA
F7FR09_MONDO          YPP--TAPHVAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADVPA
PAN3_XENTR            YPP--TAPHIAYMQPKANAPS--FFMADELRQ--------ELINRHLITMAQIDQADMPG
H3BC88_LATCH          FVK--LKDYFSFVFPKHFIPSKVLFLKPSCSK--------ELINRHLITMAQIDQSENPG
Q4S571_TETNG          RAA--TGLFLCFHQFLSSLGAALFFPCAHLRHIGLVFVLQELINRHLITMAQIDHSENTD
C3XW74_BRAFL          HLF--HLPHTALMKPKANQPS--FFMQDELRL--------DTLRRQYLLAAQIDPVQHPD
W4XCT7_STRPU          YPS--TPAHVDYMKRNVNGPS--FFMDEEFKI--------DVLNKQAQALTQLDLAEHPD
PAN3_DICDI            YPS--YSQSVIRNKPGRRNIGSFFMSESLKQDILN-------QKSLLYLTLDPNDPRIKN
F4P6Y9_BATDJ          YNT--PLPNVSHIPPHLKSSHNFFIDDQLREMLLK---------RNEAVQQVVDPSDWSN
A8NJ49_COPC7          YTP--TAYPD----FQPSTVNTHFVPPSADLRQTL-------QERSETIRGIAP--PGLN
PAN3_CRYNJ            YAA--PLPSIGGNPLYPTHPHAFFVSDDLRRAIQA-------KQEAVYAGANGA--SAPG
A0A0D1E1J8_USTMA      YAP--PLPHVSNLHPHHLTANAFFLHPNQREELQR-------KQEAMLASVPPPELGGPN
PAN3_YARLI            HYL--SASRQRQLLSHQKTAKDFFLDPHLHQRLHK------------QSEDLLRVEGSSN
B6K186_SCHJY          YNP--PLQHPPILQPYERLTNDLFIDSKLRESIQ--------------KKCEASHQVAAA
PAN3_SCHPO            YNP--QPSPMPTLLPYERTVNGLFIDDTTRERIE--------------RKSEASRQTISA
                                             :                                    

PAN3_ASHGO            LPDIVGDYFGLVPLEFHNRQTGKG----------------------------RYLGHQNS
PAN3_KLULA            LPDIVGDYFGLVPMDFHNRTSDKK----------------------------RYNGHKNS
PAN3_CANGA            LPHIVKDYFGLVPLDFHQRSSVKD----------------------------RYKKHKNS
PAN3_YEAST            IPSIVQDYFNLVPLNFNNND----------------------------------FLNKTT
PAN3_CANAL            LPEHVNQYHSLVPIDKSYEPV-SK----------------------------LWLGKNSL
PAN3_LODEL            LPDHVNSYHSLVPIDKSYDSS-SK----------------------------IWPGKSTV
PAN3_DEBHA            LPDHVNIYHSLVPIDTSFENI-SK----------------------------VY-ELPSF
PAN3_PICST            LPEHINIYHSLVPIDKSYDPK-SK----------------------------VW-DVPSS
PAN3_PICGU            -PEIVDVYHTVVPI--AAEGV-SK----------------------------IW-KVSSS
C0NEU6_AJECG          LPTQLDHFHSLVPLDLS-YQKNAA-----------------------------IFGYPSW
PAN3_COCIM            LPTQIDYFHSLVPLDLS-HQKNAA-----------------------------IFGYPSW
PAN3_NEOFI            LPAQIDYFHSLVPLDLN-HQKNAT-----------------------------IFGFPSW
PAN3_ASPFU            LPAQIDYFHSLVPLDLN-HQKNAT-----------------------------IFGFPSW
PAN3_ASPCL            LPAQIDYFHSLVPLDLN-HQKNAT-----------------------------VFGFPSW
PAN3_ASPOR            LPAQVDYFHSLVPLDLN-HQKNAT-----------------------------IFGFPSW
PAN3_ASPTN            LPAQVDYFHSLVPLDLN-HQKNAT-----------------------------IFGFPSW
PAN3_ASPNC            LPAQVDYFHSLVPLDLN-HQKNAT-----------------------------IFGFPSW
PAN3_EMENI            LPAQVDYFHSLVPLDLN-HQKNAA-----------------------------IFGYPSW
PAN3_PHANO            LPV-IEQFHSLFCLDTT-PQKNNA-----------------------------PFGYVSW
PAN3_CHAGB            -LPQLERWHSLFPLDTN-NRKNTS-----------------------------SFGYPSW
PAN3_NEUCR            -LPNLDRWHSLFPLDTK-ATRNST-----------------------------CFGYPSW
PAN3_MAGO7            QMPQVGNYHTLVTLDKTSNRKSSS-----------------------------LFGYVTW
Q17PM7_AEDAE          LPLEVENYHSLCLLE------SLP--------------------------VHPKLPVQSS
Q7Q6T6_ANOGA          IPLEVENYHSLCLLE------SVQ--------------------------LHTKL-APSS
PAN3_DROME            LPLEVENYHALYPLEP----PAQP--------------------------LHAKLTFPAT
Q29E31_DROPS          LPHEVDNYHALYPLEP----PAQP--------------------------LHAKLTLPAS
A8XA39_CAEBR          IPQNVEHFTNLVPLE-----------------------------------NTGMQNQSHS
PAN3_CAEEL            IPHSVEHFSNLVPLE-----------------------------------IAGIQSQ--T
G3NFD9_GASAC          VPSEVDSYHSLFPLEALPPPNRMQ--------------------------KTSNFSYITS
I3K9I0_ORENI          VPSEVDSYHSLFPLEPLPPPNRMQ--------------------------KTSNFSYITS
H2SNS4_TAKRU          VPSEVDSYHSLFPLEPLPPPNRMQ--------------------------KTGNFSYITS
E7EXP6_DANRE          VPSEVDSYHSLFPLEPLPPPNRLQ--------------------------KTSNFSYITS
H2LXY8_ORYLA          VPSEVDSYHSLFPLEPLPPPNRMQ--------------------------KTSNFSYITS
F1P381_CHICK          VPAEVDSYHSLFPLEPLPPPNRIQ--------------------------KTSNFGYITS
H0ZN09_TAEGU          VPAEVDNYHSLFPLEPLPPPNRIQ--------------------------KTSNFGYITS
G1KIR2_ANOCA          VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KTSNFGYITS
PAN3_HUMAN            VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
H2RA81_PANTR          VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
PAN3_MOUSE            VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
F1RSU6_PIG            VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
F1PKU0_CANLF          VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
G1QHX6_NOMLE          VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
H2NJI2_PONAB          VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
F6Y6Y5_MACMU          VPAEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
G1U195_RABIT          VPSEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
D4ADM2_RAT            VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
H0VNI8_CAVPO          VPTEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
F7FR09_MONDO          VPAEVDSYHSLFPLEPLPPPNRIQ--------------------------KSSNFGYITS
PAN3_XENTR            VPAEVDSYHSLFPLEPLPPPNRI---------------------------KTSNFGYITS
H3BC88_LATCH          FPSEVDNYHSLFPLEPLPPPNRLQ--------------------------KTSNFGYITS
Q4S571_TETNG          VPSEVDSYHSLFPLEPLLPPNRMQ--------------------------KTGNFSYITS
C3XW74_BRAFL          IPSEVDNYHTLYPLEPVPR-DPKH--------------------------RSSTFGFITS
W4XCT7_STRPU          IPTEVDNYHSLFPLEPSPK-TPMD--------------------------KSSTFGYTTT
PAN3_DICDI            IPPMLNKYHSLYPLDHDAS--REN--------------------------QGKMFGYITS
F4P6Y9_BATDJ          LPQSVDTYHTLFPLDE-----SNA--------------------------PSKIFGYPTS
A8NJ49_COPC7          LPEELQGYHTLVPLEPTGPGTE----------------------------RRKFGNWYCT
PAN3_CRYNJ            LPQELGVYHSLIPLPLPAPTAQCP---------------------PTQSQPSKVYGLPSP
A0A0D1E1J8_USTMA      LPEELHVYHSLVPLEHPGPGAPSTMGMPPGLIDPRMGNPGSNGATGASGDHSKVFGYRSH
PAN3_YARLI            LPRFVDKYHSLVLLDSNLNTKENG----------------------------APGESPQW
B6K186_SCHJY          LPTDVAIYKSLVPLNTKLDRFKHN------------------------------LGYPCW
