CLUSTAL format seed alignment for MF_03193

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COQ6_DROME            ---------------------MLGVLRIQGALASAGQARLLSVRLLASKSTTDMTTNRGE
Q29NU4_DROPS          ---------------------MLSLFLHNGGAASKGQLRCVAARVLSTTATTNAPT----
Q0IFQ5_AEDAE          ---------------------MSSILSGVSRSLLPRVRCTVLQWRLASGAT-PHATS---
Q7QER0_ANOGA          ----------------MNRLFCTTLVKYSPRNAILPSRAVQWPRTLATTASNRHANT---
A0A088A361_APIME      ------------------------MATFGKAMTFCDVLALTLKRCIISNGSMLPAKPF--
E0W075_PEDHC          ---------------------------------MGNKSILMFNKINRQPGKRFVKNLL--
E9HGJ4_DAPPU          ----------------------------------------MKGFSFLSKYSNTIHNWRLN
COQ6_CAEEL            --------------------------------------------MKLPGGTIICARN---
A8XV72_CAEBR          --------------------------------------------MKLPGGTIICAKN---
A0A2H2IKS5_CAEJA      --------------------------------------------MKLPGGTIISMRN---
COQ6_DANRE            ----------------------------MLSLAKAKLAVVGIGRQCVAVRTLNGARAVHR
W5K4Y2_ASTMX          ----------------------------MLSLGRIRLAAAA-GRPILS----GTGRGCAR
W5MYN5_LEPOC          ----------------------------MHFLTKAKFVLQGGGRRLAAVHCVVGIRALKR
I3KWA8_ORENI          ----------------------------MHKLTRASLALNGLSRCFVTEKHLSAIKITRR
A0A087YDN3_POEFO      ----------------------------MHKLTKAPLVLNGLGRCLITEKHLPAVNIIRR
G3NYE7_GASAC          ----------------------------MHKLTRATLAFNGLGRCLVADKHVSALQIHSR
H3DJ31_TETNG          ---------------------------MIHKLTKSSLALNALGRCL--TNHISSLKIITR
H2VBJ8_TAKRU          ----------------------------MHKLTRSALAFHALGRSFIGKNHLSPIKIITR
F1PBF7_CANLF          --------------------------------MAARLAVSRWRAPLAAAGPGPLLSCRRW
M3WSL0_FELCA          ------MIGGLCSGSAPKGGPSGAPSTLRVSVMAARLALSRWRAAPAAAGRGPLLSCRRW
M3YDS0_MUSPF          --------------------------------MAARLAVSRWRAAPAAAGRGPLLSCRRW
COQ6_BOVIN            --------------------------------MAAQLARVRWGTVFAAAQKGPRVSCRRW
H2Q8L0_PANTR          --------------------------------MAARLV-SRCGAVRAAPHSGPLASCRRW
COQ6_HUMAN            --------------------------------MAARLV-SRCGAVRAAPHSGPLVSWRRW
F6YUG8_CALJA          --------------------------------MAARLV-RRWGAVRAAAHSGPLVPCRRW
A0A096NUG4_PAPAN      --------------------------------MAARLV-SRCGVVGAAAYSSPLVSCRRW
I3MRJ2_ICTTR          -------------------------MVARVSVMAARVSRTGWAIAFTAARRSPLISCRRC
H0VF05_CAVPO          --------------------------------MAARLALSRSCALPASARKSSLVSCRRW