PAN3_SCHPO            LPSIISSYTSLAPLNTKLYRYKEQ------------------------------IGFSSW
                          :  :  :  :                                              

PAN3_ASHGO            LYKVFSNFDGKVYIIRRIHDVKTT-DVGQI-SLPFRKWQKV-SCPNVVKVKDAF-TTLAF
PAN3_KLULA            LYKVFSNLDGKIYFMRRIHDVKIT-DSAQV-SKPFQTWSHL-RSANITVLKDSF-VTSAF
PAN3_CANGA            LYKVFSNVDGRIYLLRRIHDVNIS-DPTII-SKTFQKWSKI-DSSNVVALKDLF-LTTAF
PAN3_YEAST            LFKVFSNYDGKAYVLKRLPNIDKSMNPNKI-SKIYQIWSKI-NCTNLIKFRDIF-QTTKF
PAN3_CANAL            IFKCLDNIDGNLYVMRKIEPCN--EIINEKPFKTIKRWKSI-KNANIVGLQDAF-TTMAF
PAN3_LODEL            LFKCNSNFDGNLYALRKIEPCN--EIVDETPFRNIRKWKSLHNNANIVALRDAF-TTMAF
PAN3_DEBHA            VYKVFSNVDGNPYALRKIDIQSVLRITNELPFKYIKKWKSV-KCANIVQLQEAF-TSMAF
PAN3_PICST            LYKVFSSVDGNPYALRKIELN--FPIINEAPFKTIKKWRSV-KNANVTQLQEAF-TSMAF
PAN3_PICGU            VYKGVSNVDGNVYALRKIEDFK---IINETPFRTIKRWHGL-QSANIVKIQDAF-TTVAF
C0NEU6_AJECG          VYKAQSSKDGNFYALRRLEG--FRLTSEKAIRSV-QNWKRV-CNGSVVTVHDAF-TTRCF
PAN3_COCIM            VYKAQSSKDGNFYALRRLEG--FRLTNEKAIRSV-QNWKRV-SCGSVVTVHDAF-TNRSF
PAN3_NEOFI            VYKAQSSKDGNFYALRRLEG--FRLTNEKAIRSV-QAWKRV-CNGSVVTVHDAF-TSRSF
PAN3_ASPFU            VYKAQSSKDGNYYALRRLEG--FRLTNEKAIRSV-QAWKRV-CNGSVVTVHDAF-TSRSF
PAN3_ASPCL            VYKAQSSKDGNFYALRRLEG--FRLTNEKAIRSV-QAWKRV-CNGSVVTIHDAF-TSRSF
PAN3_ASPOR            VYKAQSSKDGNFYALRRLEG--FRLTNEKAIRSV-QAWKRV-CNGSVVTVHDAF-TSRSF
PAN3_ASPTN            VYKAQSSKDGNFYALRRLEG--FRLTNEKAIRSV-QAWKRV-CNGSVVTVHDAF-TSRSF
PAN3_ASPNC            VYKAQSSKDGNFYALRRLEG--FRLTNEKAIRSV-QAWKRV-CNGSVVTVHDAF-TSRSF
PAN3_EMENI            VYKAQSTKDGSYYALRRLEG--FRLTNEKAIRSV-QAWKRI-ASGSMVTIHDAF-TSRSF
PAN3_PHANO            IYKAISGKDGKTYALRRLEN--FRLTSEPAIRSA-QAWKRI-FNGSIVTIHEAF-TTRAF
PAN3_CHAGB            VYKAQNSRTARHYALRRLEG--YRLTNEKAILTVMKEWKKI-KNGNVVTVHEAF-TTREF
PAN3_NEUCR            MYKAQNNKNGRHFALRRIEG--YRLTNEKAILNVTKEWKKI-INANIVTVHEAF-TTEFF
PAN3_MAGO7            VYKAVSGKTSRLYSLRRLEG--FTVSNDQ-ILRPVKEWKKI-TNGNIVAMQDAF-TTRAW
Q17PM7_AEDAE          TYKATHNLTGVKYCLRRLHG--FRLQST-KCMQIVDMWKKL-QHTNVVQLREVF-TTKTF
Q7Q6T6_ANOGA          TYRATHAVTGVKYCLRRLHG--FRLQST-KCVQVVDKWKKL-QHTNIVQLREVF-TTKTF
PAN3_DROME            TYRATHNTTGYKYCLRRIHG--FRLQST-KCMTLVEMWKKL-QHTNVVQLREVF-TTKAF
Q29E31_DROPS          TYRATHNTTGYKYCLRRLHG--FRLQST-KCMTLVEMWKKL-QHTNVVQLREVF-TTKAF
A8XA39_CAEBR          TYKAISCRDGNFYCLRRIHG--NRIQQPGKQTHLVEQWKKL-VHGNIVPLREVLLNCRAF
PAN3_CAEEL            TYKAFSCRDGNYYCLRRIHG--NRIQHPGKQTHLVEQWKKL-VHGNVVPLREVLINCRAF
G3NFD9_GASAC          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMMLVDMWKKI-QHSNSVTLREVF-TTKAF
I3K9I0_ORENI          CYKAVNSKDDLPYCLRRIHGKGFRLVNT-KCMMLVDMWKKI-QHSNTVTLREVF-TTKAF
H2SNS4_TAKRU          CYKAVNSKDDLPYCLRRIQG--FRLVNT-KCMMLVDMWKKI-QHSNSVTLREVF-TTKAF
E7EXP6_DANRE          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMMLVDMWKKI-QHSNTVTLREVF-TTKAF
H2LXY8_ORYLA          CYKAVNSKDDMPYCLRRIHG--FRLVNT-KCMMLVDMWKKI-QHSNTVTLREVF-TTKAF
F1P381_CHICK          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
H0ZN09_TAEGU          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
G1KIR2_ANOCA          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
PAN3_HUMAN            CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
H2RA81_PANTR          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
PAN3_MOUSE            CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
F1RSU6_PIG            CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
F1PKU0_CANLF          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
G1QHX6_NOMLE          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
H2NJI2_PONAB          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
F6Y6Y5_MACMU          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
G1U195_RABIT          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
D4ADM2_RAT            CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
H0VNI8_CAVPO          CYKAVSSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
F7FR09_MONDO          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
PAN3_XENTR            CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMSLVDTWKKI-QHSNIVTLREMF-TTKAF
H3BC88_LATCH          CYKAVNSKDDLPYCLRRIHG--FRLVNT-KCMVLVDMWKKI-QHSNIVTLREVF-TTKAF
Q4S571_TETNG          CYKAVNSKDDLPYCLRRIQG--FRLVNT-QVHDAGGHVEED-PALQLGDIKGGL-HHQGL
C3XW74_BRAFL          CYKGISAKDAMAYCLTRIHG--FHMVNS-KCMLFTDMWKKI-QHSNIVQLREVF-TTKAF
W4XCT7_STRPU          CYKAMNKKDSKLYCLRRIHG--FRVGVT-QWMVLVDKWKKL-QHSNIVSLREVF-STKAF
PAN3_DICDI            VYKAISTLDGLPYAIRRVEG--FRLSSE-YALQAAETWRNI-QHPNIVSLKEIFVSKEFG
F4P6Y9_BATDJ          VYKAIRSTDGKPYVLRRIEG--FRMLNE-AAMMCIDNWQRV-RHANIVSVIEAF-TTKAF
A8NJ49_COPC7          VYRAIKASDGLPYVLRRIES--KSFSEPQRYAPLLTSLDRL-SHPGIVSLKEAF-TTRSF
PAN3_CRYNJ            VYRATSEVDGNTYCLRRVEG--FKLVNQLAFASM-DTWRRM-RHPNIVGLKEAF-TTKTF
A0A0D1E1J8_USTMA      SYKATCTLDGKRYVLRRLES--FRLQHEAAIALV-ERWRRI-RHPSIVSVREAF-TTRAF
PAN3_YARLI            VYKCMNGKDGKQYALRRIQG---FVLTNEQAMTSVRKWQSI-VHPAFVSLCEAF-TTRDF
B6K186_SCHJY          TYKAISTLDNLTYTLQRVQN-----CNVQCSKVLLEKWRSL-LHPNVISIHDVF-STNTF
PAN3_SCHPO            TYKCTSSIDGNAYVLKRLQD-----CSINIDTSTVDKLKNV-FHPNIVPFHSAF-HTDTF
                       ::         : : ::                               .   :      

PAN3_ASHGO            GD------------------SSLCVVHDYYPQSNSLYETH---VANYTVVP---------
PAN3_KLULA            ND------------------SSLCMVFDYYPQSQSLYETY---GLANSVNE---------
PAN3_CANGA            GD------------------SSLGIVYDYYPNATSLYEAH---FVNYPTVE---------
PAN3_YEAST            GD------------------LSICLVFDYYPNSLSLYDYH---FVNFPKFP---------
PAN3_CANAL            NGNQSG-------------NTSLCIIYDYYPNSISLLEHH---KKGLRVEP---------
PAN3_LODEL            SNTFSSPNSSAGNEVVGANGASLCFVYDYYPNLTTLLERH---KKGIRVVP---------
PAN3_DEBHA            GGS----------------YSSLIVTYDYFPNSNTLQEQHISRRLGGKLEP---------
PAN3_PICST            GK------------------SCLVVVYDYFPNSSTLIDHH--KRIGTRTEP---------
PAN3_PICGU            GS------------------PSLVVAYDYYPNASTLLEQHVNRRLGGRLEP---------
C0NEU6_AJECG          QD------------------SSLIIVTDYHPLSKTLAEHHLG-GPSRYQAR-QTGT----
PAN3_COCIM            QD------------------SSLIFVTDYHPLSKTLAEQHLADGQGRYQGR-HTSG----