COQ6_MOUSE            -------------------------MAARIGSMAGLLCVRWWSSAQLAARGGPLVASQRW
COQ6_RAT              -------------------------MAARIGPMAGLLCVRWWSTAQLAARGGPLVACRRW
F7AKV7_MONDO          --------------------------------MAACVRFTRVLAVPGTTLGGPRLPGLRR
G1KSA9_ANOCA          -------------------------MAAGAGAFSCLGLGPGCRKRLGLHVGSALRRGSAR
COQ6_XENTR            --------------------------------MRCLGGSSLSRLLRMLSQS----QGRAL
W4Y3Y9_STRPU          -------------------------------------MVTMNKVDSVPKKTRPVVGSWQT
A7RWT5_NEMVE          -------------------------------------MWRILRRSARSVRRLQYHVCSYC
B3SDE9_TRIAD          ----------------------------------MLRRIPTAVRVANWTRSLATVSNSGG
F7B5Q2_CIOIN          ----------------------------------MLKQLKKVGLSQWKNKQLITITHRLL
COQ6_DICDI            ----------------------------------MLRLINKTIN---KNDLIKINNSKRF
F0ZRQ8_DICPU          ----------------------------------MLKIIKLNKI---NQSYRIYNNTYRT
D3B5F4_POLPP          ----------------------------------MNRFLNKSTLLLVNNNFRVTGSRRCY
B9GMF8_POPTR          ---------------------MNRVIARKVVPANNQIFK---LSRKKFFSDEAAKASTSA
K7LAM2_SOYBN          ---------------------MNRVIKKTV--SNICALK---VPRKSFCSTEGVKVAGCS
K4CWI3_SOLLC          ---------------------MNRLSVSRRIVTNIHGFR---SVQRTLCSDTGVKNPNLV
F4J6I5_ARATH          ---------------------MNRVLARNL-RTSVCGTR---ILQRTCSTVVTHDVSTSC
U5D2V4_AMBTC          --------------MVSSLSTSVRTIGRMRAWNCASAFRTWILLKRSYASDAAKASLNHQ
C5WT36_SORBI          -----------------------MLSRRRCFAAAVNRIRP--LARAFCDAPDS-------
K4A8H5_SETIT          -----------------------MLSRRRCFTAAANRIRP--LARAFCDAPAPRADAAPG
A0A1D6GDN2_MAIZE      -----------------------MLSSRRCFAAAANRVRP--LARAFCDAPASRADAGAS
Q851N5_ORYSJ          -----------------------MLSRGRCFPAA-SRIRP--LVRAFCDVPPSLQDAAA-
I1GL38_BRADI          ---------------------MPPPARASALHSLLRRTRC--FAAANRTALARTFSGHPA
A9RFL2_PHYPA          ------------------------------------------------------------
D0NQJ6_PHYIT          --------------------------------------------MVLSSVARVSTRSLRC
COQ6_YEAST            --------------------------------MFFSKVMLTRRILVRGLATA--------
Q752C7_ASHGO          ------------------------------------MLRRAYTLLHRRTLAV--------
C4R280_KOMPG          --------------------------------------------MFQVIRRF--------
Q5AHZ4_CANAL          --------------------------------------------MISRFVRT--------
Q7SHS8_NEUCR          ------------------------------MEAVARRKAAA--YVCLSCTRQ--------