PAN3_NEOFI            QD------------------SSLIFVTDYHPLSKTLAEQHLGAGQQRFQGR-QNV-----
PAN3_ASPFU            QD------------------SSLIFVTDYHPLSKTLAEQHLGAGQQRFQGR-HNVQ----
PAN3_ASPCL            QD------------------SSLIFVTDYYPLSKTLAEQHLGTGQ-RFQGR-HNV-----
PAN3_ASPOR            QD------------------SSLIFVTDYHPLSKTLAEQHLGAGN-RFQGR-HNT-----
PAN3_ASPTN            QD------------------SSLIFVTDYHPLSKTLAEQHLSAGN-RFQGR-SNT-----
PAN3_ASPNC            QD------------------SSLIFVTDYHPLSKTLAEQHLGAGN-RFQGR-HNT-----
PAN3_EMENI            QD------------------SSLIFVTDYHPLSKTLAEQHLSAGGPRFQAR-HNA-----
PAN3_PHANO            GD------------------SSLIIVTDYHPNSKSLADEHFKPMQ-RFNGRQATSS----
PAN3_CHAGB            GD------------------SSLIFAYDYHPLSKTLQEHHLQPTH-GNRYRAPS------
PAN3_NEUCR            GD------------------SSLIFVYDFHPLSETLYDHHFPPNNSHNRLRNTN------
PAN3_MAGO7            GD------------------SSLMFSFEYYPLAETLMEHHFPNAQHKTSFRSNTNH----
Q17PM7_AEDAE          GD------------------NSLVIVYDYHPGSQTLLSKYFIPSAESTNGYSDPFSGEVR
Q7Q6T6_ANOGA          GD------------------NSLVMVYDYHPGSQTLLSKYF-TSVPETNGYTDPFAGEAR
PAN3_DROME            GD------------------NSLVLVYDYHPGSQTLLAKYF-TPAPETNGYTDPFQGEAR
Q29E31_DROPS          GD------------------NSLVLVYDYYPGSQTLLAKYF-TPAPDTNGYTDPFQGEAR
A8XA39_CAEBR          ED------------------YSLIFAYDYYPLAETLMTKHF--DPKNVTNFYDPANNFRI
PAN3_CAEEL            DD------------------SSLIFAYDYYPLAGTLMEKHF--DTKSGT-FFDPNNGFRI
G3NFD9_GASAC          GD------------------HSLVFSYDFHAGAETMFGRHFSDPAADSYFTKRKWG----
I3K9I0_ORENI          GD------------------HSLVFSYDFHAGAETMFSRHFNDPAADSYFTKRKWGA---
H2SNS4_TAKRU          GD------------------HSLVFSYDFHAGAETMYSRHFNDPAADSYFTKRKWG----
E7EXP6_DANRE          GD------------------HSLVFSYDFHAGAETMFSRHFNDPAADSYFTKRKWG----
H2LXY8_ORYLA          GD------------------HSLVFSYDFHAGAETMFSRHFNDPSADSYFTKRKWG----
F1P381_CHICK          GE------------------HSLVFAYDFHAGGETMMSRHFNDPSADAYFTKRKWG----
H0ZN09_TAEGU          GE------------------HSLVFAYDFHAGGETMMSRHFNDPSADSYFTKRKWG----
G1KIR2_ANOCA          GE------------------HSLVFAYDFHAGGETMMSRHFNDPSADAYFTKRKWG----
PAN3_HUMAN            AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
H2RA81_PANTR          AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
PAN3_MOUSE            AE------------------PSLVFAYDFHAGGETMMSRHFNDPNSDAYFTKRKWG----
F1RSU6_PIG            SE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
F1PKU0_CANLF          AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
G1QHX6_NOMLE          AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
H2NJI2_PONAB          AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
F6Y6Y5_MACMU          AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
G1U195_RABIT          AE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
D4ADM2_RAT            SE------------------PSLVFAYDFHAGGETMMSRHFNDPNSDAYFTKRKWG----
H0VNI8_CAVPO          TE------------------PSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWG----
F7FR09_MONDO          GE------------------HSLVFAYDFHAGGETMMSRHFNDPSADAYFTKRKWG----
PAN3_XENTR            GE------------------HSLVFAYDFHAGSETMMSRHFNDPSADAYFTKRKWG----
H3BC88_LATCH          GE------------------HSLVFAYDFHAGGETMMSRHFNDPGADAYFTKRKWG----
Q4S571_TETNG          RR------------------PLTEAANAELPWLDVVSAQRWCSPTTSTRVQKPCTADTST
C3XW74_BRAFL          GE------------------HSLVFVHDYHPGAETLMAHHFNNPQQNKDFFEGTAAS---
W4XCT7_STRPU          GE------------------HSIVFVHDYHPGATTLMSRHFGHSGGLNSFRKGHSG----
PAN3_DICDI            DN------------------SSLFFTYEFFPGSETLESKYLS------------------
F4P6Y9_BATDJ          GD------------------SSLVLVYNYHPLAMTLTSKYFSRHDTHLVRGMDERE----
A8NJ49_COPC7          DD------------------NSLVVVYAYHPNAKTLYDTYLKQNKQTSSTSTTTGSTGSR
PAN3_CRYNJ            GD------------------NSLIMVYDYHPLSTTLYDEYLSPNPPEPSPASALANQPPK
A0A0D1E1J8_USTMA      GD------------------QSIVFVYDYHPLATTLYAEHMTIKAAQPDRRTGRLQPVSM
PAN3_YARLI            GD------------------ASLCMIYDFLPSAETLFDLLN-------------------
B6K186_SCHJY          ND------------------SSLMFVYDYYPCSRSLHQLYFSTQ-NSGGKTSIDD-----
PAN3_SCHPO            HD------------------SSLLLIYDFYPCTTTLGELYLNNSKNSVKLEENRK-----
                                                    .    :                        

PAN3_ASHGO            ------------------------VTQKYLWSYLVQLSNALNEVH-RHGLSMNNISLDKV
PAN3_KLULA            ------------------------LNQEYLWAFLVQLTIALQEVH-SNGLALNDLDWKKV
PAN3_CANGA            ------------------------VTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKI
PAN3_YEAST            ------------------------ITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKV
PAN3_CANAL            ------------------------VNEALLWNYLIQLINAIMAIHEKGLSASSTIDLSKI
PAN3_LODEL            ------------------------ITEDLLWSYLTQLVNAVAAIHAKKLALRSTIDLSKI
PAN3_DEBHA            ------------------------ITEELLWNYVIEITNALINIHENNLAARSALHLSKI
PAN3_PICST            ------------------------ITEDLLWNYLVQLVNALMAIHAKGLAARSALDLTKI
PAN3_PICGU            ------------------------LTEDILWLYLTQLVNAVRTVHKKKLAARSSLDLSKI
C0NEU6_AJECG          -----------------------HIPEQILWSYVTQIASALKAIHSVGLAARVIDPSKIL
PAN3_COCIM            -----------------------HIPEQILWSYVTQIANALKAIHSAGLAARVIEPSKIL
PAN3_NEOFI            -----------------------HIPEQILWGYMTQIANALKAIHSNGLAARVIDASKIL
PAN3_ASPFU            -----------------------HIPEQILWGYMTQIANALKAIHSNGLAARVIDASKIL
PAN3_ASPCL            -----------------------HIPEQVLWGYMTQIANALKAIHSNGLAARIIDASKIL
PAN3_ASPOR            -----------------------HIPEQVLWGYMTQIANGLKAIHSNGLAARILDPSKVL
PAN3_ASPTN            -----------------------HIPEQVLWGYMTQIANALKAIHSNGLAAKIIDPSKIL
PAN3_ASPNC            -----------------------HIPEQVLWGYMTQIANALKAIHASQLAARIIDPSKIL
PAN3_EMENI            -----------------------HVPEQILWGYITQIANALKCIHSAGLAARIIDPSKIL
PAN3_PHANO            -----------------------HVPEHVLWGYIVQIASALKAIHGSGLAARLISPSKTL
PAN3_CHAGB            -----------------------AVPENVLWGYICQITNALKTIHSNKLAARCLEPSKII
PAN3_NEUCR            -----------------------KIPENLLWSYVCQIANALLAIHNAKLAARCLELSKII
PAN3_MAGO7            -----------------------QASETVLWSYIVQISNALNSIHSNGLAARCIDATKII
Q17PM7_AEDAE          PFSHKSALHRA--------STSTLLPENEIWSVIIQLSAGLRAIHQAGLACRTLDPTKII