G2X1S4_VERDV          ------------------------------MASNPRHLIAGPRFVCRSCTQR--------
C7YHL9_NECH7          -------------------------------MLARRSVLGQSSFVCRSCVRQ--------
A7EXF8_SCLS1          ------------------------------MRPPNSSLRRLKPYICQACTRRIRGFATTS
M2UK16_COCH5          --------------------------------MPPRISLAPPRALSSPLTCC--------
D5GIZ9_TUBMM          ------------------------------MSPIWCLRSRAAVPHLRSLTSQ-----PQF
Q4WQI4_ASPFU          --------------------------------MRPLSRSALRPYICPSCRSG--------
C8V4E3_EMENI          --------------------------------MRPLSAYALRPYVCPSCRSA--------
C0NN36_AJECG          --------------------------------MRSLSRSALRLYICPSCRRD--------
F2Z6J4_YARLI          -------------------------------MLRSTTLQRLRPAVFRVQRWN--------
COQ6_SCHPO            --------------------------------MSSLVLRGVSRVEMPTISPT--------
Q5KB25_CRYNJ          MRPPTTIYKPGLSNALKVSSKPAISVPAITSRNLHLARPAFSSIPLRATVSKSAHVTFKR
                                                                                  

COQ6_DROME            STQST------------STEHFDIIIGGGGLVGTTLAAAL-AKNSTLADKKVLLLEGAP-
Q29NU4_DROPS          TTTTP------------GSEHFDIIIGGGGLVGTTLAAAL-AKNDTLADKRVLLLEGAG-
Q0IFQ5_AEDAE          SSSEK------------PAEFYDIIIAGGGMVGTTLACSL-GKNPRLADRRILLLEAAT-
Q7QER0_ANOGA          ESTTS------------DAQHYDIIIVGGGMVGTALACAL-GKNSRLQNKNILLLEAAA-
A0A088A361_APIME      SISTQ------------NHENYDIIITGGGMVGSTLACAI-ANNRKLECKKILLLESNKQ
E0W075_PEDHC          DFSIR------------EN-HYDIAIAGGGLVGTSMACAV-GKNSKLSESKVILFESASQ
E9HGJ4_DAPPU          YSTAS------------RSSHYDIIISGGGMVGFAMACRL-GRSDCLANKRILLLESSN-
COQ6_CAEEL            -----------------ASSYYDTVIVGGGMVGNAMACSL-GANKSFQSKSVLLLDAGRS
A8XV72_CAEBR          -----------------ASSYYDAVIVGGGMVGNAMACSL-GANKSFQSKRVLLLDAGRS
A0A2H2IKS5_CAEJA      -----------------ASSYYDAVIVGGGMVGNAMACAL-GANKSFQSKSVLLLDAGRS
COQ6_DANRE            SFSSS---EHDQDSSTSENELFDIIISGGGMVGTAMACSL-GLDPNLTGKKILLLEAGHE
W5K4Y2_ASTMX          GFSSS---ELEEEPGRAESDVYDIVISGGGMVGTAMACSL-GFDPHLQGRKILLLEAGPK
W5MYN5_LEPOC          VFHSSKCTEHGDQASRGENEVYDVIISGGGMVGTAMACAL-GFDPNLEGKKILLLEAGNK
I3KWA8_ORENI          GLVCA-----DHGND-----VYDIIISGGGMVGSAMACSL-GLDPNLEGKKILLLEAGNK
A0A087YDN3_POEFO      GLVCS-----ENRTDSSKTEVYDVIISGGGMVGSAMACSL-GMDPNLAGKKILLLEAGHK
G3NYE7_GASAC          GFVCA-----QHVDDLGKNEVYDIIISGGGMVGSAMACSL-GMDRNLEGKKILLLEAGNK
H3DJ31_TETNG          GIVSV-----EQGNDTDNNEVYDVIISGGGMVGSAMACSL-GMDPKMADKRILVLEAGNK