Q7Q6T6_ANOGA          PFSHKSSLHRT--------AATSLLPENEIWSIIIQLSAGLRAIHQAGLACRTLDPTKII
PAN3_DROME            PFSHKSNMQRT--------SNGPLLPEATIWSIIMQLTAGLKAIHHAGLACKVLDPTKII
Q29E31_DROPS          PFSHKSNMQRT--------SNGPLLPEATIWSIIMQLTAGLRAIHQAGLACKVLDPTKII
A8XA39_CAEBR          TSPMGVPVSLG--------PSG--ANETMIWSYIIQIAAALRAIHASGLACRTLDLNKII
PAN3_CAEEL            SSPMNVSMPIS--------GTG--AHETLIWSYIIQIAAALRAIHSSGLACRTLDLNKII
G3NFD9_GASAC          --QHEPPPPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPSKIL
I3K9I0_ORENI          -GQHEPPPPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPSKIL
H2SNS4_TAKRU          --QHEPPPPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPSKIL
E7EXP6_DANRE          --QHELPPPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPSKIL
H2LXY8_ORYLA          --QHEPPQPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPSKIL
F1P381_CHICK          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
H0ZN09_TAEGU          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
G1KIR2_ANOCA          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
PAN3_HUMAN            --QHEGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
H2RA81_PANTR          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
PAN3_MOUSE            --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
F1RSU6_PIG            --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
F1PKU0_CANLF          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
G1QHX6_NOMLE          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
H2NJI2_PONAB          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
F6Y6Y5_MACMU          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
G1U195_RABIT          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
D4ADM2_RAT            --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
H0VNI8_CAVPO          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
F7FR09_MONDO          --QHDGPLPRQ---------HAGLLPESLIWAYVVQLSSALRTIHTAGLACRVMDPTKIL
PAN3_XENTR            --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKIL
H3BC88_LATCH          --QHDGPLPRQ---------HAGLLPESLIWAYIVQLSSALRTIHTAGLACRAMDPTKIL
Q4S571_TETNG          TQQQTPTSPRES-------GHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPSKIL
C3XW74_BRAFL          --KGMVNGPRQ---------HAGLLPESLIWCYVVQLSSALRTIHAAGLACRVMDPTKIL
W4XCT7_STRPU          ------PFPGSR--------APGLLPEGLIWTYIVQLSSALRAIHTAGLACRVMDPTKIL
PAN3_DICDI            -------------------QSGNPLSESVLWSFICQITSALKTIHSAGLVCRVIHPSKIL
F4P6Y9_BATDJ          -----------------------------LWSFICQITSALKTIHMHTLAARAIDPSKVI
A8NJ49_COPC7          FGRYQSGTTHYTPQASPAIGQGPAIPERTIWSYIVQIATAIKRVHEAGHALRGLDASKVI
PAN3_CRYNJ            --------------------RRSSPPERILWSYVTQIANALKAIHSSGLAVRNLDASKIL
A0A0D1E1J8_USTMA      -----------------------QVPERTLWSYLCQLTSALRSIHSSNLAARCIEASKVL
PAN3_YARLI            --------------------RGQQFSRDVIISYLLQLLSVLDTIHSAGLAAKTVDPTKIL
B6K186_SCHJY          ------------------------LNEKTLWFFMCQTASALHYLHNHGLSPSGISLSRVL
PAN3_SCHPO            ------------------------IPERELWNYFFQLTIALSYLHKSGFACNKLTPSRIL
                                                   :     :    :  :*              :

PAN3_ASHGO            IVTGDPGRIKVGDSAVHDILAFD--------EGRDIAKE---------QQADYSAVGALL
PAN3_KLULA            IVTGEPGRIKVTDIGVYDTLNYHQ-------EGRMLHTE---------QQQNYLSLAELL
PAN3_CANGA            ILTGK-GRIKISAGAEYDIMNMCCPEDNE--DDDNEEKL---------RKRNFVDLGEIL
PAN3_YEAST            LITGDPGRIKLSHCNFMDLLFNDDTDTVVSSGGSTIEGQ---------QQLDYKYLGELL
PAN3_CANAL            IVTNK-NRIKLSSVGISDILEFK---------DDETNQD-----IKIRQLQDIQKVGKVL
PAN3_LODEL            INTTE-DRIKLSGCGISEVLSFSASNANASSGEEDEERE-----FARLRALDIVDLGKVL
PAN3_DEBHA            LVTNK-NRVRLGGVGISDILNYE-------DDEEQIQQKGLDAFRHELQQADIKKFGKLI
PAN3_PICST            IVTNK-NRIRLSNLAISDILNFE-------KDEEEISKS--NRYFQGLQREDIKKLGRIL
PAN3_PICGU            IVTT--NRIRLAAIGMSDILNWE-------ADDAEIARVGLPTYMENLQQEDIRNMARLM
C0NEU6_AJECG          LTGKN--RIRLNACAILDVVQHDS------QRSITDLQS-----------QDLVNFGQLI
PAN3_COCIM            LTGKN--RIRLNACGILDVVQFDS------QRPLADLQH-----------QDLVNFGQLI
PAN3_NEOFI            LTGKN--RIRLNACAIMDVVQFDS------QRTVTDLQR-----------QDLVNFGQLI
PAN3_ASPFU            LTGKN--RIRLNACAIMDVVQFDS------QRTVADLQR-----------QDLVNFGQLI
PAN3_ASPCL            LTGKN--RIRLNACAIMDVVQYDS------QRTVADLQR-----------QDLVNFGQLI
PAN3_ASPOR            VTGKN--RIRLNACAIMDVVQYDT------QRSIAELQR-----------QDLVNFGQLI
PAN3_ASPTN            LTGRN--RIRLNACAIMDVVQFDT------QRSIADLQH-----------QDLVSFGQLI
PAN3_ASPNC            LTGRN--RIRLNACAIMDVVQFDT------QRSLAELQR-----------QDLVNFGQLI
PAN3_EMENI            LTGRN--RIRLNACAIMDVVQYDA------QRSVADLQR-----------QDLVNFGQLI
PAN3_PHANO            LTAKN--RIRLNACAIMDIVQFET------ARPVAEAQA-----------DDFVQLGRMI
PAN3_CHAGB            LSDNN--RIRLSACSILDVVQFES-----NTKSVAELQQ-----------EDLVKFGKLI
PAN3_NEUCR            WE-NN--RIRLAACSILDVLHHDSP----NRKTIEELQQ-----------EDFVKFGRII
PAN3_MAGO7            ITGKN--HIRLSSCGILDVINYEK------SKPMTELQE-----------EDFVAFGKLI
Q17PM7_AEDAE          ITGK---RIRFSCVAISDLATYDPSQTN-PLTVVNHHQQ-----------DDLTAFGKLI
Q7Q6T6_ANOGA          VTGK---RIRYSCVGISDIFSFDPNQPN-PLTVLDHHQQ-----------EDLLALGKLI
PAN3_DROME            VTGK---RVRFSSCCISDITQFDPNASN-PLALVNMHQQ-----------DDLTALGRLV
Q29E31_DROPS          VTGK---RVRFSSCCISDITQFDPNAAN-PLALVNMHQQ-----------DDLTALGRLV
A8XA39_CAEBR          CYGN---KIMLSFCGIADVLDPDS-------TPIQQQQN-----------EDLNMFGNII
PAN3_CAEEL            TYGN---KIMISFCGIQDVLDPDP-------TTIQQQQN-----------EDLNMFGNLI
G3NFD9_GASAC          ITGKT--RLRVNCVGVFDVLTFDSSQTN-HLALMPQYQQ-----------ADLVSLGKVV
I3K9I0_ORENI          ITGKT--RLRVNCVGVFDVLTFDNSQTN-HLALMPQYQQ-----------ADLVSLGKVV
H2SNS4_TAKRU          ITGKT--RLRVNCVGVFDVLTFDNSQTN-HLALMPQYQQ-----------ADLVSLGKVV
E7EXP6_DANRE          ITGKT--RLRVNCVGMFDVLTFDNSQTN-HLALMPQYQQ-----------ADLISLGKVV
H2LXY8_ORYLA          ITGKT--RLRVNCVGVFDVLTFDNTQSN-HLALMPQYQQ-----------ADLVSLGKVV
F1P381_CHICK          VTGKT--RLRVNCVGIFDVLTFDNSQNN-PLALMAQFQQ-----------TDLISLGKVV
H0ZN09_TAEGU          VTGKT--RLRVNCVGIFDVLTFDNSQNN-PLALMAQFQQ-----------ADLISLGKVV
G1KIR2_ANOCA          VTGKT--RLRVNCVGVFDVLTFDNSQTN-PLALMAQYQQ-----------ADLISLGKVV