H2VBJ8_TAKRU          GIVTA-----EEGNDSEKHEVYDIIISGGGMVGSAMACSL-GMDLNLADKKILLLEAGKK
F1PBF7_CANLF          SGARA-------------DAVYDVVVSGGGLVGAAMACAL-GYNIHFHDKKILLLEAGPK
M3WSL0_FELCA          SGAKA-------------DTVYDVVVSGGGLVGAAMACAL-GHDTHFCDKKILLLEAGPK
M3YDS0_MUSPF          SGAKA-------------DTLYDVVVSGGGLVGTAMACAL-GHDIHFSDKKILLLEAGPK
COQ6_BOVIN            AGASA-------------DNVYDVVVSGGGLVGAAMACAL-GHDIHFCDKKILLLEAGPK
H2Q8L0_PANTR          SGAST-------------DTVYDVVVSGGGLVGAAMACAL-GYDIHFHDKKILLLEAGPK
COQ6_HUMAN            SGAST-------------DTVYDVVVSGGGLVGAAMACAL-GYDIHFHDKKILLLEAGPK
F6YUG8_CALJA          SGAST-------------DTVYDVVVSGGGLVGAAMACAL-GYDVHFHDKKILLLEAGPK
A0A096NUG4_PAPAN      SGAST-------------DPVYDVVVSGGGLVGAAMACALVGYDIHFHDKKILLLEAGPK
I3MRJ2_ICTTR          SSVSA-------------DTVYDVVVSGGGLVGAAMACAL-GHDIHFRDKKILLLEAGPK
H0VF05_CAVPO          SGNTA-------------DTVYDVVVSGGGMVGAAMACAL-GHDIHFHDKKILLLEAGPK
COQ6_MOUSE            AGSSA-------------DTVYDVVVSGGGLVGSAMACAL-GHDIHFHDKKILLLEAGPK
COQ6_RAT              TSSST-------------DSVYDVVVSGGGMVGSAMACAL-GHDIHFHDKKILLLEAGPK
F7AKV7_MONDO          LSCSVG----------PGQAVYDVVVAGGGMVGTAMACAL-GHNVHFRDKKILLLEAGSN
G1KSA9_ANOCA          RSSGS-------------TEVYDVVVSGGGMVGTAMVAAL-GHDIHLRDKKILLLEARPR
COQ6_XENTR            SSTGP--------------AVYDVVISGGGMVGTAMACAL-GSDPHLQHKKVLLLEAGNR
W4Y3Y9_STRPU          TSED---------------ELYDVVIVGGGMAGQAMACAL-GFEPSLGDHRILLLEQGKR
A7RWT5_NEMVE          SSTNP-----------RKENLYDVTIVGGGMVGASLACAL-GFEGALSKHRVLVVEAGHD
B3SDE9_TRIAD          DTVQK-------------TSKFDIVIAGGGMVGSAMACSI-GYNPIFGEYKIALLEPNPV
F7B5Q2_CIOIN          TSQSN-------------NEDYDVIIAGGGLVGGAMACAL-GKSRYLEKKKILMLEGRSK
COQ6_DICDI            CSTTTNSTINK-------DNIYDIIIIGGGLVGSTMACSI-GNNNTTKHLKVALIESSK-
F0ZRQ8_DICPU          LCTTNNNNSNN-------NGVYDIVIVGGGLVGSAMACSL-GNNNNTKHLKVALIESSP-
D3B5F4_POLPP          SGVGSGDSLNNTQPIKQEQQHYDVVIVGGGLVGSSMACAL-GSTESTKHLRVALIESAP-
B9GMF8_POPTR          ASSQSNQESDGNLSFTGNVQPYDIAIVGGGMVGMALACSL-ATTPLTKHLSVAIIDSSPA
K7LAM2_SOYBN          IPEVSNDHEK-KQAISKVIPQYDIAIVGGGMVGMALSCFL-ASNPMTKQLSVAIIDSNPA
K4CWI3_SOLLC          SEKKPLEKPG----LTDDIPQYDIAIVGGGMVGMALACSL-ATMPLTKQLTVAIIDSNPA
F4J6I5_ARATH          SNESNALNNS-----TDDGPQHDIAIVGGGMVGIALAASL-ASKPLTKHLNVAIIDNNPL
U5D2V4_AMBTC          AENVHEGGDK--PVETNNVEQYDVAIVGGGMVGMALACTL-ASMPLTKSLSIAIIDSNPA
C5WT36_SORBI          GARRSQDHTEKVAGVKAPPDVLDVAIVGGGMVGLAVACAL-SNMPLTKHLRVAIIDSNPA
K4A8H5_SETIT          GAPGSQDRTQEVGGVKAAPDVLDVAIVGGGMVGLAVACAL-SNMPLTKHLRVAIIDSNPA
A0A1D6GDN2_MAIZE      GTPSPQDHAEKVAALKDPPDVLDVAIVGGGMVGLAVACAL-SNMPLTKHLRVAIIDSNPA
Q851N5_ORYSJ          GVPSSQDHTEKVDDVKARPDELDIAIVGGGMVGLAVACAL-SNMPLTKHLRVGIIDSNPA
I1GL38_BRADI          GATETQVREEKSGGVKARDDELDVAIVGGGMVGLAVACAL-SNMPLTKHLRVAVIDSNPA
A9RFL2_PHYPA          -MEKKQAGSE---------DEYDVVIVGGGMVGAAVGCGL-ACSPLSRDLRVAIIDSSKP
D0NQJ6_PHYIT          SHALATRSLSTSAPFDPQVPHYDVVVVGAGLVGSALACQL-KSNPVFKGKNVAVIEPSAP
COQ6_YEAST            --------------KSSAPKLTDVLIVGGGPAGLTLAASI-KNSPQLKDLKTTLVDMVDL
Q752C7_ASHGO          --------------SSAGIEKTDVLIVGGGPAGLTLAAGI-KNSPHLSDVPVTLVEGSSL
C4R280_KOMPG          --------------ATSVSNVADIVIIGGGPAGLTLGTAL-KNSPVTKHLKIHLVEGGKI
Q5AHZ4_CANAL          --------------LATSAKFQDVVIIGGGPAGLTLLAAL-KTSPKTKHLQCTLIEGS-S
Q7SHS8_NEUCR          --FQRHIRRQYHNAAP-RPDIYDVVCVGGGPAGLSLLTAL-RANPVTSHLRVALVEAQ-D
G2X1S4_VERDV          --AATQNRRSFATAAASNPDIYDVVCVGGGPAGLSLLAAL-RSNPTTSRLRVALVEAQ-D
C7YHL9_NECH7          --YQSQIRRASTAAQD---NIYDVVCVGGGPAGLSLLTAL-RANPVTAGLRVALVEAQ-D
A7EXF8_SCLS1          SYYSNTSPSTSNSTTNARPDVYDVVCVGGGPAGLSLVAAL-RANPLTRNLRLALIEPQ-S
M2UK16_COCH5          --VRLQPQRRFLSSSVDAPEVYDVVCVGGGPAGLSLLTGL-KASPITNGLKVALIEGQ-D
D5GIZ9_TUBMM          IAFRHSSVPRTYATTNIPENLYDVVIVGGGPAGLSLATSL-RSSSVTSRLRVALIEGL-D
Q4WQI4_ASPFU          -AVL-RRRFATQP--SSVPEIYDVVCVGGGPAGLGLLAAL-RASPATSKLKVALIETQ-D
C8V4E3_EMENI          -RILNRRRFGSEH--APVTDIYDVVCVGGGPAGLALLAAL-RASPATSKLKVALVESQ-D
C0NN36_AJECG          -LQLGRRGFSSSSKLLQRPDIYDIVCVGGGPAGLGLVAAL-RSSPITSKLRIALIESQ-D
F2Z6J4_YARLI          --------STTTSAPKPSTTHSDIVVVGGGPAGLTIAAAL-KHYPETVNKSVTLVEFG-S
COQ6_SCHPO            ----LGIYTRKFASQKILQRQFDVVIVGSGPVGLALAAGL-QSNPVTQSLKVGLLDIQ-D
Q5KB25_CRYNJ          SHSHHAPQPTEPIPEISSENTYDIVIIGGANAGLAFACAL-LSQPTISQTCRILLVEGSS
                                            *    *.. .*  .   :             :.     

COQ6_DROME            --EFRGFNPTG--PYQNRVSAINHNSIELF-KSIDAWKHIESA-RYKPVKQMQVWESN-T
Q29NU4_DROPS          --EFKGFDTSG--PYQNRVSAINRNSVELF-KSIGAWSHIEAA-RYKPVKQMQVWESN-S
Q0IFQ5_AEDAE          --GFKQ-PSTE--TYSNRVSAISKGTHRLM-KAIGAWEQIEAT-RVKPVLKMQVWDAC-S
Q7QER0_ANOGA          --GFKQ-PSTE--QYSNRVSAISKGTYRLM-RTIGAWEEIERT-RVKPVLKMQVWDAC-S
A0A088A361_APIME      H-EYKSQEK-----YSNRVVALNKQTRCLL-SSIGAWQHIEAI-RYSTVRKMQVWDAC-S
E0W075_PEDHC          K-SFKKKAKDD--EYSNRVVSINPGSKKFL-ENIGAWKFISDL-RYKTVKKLQVWDAC-S