PAN3_HUMAN            ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
H2RA81_PANTR          ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
PAN3_MOUSE            ITSKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
F1RSU6_PIG            ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
F1PKU0_CANLF          ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
G1QHX6_NOMLE          ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
H2NJI2_PONAB          ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
F6Y6Y5_MACMU          ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
G1U195_RABIT          ITGKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
D4ADM2_RAT            ITSKT--RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQ-----------ADLISLGKVV
H0VNI8_CAVPO          ITGKT--RLRVNCVGIFDVLTFDNSQNNNPLAIMAQYQQ-----------ADLISLGKVV
F7FR09_MONDO          ITGKT--RLRVNCAGIFDVLTFDNSQNN-PLALMAQFQQ-----------ADLMSLGKVV
PAN3_XENTR            ITGKT--RLRVNCVGIFDVLTYDGSQNN-PVALMPQYQQ-----------ADLISLGKVV
H3BC88_LATCH          ITGKT--RLRVNCVGIFDVLTFDNSQNN-PMAMMAQYQQ-----------ADLISLGKVV
Q4S571_TETNG          ITGKT--RLRVNCVGVFDVLTFDNSQTN-HLALMPQYQQ-----------ADLVSLGKVV
C3XW74_BRAFL          ITGKS--RLRVNCVGIFDVLTFDVNQSN-PMALIPQFQQ-----------EDLLSLGKVV
W4XCT7_STRPU          ILAKS--RLRVNCVGIFDVLTFDPSQSN-PLAMISHYQQ-----------EDLISLGKVI
PAN3_DICDI            LTGKN--RIRMNGVGIFDVVNFDTPR------ILAQYQH-----------EDLLLFGRLI
F4P6Y9_BATDJ          VTGKN--RFSLNCCGVMDMLTFEANSSL------AQLQQ-----------EDLRNFGKLI
A8NJ49_COPC7          ITGQN--RIRISACGTMDVLMHDV------PQDIHLMQQ-----------EDLTQFGRLI
PAN3_CRYNJ            LTGKN--RIRLNGCGVWDVLAFDN------KTPVQAFQQ-----------EDLLSFGKLI
A0A0D1E1J8_USTMA      RTGKN--RVRINCCSVFDVIAYNPDETG--SDALKAQQQ-----------EDMVNLGALI
PAN3_YARLI            VCGPG--RVRLNCCGLYDVINFDKDEN------VTLFQQ-----------QDLRNLGLLV
B6K186_SCHJY          VDSNN--RIRLSSCATKSLLQSDT-------LSIEESKN-----------DDIKSFGKMM
PAN3_SCHPO            VDQTE--RIRISGCADYELVVSNK-------PPLEERKK-----------QDFVDLGVVI
                             :.        .                                 :   .. ::

PAN3_ASHGO            MDLAQRMLGTRD--QPLDSM-------------DIDPLFKRVLAYLLSD-----------
PAN3_KLULA            LNLVQRLCGASGPLDDVKSY-------------HIDPLFKKCIQYLQDTS---------N
PAN3_CANGA            FKLASKMCNCHGKDVANLAQ-------------VSEKLKNLIKSLAFEQL-------HDY
PAN3_YEAST            FNLSINIENSNNNTAPKEYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNG--------D
PAN3_CANAL            MELAILLLPVNMRQS--NNIYNSLKAST-----NLSEEIINNLQELND--LD-----TAS
PAN3_LODEL            LELSALLLPMNLRASLTSTLLKNLANST-----KLSQNFLDVLQVLTDPSLL----QEPY
PAN3_DEBHA            LDLAALCLPNNARNHEPKDLISLLKTSTT---VNFSGEFINLLTELNM-----------N
PAN3_PICST            LSLSTLTIPNTLRNNDTGELLRHLKTSST---ISFSDEFIQVLTVLNE---------DTV
PAN3_PICGU            VDLTTVMNPVVQNDI------FKLKSSG------LSTDFVAAVQDLSN------------
C0NEU6_AJECG          ITLGANSPSVMHN--PTKAMEHFTRAYTP----QLKNSIFWLLSALQ-----------KD
PAN3_COCIM            LTLGANSPSLMHN--PTKATEHFNRSYSA----QLNNSVYWLLSGMQ-----------KD
PAN3_NEOFI            VTLGANSPTVMHN--PTKAMEHFTRAYSP----QLKNSVFWLLNGMQ-----------KD
PAN3_ASPFU            VTLGANSPTVMHN--PTKAMEHFTRAYSP----QLKNSVFWLLNGMQ-----------KD
PAN3_ASPCL            VTLGANSPTVMHN--PTKAMEHFTRAYSP----QMKNSVFWLLNGLQ-----------KD
PAN3_ASPOR            VTLGANTPSVMHN--PTKAMEHFTRAYSP----QLKNSVFWLLNGLQ-----------KD
PAN3_ASPTN            VTLGANSPSVMHN--PTKAMEHFTRAYSP----QMKNSVFWLLNSMQ-----------KD
PAN3_ASPNC            VTLGANQPNVMHN--PTKAMEHFTRAYTA----QLKNSVFWLLNGLQ-----------KD
PAN3_EMENI            LTLGANQPNVIHN--PSKAMEHFTRAYSP----QLKNTVMWLLGGMQ-----------KD
PAN3_PHANO            LCIANNNTTAHLQ--MQKSMDHVTRNYTA----RLKECIQWLLNPQPPLGTPSSPTTPAP
PAN3_CHAGB            LALATGAPPAHLNN-IQVALDSLVTKYSA----NLKDAVAWLIAPSN-----------PG
PAN3_NEUCR            LALATNTPTLNFNN-IDAALATIVPRYST----QLRGVLEWLIKPSA-----------PG
PAN3_MAGO7            VSLATNTPPTGLN--LGKAIEQMGRNHSS----TLKDMVLWLLNPPQ-----------AS
Q17PM7_AEDAE          LALACRSLQSVQRDQIQNSIELISRHYSS----DLRNIILYLLSS-SNR-----------
Q7Q6T6_ANOGA          LALACRSLQSVQRDQIQSSVELVSRHYSS----DLRNILICLLNT-NTR-----------
PAN3_DROME            LALACRCLQSVQRDNVQSSIDMVTRNYST----DLRNFIVYLFTT-NNR-----------
Q29E31_DROPS          LALACRCLQSVQRDNVQSSIDMVTRNYST----DLRNFIVYLFTT-NNR-----------
A8XA39_CAEBR          VSLATGRANAWRKDLYPQSKKLIDENFSI----DLRNVIGFLHNN-GSR-----------
PAN3_CAEEL            VALATGRANGWRKDLYQQLKKFIEDTYSM----DLRNVIGFLHNN-STR-----------
G3NFD9_GASAC          LALACNSLAGIQRENLQKAMELVSINYSS----DLKNLILYLLTE-QSRL----------
I3K9I0_ORENI          LALACNSLAGIQRENLQKAMELVSINYSS----DLKNLILYLLTE-QSRL----------
H2SNS4_TAKRU          LALACNSLAGIQRENLQKAMELVSLNYSS----DLKNLILYLLTD-QSRL----------
E7EXP6_DANRE          LALACNSLAGIQRENLQKAMELVSINYSS----DLKNLILYLLSE-QSRL----------
H2LXY8_ORYLA          LALACNSLAGIQRENLQKAMELVSLNYSS----DLKNLILYLLSE-QSRL----------
F1P381_CHICK          LALACNSLSGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRL----------
H0ZN09_TAEGU          LALACNSLSGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRL----------
G1KIR2_ANOCA          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRL----------
PAN3_HUMAN            LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
H2RA81_PANTR          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
PAN3_MOUSE            LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
F1RSU6_PIG            LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
F1PKU0_CANLF          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
G1QHX6_NOMLE          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
H2NJI2_PONAB          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
F6Y6Y5_MACMU          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
G1U195_RABIT          LALACNSLAGIQRENLQKAMELVTINYSS----DLKYLILYLLTD-QNRM----------
D4ADM2_RAT            LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
H0VNI8_CAVPO          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRM----------
F7FR09_MONDO          LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRL----------
PAN3_XENTR            LALACNSLAGIQRENLQKAMELVTINYSS----DLKNLILYLLTE-QNRM----------