E9HGJ4_DAPPU          ----KKQLKLD--SYNLRVSALNPGSKSLL-ESLGAWQHIEKT-RFGSVKKMQVWDAC-S
COQ6_CAEEL            P-SLASFKPGA--PFNNRVVATSPTSIDTF-KKLGVWDQINSH-RTKKVNRLFVFDSC-S
A8XV72_CAEBR          P-SLSSFESGA--PFNNRVVATSPTSIDIF-KKLGVWERINSH-RAKKVNRLFVFDSC-S
A0A2H2IKS5_CAEJA      P-SLSSFEQGT--PFNNRVVATSPTSIDIF-KQLGVWEQIKSH-RAKKVNRLFVFDSC-S
COQ6_DANRE            ---KKMDKIPE--TYSTRVSSISPGSATLL-SGLGAWDHIVNM-RCKPYNKMQVWDAC-S
W5K4Y2_ASTMX          ---KQMDKAPE--VFSTRVSSISPGSATLL-SGLGAWDHIVKL-RCKPYQKMQVWDAC-S
W5MYN5_LEPOC          ---KTLDKVPE--AYSTRVSSISPGSATLL-SSVGAWDHILNM-RCKPFRRMQVWDAC-S
I3KWA8_ORENI          ---KVMDKVPD--TYSTRVSSISPGSATLL-SGIGAWEHITKM-RFKPYKKMQVWDAC-S
A0A087YDN3_POEFO      ---KVMDRVPD--TYSTRVSSISPGSATLL-SGIGAWEQITRM-RCKPYKRMQVWDAC-S
G3NYE7_GASAC          ---KVMHKVPD--TYSTRVSSISPGSATLL-TGVGAWEHITKM-RCKPYKRMQVWDAC-S
H3DJ31_TETNG          ---KVMEEIPD--SYSTRISSISPGSATLL-SSVGAWEHITGM-RFKPYKRMQVWDAC-S
H2VBJ8_TAKRU          ---QVMEGIPD--TYSTRVSSISPGSATLL-SSIGAWEHITEM-RCKPYKRMQVWDAC-S
F1PBF7_CANLF          ---KVWEKLPE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
M3WSL0_FELCA          ---KVWEKLPE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
M3YDS0_MUSPF          ---KVWEKLPE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
COQ6_BOVIN            ---KVLEKLPE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RCRAFRRMQVWDAC-S
H2Q8L0_PANTR          ---KVLEKLSE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
COQ6_HUMAN            ---KVLEKLSE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
F6YUG8_CALJA          ---KVLEKLSE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
A0A096NUG4_PAPAN      ---KVLEKLSE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
I3MRJ2_ICTTR          ---RVLEKLSE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDAC-S
H0VF05_CAVPO          ---KVLDKLPE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYRAFRRMQVWDGC-S
COQ6_MOUSE            ---KALEKLSE--TYSNRVSSISPGSTTLL-SSFGAWDHICNM-RCKAFRRMQVWDSC-S
COQ6_RAT              ---KTLEKLSE--TYSNRVSSISLGSTTLL-SSFGAWDHICNM-RCKAFRRMQVWDSC-S
F7AKV7_MONDO          ---KILEKLPE--TYSNRVSSISPGSATLL-SSFGAWDHICNM-RYKPFRRMQVWDAC-S
G1KSA9_ANOCA          ---KASDQLPK--SYSNRVSAITPGSVTFL-SSFGAWEDISSM-RIKPFRRMQVWDAC-S
COQ6_XENTR            ---KPFDHLPE--NFSNRVSSITPGSATLL-ASFGAWDHILAM-RLKPYKRMQVWDAC-S
W4Y3Y9_STRPU          P--MQLNELPS--KYSNRVCSLNHNSVKLL-TDVGAWHHMAEM-RVKPFRRMQVWDAC-S