H3BC88_LATCH          LALACNSLVGIQRENLQKAMELVTINYSS----DLKNLILYLLTD-QNRL----------
Q4S571_TETNG          LALACNSLAGIQRENLQKAMELVSLNYSS----DLKNLILYLLTE-QSRL----------
C3XW74_BRAFL          LALACNSVAGIQREFLQKAMELVTLNYSS----DLKNLILYLLTN-QGRP----------
W4XCT7_STRPU          LALACNSVQSIQRQRLSASVDLVAHQYSA----DLKNLVLYLLTS-QPRP----------
PAN3_DICDI            LTLACRSAQSTTTTNLSKSIEYVSNQYSK----ELYNLIVYLLTKPVINL----------
F4P6Y9_BATDJ          VSLAVGSLPALQ--NIQKCLDHIRKHFSP----DLTTVVMYLLGN-TPAI----------
A8NJ49_COPC7          FALCCGSTNASSGPHFQKSVDHLLRVYGQ----EIKSLALWLISKQT-------------
PAN3_CRYNJ            ISLTCDFFQPT--LPFSLPLEHISRHYSS----DLSNLILYLISKPAQ-----------G
A0A0D1E1J8_USTMA      VSIGLNSISAT--NDIASSLATFAGRYSA----ELKNVVAWLVAQTPAPYESVGGDDVVE
PAN3_YARLI            LCLACNSVEAT------KNVEQSLTRLDS----ELQEIVQYLLSSNTSKT----------
B6K186_SCHJY          VALCTGNVDEDLTTAATNIRKNYSHDFWK--------AIIFLISETHENK----------
PAN3_SCHPO            ANLATGRTDMDMSSAARAIYSTYSREFYK--------AVLYFVSEVPEDK----------
                        :                                                         

PAN3_ASHGO            EKKTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESS
PAN3_KLULA            NNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQLSRELENARLFRLMCKLNAIYGRLESR
PAN3_CANGA            VNVATIIEKYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNFIFGRVENR
PAN3_YEAST            SKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESR
PAN3_CANAL            GEFDLNEFSQRLTPKMFNIIDSLQNSSDFIEGQLTSELENARLFRLMTKLNYLIHD----
PAN3_LODEL            SFDMDQFILQYISSHFMTLMNKLQNSHDWVELQLSTELENARLFRLMTKINFIISEMP--
PAN3_DEBHA            TSDLQEFNRNHLSRRILNFCSNAQDSQDFMESQLSTELENARVFRLITKLNFIIDRPEYD
PAN3_PICST            EFDLDRFSQRYLTTRLFSTINNLEDSTDFMESQITTELENARLFRLLTKLNFIIDRPE--
PAN3_PICGU            TDDLESYIRKHLAIRLLDVVDMLEDSNDYLESQLSTELENARLVRLMTKINFIVDRPEWD
C0NEU6_AJECG          QERNIDLFVTGISSQLISTFDSALHLDDELTSDLSRELENGRLVRLLTKLNFINERP---
PAN3_COCIM            QERTIDIFISGISSQLMSTFDSSLHLDDQLISDLSRELENARLVRLLTKLNFINERP---
PAN3_NEOFI            QDRNIDIFITGISSQLMSTFDSALHLDDQLTSDLSRELENGRLVRLMTKLNFVNERP---
PAN3_ASPFU            QDRNIDVFITGISSQLMSTFDSALHLDDQLTSDLSRELENGRLVRLMAKLNFVNERP---
PAN3_ASPCL            QDRNIDIFITGISSQLMSTFDSALHLDDQLTSDLSRELENGRLVRLMTKLNLVNERP---
PAN3_ASPOR            QDRNIDIFITGISSQLMSTFDSALHLDDELTSDLSRELENGRLVRLVTKLNFVNERP---
PAN3_ASPTN            QDHTIDIFITGISSQLMSTFDSALHMDDQLTSDLSRELENGRLVRLMTKLNFINERP---
PAN3_ASPNC            QERNIDIFITGISSTLMSTFDSALHLDDQLTSDLSRELENGRLVRLMTKLNFVNERP---
PAN3_EMENI            QERNIDILINGISSQLMSTFDSALHLDDQLTSDLGRELENGRLVRLLTKLNFINERP---
PAN3_PHANO            GSKDIDNFLGGISDQLASVFDSELHAQDTLTNTLGRELESSRIVRLLVKLNMVNERP---
PAN3_CHAGB            ESKSIENFISGIATHMTAFFDLALQDGDEKQFHLARELENGRIARSMMKLMTIIERA---
PAN3_NEUCR            ETKTVETLLGGITTHLANFANFVMQESDEKEFHLMRELENGRIARLMFKLSVVNERG---
PAN3_MAGO7            GQKTVKNLVAGINEHVMTAFDAQQRQSDMLYSELYREVENGRVLRLLMKLATINERT---
Q17PM7_AEDAE          --RSVTEIMPMIGARFYVQLDALQSQCDIQEDELAREMENGRLYRLLVKLGTVNERP---
Q7Q6T6_ANOGA          --RSVTEIMPMIGARFYVQLDALQAQCDIQEDELAKEMENGRLYRLLVKLGCINERP---
PAN3_DROME            --RSVTDLMPMIGARFYTQLDALQSKIDMQEDELAKEMENGRLYRILVKLNSINERP---
Q29E31_DROPS          --RSVTDLMPMIGARFYTQLDALQSQIDMQEDELAKEMENGRLYRILVKLNSINERP---
A8XA39_CAEBR          --KTINEIMPMIGGRFFTVMENMQAKTDVLEGELSREMENGRLLRLLAKMNTVLERV---
PAN3_CAEEL            --KTINEIMPMIGGRFFTVMENMQAKTDVLEAELSREMENGRLFRLVAKMNTVLERV---
G3NFD9_GASAC          --RSVNDIMPMIGARFYTQLDASQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
I3K9I0_ORENI          --RSVNDIMPMIGARFYTQLDASQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H2SNS4_TAKRU          --RSVNDIMPMIGARFYTQLDASQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
E7EXP6_DANRE          --RSVNDIMPMIGARFYTQLDASQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H2LXY8_ORYLA          --RSVNDIMPMIGARFYTQLDASQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
F1P381_CHICK          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H0ZN09_TAEGU          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
G1KIR2_ANOCA          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
PAN3_HUMAN            --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H2RA81_PANTR          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
PAN3_MOUSE            --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
F1RSU6_PIG            --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
F1PKU0_CANLF          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
G1QHX6_NOMLE          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H2NJI2_PONAB          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
F6Y6Y5_MACMU          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
G1U195_RABIT          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
D4ADM2_RAT            --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H0VNI8_CAVPO          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
F7FR09_MONDO          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
PAN3_XENTR            --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
H3BC88_LATCH          --RSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRMFRLLAKLGTINERP---
Q4S571_TETNG          --RSVNDIMPMIGARFYTQLDASQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERP---
C3XW74_BRAFL          --KSVNDIMPMIGARFYTQLDAAHMRCDVIESELAKEVENGRLFRLLCKLGIINDRP---
W4XCT7_STRPU          --RSVNDIMPMIGARFYTQLDAALMCNDVLEEQLSREIQNGRLFRLLCKLGVMNERP---
PAN3_DICDI            --PNIDEVVLMISGRLLQENNYLHTYTDDLETELSKEYENGRLFRLVTKLGFINERP---
F4P6Y9_BATDJ          --KSIDGILQLIASRLLDEMDSAFRYNDRLEDDLSRELENARLVRLMSKLGFINERP---
A8NJ49_COPC7          -MKSIDQVLDSIRHRVLLEQEEALLAVDRLEVELQSELENARLVRLMTKLGFINERP---
PAN3_CRYNJ            QIKSIDEVVKMMGPRILNELDAVQSYADVLENELGAEVENGRIVRLLTKLGFINERA---
A0A0D1E1J8_USTMA      VARNVTELIKVLGSHCADEMDSALNYTDLMENSLMKELENGRLVRLLCKFGFINERP---
PAN3_YARLI            ----ASRVLASLTPLLTATFNESLNTNDSLEHELRRELENGRLVRLMAKLNFITERPGP-
B6K186_SCHJY          ---DMTNFMNLIAPQLMQIVNNSFAKTQKTEACLSGLMEHNRIVRILFKLIHVLENP---
PAN3_SCHPO            ---NLELFLQNHIESFFPIMSSPYVECEKMERKISDAFQHGRFFNILCKIMFIIDN----
                                          .      :     :    :  *. . : *:  :       

PAN3_ASHGO            M-----DIHWS------------EAGDKFPIILFYDYVFHQVD-ENGKSVMDLTHVLRCL
PAN3_KLULA            I-----DINWA------------ESGEKFPIILFFDYVFHQKD-DTGKNVMDLTHVLRCL
PAN3_CANGA            L-----DINWS------------EPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCL
PAN3_YEAST            I-----DINWS------------ESGTKFPIILFYDYVFHQVD-SNGKPIMDLTHVLRCL
PAN3_CANAL            --------NSN------------SEN-DKIIKLFLNYVYNCYD-SNNKKVINLNKVLINL
PAN3_LODEL            ------TYDLN------------SQNRLKIIKVFQENLFNSVG-PNGKKVVNMDRVLVNL
PAN3_DEBHA            N-----DPNWQ------------ENGNKYIIKLFRDYIFFQYD-EFGKPVCDLSRVLTNL
PAN3_PICST            ------AKDWT------------ENSNKYIIKLFRDYIFFQHD-EYGKPVVDLSRVLTNL
PAN3_PICGU            NEATAAAAGWT------------ENGPKYLLKLFRDFVFFQTD-EMGKPVTDLSRVLVTL
C0NEU6_AJECG          --EYDHDPQWA------------ENGERYVLKLFRDYVFHQID-AQNLPVVDLGHVLTCL
PAN3_COCIM            --EYEHDRQWS------------ENGERYFLKLFRDYVFHQVD-AQNAPVVDLGHVLTCL
PAN3_NEOFI            --EYEHDRQWS------------ENGERYFLKIFRDYVFHQVD-VQGDPVVDLGHVISCL
PAN3_ASPFU            --EYEHDRQWS------------ENGERYFLKIFRDYVFHQVD-AQGDPVVDLGHVITCL
PAN3_ASPCL            --EYEHDRQWS------------ENGERYFLKIFRDYVFHQVD-AQGDAVVDLGHVLSCL
PAN3_ASPOR            --EYEHDRQWS------------ENGERYFLKMFRDYVFHQVD-AQGDPVVDLGHVLSCL
PAN3_ASPTN            --EYEHDRQWS------------ENGERYFLKIFRDYVFHQVD-AHGDPVVDLGHVLACL
PAN3_ASPNC            --EYEHDRQWS------------ENGERYFLKIFRDYVFHQVD-AQGDPVVDLGHVLMCL
PAN3_EMENI            --EHEHDRQWS------------ENGERFYLKIFRDYVFHQVD-ASGDPVVDLGHVLTCL
PAN3_PHANO            --ELDASQQMSGGNTSNPSSVWAETGERYYLKLFRDYVFHQVD-ANGHPVTDLAHVLDCL
PAN3_CHAGB            --EPGGAQSWS------------ETGERYQLKLFRDYVFHRVE-ADGKPNLAVGHMLSCL
PAN3_NEUCR            --DSCGVHNWS------------ETGERLLLKLFRDYVFHQVD-ADGKARLDTNHYLNCL
PAN3_MAGO7            --EYDKDAGWS------------ENGDRYMLKLFRDYVFHQVD-AQGRPVLDPGHMLRCL
Q17PM7_AEDAE          --ELNLDVTWS------------ETGDRYMLKLFRDYLFHTVT-EDGRPWLNQSHIVQCL
Q7Q6T6_ANOGA          --ELNLDVTWS------------ETGDRYMLKLFRDYLFHTVT-EDGRPWLNQSHIVQCL
PAN3_DROME            --DFNLDCTWS------------ETGDRYMLKLFRDYLFHSVT-EDGRPWLDHAHIVQCL
Q29E31_DROPS          --DFNLDCTWS------------ETGDRYMLKLFRDYLFHSVT-EDGRPWMDHAHIVQSL
A8XA39_CAEBR          --ENGTEEGWS------------ETGDRFMLKLFRDYVFHQVT-DQGRAWLDMAHIVQCL
PAN3_CAEEL            --EHGTDDAWS------------ETGDRFMLKLFRDYVFHQVT-DQGKAWLDMAHIVQCL
G3NFD9_GASAC          --EFQKDPSWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIVSCL
I3K9I0_ORENI          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIVSCL
H2SNS4_TAKRU          --EFQKDPAWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIVSCL
E7EXP6_DANRE          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-ETGTPWVDLSHIVSCL
H2LXY8_ORYLA          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-ETGSPWIDLSHIVSCL
F1P381_CHICK          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIISCL
H0ZN09_TAEGU          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIISCL
G1KIR2_ANOCA          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIISCL
PAN3_HUMAN            --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
H2RA81_PANTR          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
PAN3_MOUSE            --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
F1RSU6_PIG            --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
F1PKU0_CANLF          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
G1QHX6_NOMLE          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
H2NJI2_PONAB          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
F6Y6Y5_MACMU          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
G1U195_RABIT          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
D4ADM2_RAT            --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
H0VNI8_CAVPO          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
F7FR09_MONDO          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGAPWIDLSHIISCL
PAN3_XENTR            --EFQKDPAWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIVSCL
H3BC88_LATCH          --EFQKDPTWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIISCL
Q4S571_TETNG          --EFQKDPAWS------------ETGDRYLLKLFRDHLFHQVT-EAGTPWIDLSHIVSCL
C3XW74_BRAFL          --GLGLDSDWS------------ETGDRYLLKLFRDYLFHQVT-ESGEPWIDMAHVVQCL
W4XCT7_STRPU          --EFHGDVQWA------------ETGDRYLLKLFRDHLFHQVK-ETGNPWIDLSHIVQCL
PAN3_DICDI            --LYDMDPRWS------------ETGDRYLIKLFRDYIFHQVY-DDGTPVLDFYHVVETL
F4P6Y9_BATDJ          --EYDLDPTWA------------ETGDVYLLKLFRDYIFHQVD-QNGAPLLDLGHVIQTL
A8NJ49_COPC7          --EFAREPRWS------------ETGDRYIIKLFRDYVFHQVD-EHGNPVLDMSHVLTCL
PAN3_CRYNJ            --EFELDPRWS------------DTGDRYILKLFRDYVFHSVG-VDGKPILDLSHVLVCL
A0A0D1E1J8_USTMA      --EFDHDPRWA------------ETGDRYVIKLFRDHVFHSVD-EAGRPVVDLSHILTNL
PAN3_YARLI            --DPEMSQQWS------------ETGDRYLIKLFRDYVFHQQD-EMGKPVMDLGHVVRTL
B6K186_SCHJY          ---NAAVNPRS----------LTKEKRVQLSQLFRDFVFHQVD-ESGSPVLDLQHVLTCL
PAN3_SCHPO            ---NRASREYP----------IAREKEISLIYLLRDYLFHQID-EDECPVIDLYQVLNRL
                                                      :: : ::               : :  *

PAN3_ASHGO            NKLDTGVSEKIILVTPDEMNCIIISYKELKDSIDSTFRSMTQ------------------
PAN3_KLULA            NKLDAGVSERLMLVTPDEMNCIIISYKELKDLIDSTFRALTQ------------------
PAN3_CANGA            NKLDAGVEENILLVTPDELNTAVVSYKKVKELVDKTFRAMTL------------------
PAN3_YEAST            NKLDAGIQEKLMLVTPDELNCIIISYKELKDLIESTFRSITQ------------------
PAN3_CANAL            NKLDCGIDEKILLVNNDE--CIIISYKELKEIIDTKFRLMRE------------------
PAN3_LODEL            NKLDCGIDEKTLLISDKE--CMIITFKEIKELIDTQFRLLRG------------------
PAN3_DEBHA            NKLDAGIDEKFLLVNKDEKNCIIVSYKEIRDIIDSAFRTLTRG-----------------
PAN3_PICST            NKLDAGIDEKFLLVSRDEKNCIIVSYKEIRDTIDSVFRNLTRD-----------------
PAN3_PICGU            NKLDAGIDEKFLLVSRDEKTCIVVSYKEIRDLLESVFRTITRGK----------------
C0NEU6_AJECG          NKLDAGTEEKVTLVSRDEQSCFIVSYKELKKAVESSFQALTKHP--RRA-----------
PAN3_COCIM            NKLDAGTDEKVTLISRDEQSCFIVSYKELKKAVEASFQALLKPA--RRI-----------