A7RWT5_NEMVE          ----RPFELPE--KYSNRVSSITPGSRKLL-ESVGAWDHISNM-RVKHYKRLNVWDAC-G
B3SDE9_TRIAD          ----KTMAIQA--DFSNRVSAIIPGSINVL-DDIGVWPYISEL-RAKLFQSMQVWDAA-S
F7B5Q2_CIOIN          MKEIDLKNPPS--NYDCRVCAISPGNVEFL-KDINSWDNVS---RKCSVNRMQIWDAC-S
COQ6_DICDI            IQTVEQSISNA--IPEIRTISFNNQTIELF-KSINVWDTIKSTKRVNPFNQVRVWDTS-G
F0ZRQ8_DICPU          IQTVNETTSNK--IPDIRTISFNHQTIDLF-KSIGVWDTIESTKRVNPFNQVRVWDTS-G
D3B5F4_POLPP          VQPLYPLTAE----PDLRTLSFNHTSVGLF-DAIGAWSLIKDTKRTAAFNQLKVWDAS-G
B9GMF8_POPTR          LANKPCIKRED--PPDPRVSTVTPATISFF-KDTGAWQYVQ-QHRHAYFDKMQVWDYT-G
K7LAM2_SOYBN          LGSSLHIKKED--PPDPRVSTVTPASISFL-QDAGAWKYVE-QNRRAYFNTMQVWDYT-G
K4CWI3_SOLLC          LINNFHIKKED--PPDPRVSTVTPATISFF-KDMGAWEFVQ-QSRHAYFDKMQVWDYT-G
F4J6I5_ARATH          LGRRNIIEKGH--QPDPRVSTVTPATISFL-KDIGAWKYIE-QQRHAYFDKMQVWDYT-G
U5D2V4_AMBTC          LGSRKHIPNDS--IPDPRVSTVTPATLSHF-KDIGAWEYIK-KHSHAFFDKMQVWDYT-G
C5WT36_SORBI          LKSRGYLDKNS--IPDSRVSTVTPATMSFF-KDIGAWEHVQ-QQRHAFFGKMQVWDYT-G
K4A8H5_SETIT          LKSRNHLTKNS--IPDSRVSTVTPATISFF-KDIGAWEHVQ-QQRHAFFGKMQVWDYT-G
A0A1D6GDN2_MAIZE      LKSRSYLDKNS--IPDSRVSTVTPATISFF-KDIGAWEHVQ-QQRHAFFGKMQVWDYT-G
Q851N5_ORYSJ          LKSRNYLKKDG--VPDSRVSTITPATISFF-RDIGAWDHVQ-QQRHAFFGKMQVWDYT-G
I1GL38_BRADI          LKSRNYLKKDG--IPDSRVSTVTPATISFF-RDIGAWEHIL-QQRHDFFDKMQVWDYT-G
A9RFL2_PHYPA          MAAPKHDPK-A--VPDQRVSAITPATVRFF-KEVGAWESVQ-AAMPTPFDAMQVWDYE-G
D0NQJ6_PHYIT          PVAPSVEKD----SPDLRVFTITPASQKLL-ESTGAWNFIA-DGHTAVFKDMQAWDAM-G
COQ6_YEAST            KDKLSDFYNSPPDYFTNRIVSVTPRSIHFLENNAGA--TLMHD-RIQSYDGLYVTDGC-S
Q752C7_ASHGO          T-KIAGFYKSPSAKYHNRIINLTPQSKNFLEQKVGV--KLLED-RIQAFDGFYVTDGC-S
C4R280_KOMPG          IEPLNSFLETPPPNYLNRVVSLTPSTIGFL-DSIGAWSHFNQE-RTQSYDDIVTYDGV-S
Q5AHZ4_CANAL          LDNVRKFHNDPPADYTNRVISLTPKSIEFMQNKVGSWDFIHED-RVKAYDGIIAYDSQDA
Q7SHS8_NEUCR          LSKVKSWKLPP-SKYSNRCSSLTPTSAFYL-DQIGAWEHLDQT-RVQPYHEMQVWDGV-T
G2X1S4_VERDV          LSKTRNWTLPA-DRFSNRCSSLTPTSAQYL-NSIGAWSHMKRE-RIQAYQEMQVWDGV-T
C7YHL9_NECH7          LSKVSSFSLPP-TQFSNRCSSLTPSSARYL-DTIGAWQHMKRE-RIQDYQEMQVWDGV-T
A7EXF8_SCLS1          LSKSLNWKLKE-GEYSNRCSSLTPKSVRFL-QEIGTWELVERQ-RVQGYGGMQVWDGV-S
M2UK16_COCH5          LHKSRLAQDASLETFSNRCSSLTPASVRNL-QEIGAWAHVNQP-RVQPYQEMQVWDGV-S
D5GIZ9_TUBMM          LDAGRKWKPSS-ENYSNRVSSLTPCSVGFL-TDIGVWKHVQRN-RVQDYHGMQVWDGV-S
Q4WQI4_ASPFU          LSKARSWKLEP-HQFSNRVSSLTPSSVSFL-QRIGAWDHVDAS-RAQVYQEMQVWDGE-T