PAN3_NEOFI            NKLDAGTEEKITLISRDEQSCFIVSYKELKKALESSFQALMKPA--RRMH----------
PAN3_ASPFU            NKLDAGTEEKITLISRDEQSCFIVSYKELKKALESSFQALMKPA--RRMH----------
PAN3_ASPCL            NKLDAGSDEKITLVSRDEQSCFIVSYKELKKALESSFQALLKPA--RRMH----------
PAN3_ASPOR            NKLDAGTDEKITLVSRDEQSCFVVSYKDIKKALESSFQALLKPT--RRLH----------
PAN3_ASPTN            NKLDAGSDEKITLVSRDEQSCFIVSYKEIKKALESSFQALLKPT--RRVH----------
PAN3_ASPNC            NKLDAGTDEKITLISRDEQSCFVVSYKELKKALESSFQALLKPSASRRLH----------
PAN3_EMENI            NKLDAGTDERITLVSRDEQTCFVVSYKELKKGLESSFQALLRPS--RRPH----------
PAN3_PHANO            NKLDAGTDEKIALISRDEQNVLIVSFREVKRGLEIAFQDLIRAG--RGQGK---------
PAN3_CHAGB            SKLDAGIDEMVVLTSRDNETVFVLSYRELKQMFDRAFNELVKHSKTG-----APGANN--
PAN3_NEUCR            SKLDASSEEQILLTSRDNATVFVVSYRSIRQMLDRAYGELGKESKPS-----ATGATI--
PAN3_MAGO7            SKLDVGTEERIKLTSRDCETDFLVTYKDLKGAVQSAFGELLKGSGNGRGGPVASGSGHGV
Q17PM7_AEDAE          NKLDAGTVEKVQLMSRDEQSVLVVTYAELKHCLEQAFSELVAATTV--------------
Q7Q6T6_ANOGA          NKLDAGTMEKVQLMSRDEQSVLVVTYAELKHCLDQAFSELVAASEGSV------------
PAN3_DROME            NKLDAGSIERVQLMSRDEQSVLIVSYAELKNCLENAFSELMSSAAN--------------
Q29E31_DROPS          NKLDAGSIERVQLMSRDEQSVLIVSYAELKNCLENAFSELMSSAAN--------------
A8XA39_CAEBR          NKLDCGTLEKIEMVARGGDTQIIIDYATLKKCLEKSYRELMGNTMMIVHR----------
PAN3_CAEEL            NKLDCGSQEKIEMVSRSGDTQIIIDYATLKRCLDKSFRDLLGTNMMLHR-----------
G3NFD9_GASAC          NKLDAGVPEKISLVSRDEKSVLVVTYSDLKRCFDSTFQELQAAAS-GSL-----------
I3K9I0_ORENI          NKLDAGVPEKISLVSRDEKSVLVVTYSDLKRCFDSTFQELQAAAS-GSL-----------
H2SNS4_TAKRU          NKLDAGVPEKISLVSRDEKSVLVVTYSDLKRCFDNTFQELQSVAS-GSL-----------
E7EXP6_DANRE          NKLDAGVPEKISLVSRDEKSVLVVTYSDLKRCFESTFQELLATAN-GPL-----------
H2LXY8_ORYLA          NKLDAGVPEKISLVSRDEKSILVVTYSDLKRCFDSTFQELQAAAA-GSL-----------
F1P381_CHICK          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
H0ZN09_TAEGU          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
G1KIR2_ANOCA          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELVAAAN-GQL-----------
PAN3_HUMAN            NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
H2RA81_PANTR          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
PAN3_MOUSE            NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GNDRNSN-------
F1RSU6_PIG            NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
F1PKU0_CANLF          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
G1QHX6_NOMLE          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
H2NJI2_PONAB          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
F6Y6Y5_MACMU          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
G1U195_RABIT          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
D4ADM2_RAT            NKLDAGVPEKISLTSRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GE------------
H0VNI8_CAVPO          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
F7FR09_MONDO          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAAN-GQL-----------
PAN3_XENTR            NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELVAAAN-GQL-----------
H3BC88_LATCH          NKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENAFQELLAASN-GQL-----------
Q4S571_TETNG          NKLDAGVPEKISLVSRDEKSVLVVTYSDLKRCFDNTFQELQSVAS-GSL-----------
C3XW74_BRAFL          NKLDTGVPEKLCLVSRDEQSVLVLNYHDLKRCFEQAFQEVLTASQPGEQPPTSLHQ----
W4XCT7_STRPU          NKLDAGIPEKVCLMSRDEQNILVVSYSDLKHCFQTTFSEVFQASQPSPENIGH-------
PAN3_DICDI            NKLDCGVDEKILLMSRDEQSLLVVSYKDLKKCIDSAFSELVSQKSHI-------------
F4P6Y9_BATDJ          NKLDVGVDEKIMLTSRDEKSCLVASYRDLKQCIDTTFREMIARRGWQK------------
A8NJ49_COPC7          NKLDAGTDEKLMLVARDEQSCLVVSYKEVKNCIEGAFGDLAKAAIASPAAYKHR------
PAN3_CRYNJ            NKLDAGLDERVMLVSRDDQSCLVVSYREIKHCIEAAFNELKNAGNNHRVHR---------
A0A0D1E1J8_USTMA      NKLDAGTDEKIMLTSRDEQSCLVVSYREIKNCIESAFQDLSRTR----------------
PAN3_YARLI            NKLDAGIDERITLISRNGQNCLIVSFKDLKQCIESALRDLE-------------------
B6K186_SCHJY          SKLVAGSNKRIVLVSRDEREFTPISYDELKTCIESAFQAQLHS-----------------
PAN3_SCHPO            GKLDAGINQAIALISRDELDCVSVSYGELKAWLDNVYEMEINS-----------------
                      .**  .  :   :            :  ::  .:                          

PAN3_ASHGO            ---------
PAN3_KLULA            ---------
PAN3_CANGA            ---------
PAN3_YEAST            ---------
PAN3_CANAL            ---------
PAN3_LODEL            ---------
PAN3_DEBHA            ---------
PAN3_PICST            ---------
PAN3_PICGU            ---------
C0NEU6_AJECG          ---------
PAN3_COCIM            ---------
PAN3_NEOFI            ---------
PAN3_ASPFU            ---------
PAN3_ASPCL            ---------
PAN3_ASPOR            ---------
PAN3_ASPTN            ---------
PAN3_ASPNC            ---------
PAN3_EMENI            ---------
PAN3_PHANO            ---------
PAN3_CHAGB            ---------
PAN3_NEUCR            ---------
PAN3_MAGO7            HHPSHRDRF
Q17PM7_AEDAE          ---------
Q7Q6T6_ANOGA          ---------
PAN3_DROME            ---------
Q29E31_DROPS          ---------
A8XA39_CAEBR          ---------
PAN3_CAEEL            ---------
G3NFD9_GASAC          ---------
I3K9I0_ORENI          ---------
H2SNS4_TAKRU          ---------
E7EXP6_DANRE          ---------
H2LXY8_ORYLA          ---------
F1P381_CHICK          ---------
H0ZN09_TAEGU          ---------
G1KIR2_ANOCA          ---------
PAN3_HUMAN            ---------
H2RA81_PANTR          ---------
PAN3_MOUSE            ---------
F1RSU6_PIG            ---------
F1PKU0_CANLF          ---------
G1QHX6_NOMLE          ---------
H2NJI2_PONAB          ---------
F6Y6Y5_MACMU          ---------
G1U195_RABIT          ---------
D4ADM2_RAT            ---------
H0VNI8_CAVPO          ---------
F7FR09_MONDO          ---------
PAN3_XENTR            ---------
H3BC88_LATCH          ---------
Q4S571_TETNG          ---------
C3XW74_BRAFL          ---------
W4XCT7_STRPU          ---------
PAN3_DICDI            ---------
F4P6Y9_BATDJ          ---------
A8NJ49_COPC7          ---------
PAN3_CRYNJ            ---------
A0A0D1E1J8_USTMA      ---------
PAN3_YARLI            ---------
B6K186_SCHJY          ---------
PAN3_SCHPO            ---------