C8V4E3_EMENI          LDKARSWKLDP-HQFSNRVSSLTPSSVSFL-QKIGAWDHLDVS-RTQPYQAMEVWDGE-T
C0NN36_AJECG          LLKSRSWNLEP-TQFSNRVSSLTSSSVSFL-KDIGAWEHVDVA-RVQPYQEMRVWDGE-T
F2Z6J4_YARLI          LDNLKTWGPDM-ERFENRVSSLTPSSVEYL-TKIGVWEHVNRD-RVQAYRHMTAWDGV-S
COQ6_SCHPO            TMKLKDWKFET---YSNRCSSLTNHTRMFF-DKIGAWDFARKD-RIQPFQHILASDGL-T
Q5KB25_CRYNJ          LDRTRNWPESS--EWENRISSLTHENIEWL-ESIGVWRHITND-RSCPVHEIIVWSNPSP
                                       *       .   :    .                .   .    

COQ6_DROME            DALIQFQHDN-----------FASDVACIIENDLILDAVYALAKE---------------
Q29NU4_DROPS          DALIQFQHDN-----------FASDVACIIENDLILDAVYARVRE---------------
Q0IFQ5_AEDAE          DALITFNYDD-----------LADNISWIVENDVLLASVYRQLEG---------------
Q7QER0_ANOGA          DALITFNYDD-----------FAENISWIVENDVLLASIYRQLEG---------------
A0A088A361_APIME      DAMIVFNEDY-----------LTEEIAYIVENDLLLHAVNKQLAD---------------
E0W075_PEDHC          DALITFNDD------------LMKDVSYIVENDLILNALEEVCSN---------------
E9HGJ4_DAPPU          DAAVTFGKAD-----------LSEDIAWIVENDLVQDSLMKELDK---------------
COQ6_CAEEL            TSEIEFERG------------QQEEVAFIIENDLIVGSLYEKLAE---------------
A8XV72_CAEBR          TSEIEFERG------------QNEEVAYIIENDLIVGSLYEKLAD---------------
A0A2H2IKS5_CAEJA      TSEIEFERG------------QNEEVAYIIENDLIVGSLFEKMTE---------------
COQ6_DANRE            DALITFDKENL-----------QDEMAYIVENDVIVAALTKQLQTL--------------
W5K4Y2_ASTMX          DALITFDKENL-----------QDEMAYVVENDVIVAALTKQLQTL--------------
W5MYN5_LEPOC          DAMITFEKDSL-----------EDEMGYIVENDVIIAALTKQVESM--------------
I3KWA8_ORENI          DALITFDKENV-----------EDEMAYIVENDLVVAALTRQLDSL--------------
A0A087YDN3_POEFO      DALITFDKEDL-----------LDEMAYIVENDIVVAAITRQLDAM--------------
G3NYE7_GASAC          DVLITFDKEDM-----------QDEMAHIVENDVVVAALTKQLDDL--------------
H3DJ31_TETNG          DALITFDKENL-----------QEEMAYIVENDVVVAALTKQLDTL--------------
H2VBJ8_TAKRU          DALITFDKENL-----------EDEMAYIVENDIVVAALTKQLDAL--------------
F1PBF7_CANLF          EALIMFDKDN------------LDDMGYIVENDVIMRALTKQLEAA--------------
M3WSL0_FELCA          EALIMFDKDN------------LDDMGYIVENDVIMCALTKQLEAV--------------
M3YDS0_MUSPF          EALIMFDKDN------------LDDMGYIVENDVIMRALTKQLEAV--------------
COQ6_BOVIN            EALIMFDKDN------------LDDMGYIVENDVIMHALTKQLEAV--------------
H2Q8L0_PANTR          EALIMFDKDN------------LDDMGYIVENDVIMHALTKQLEAV--------------
COQ6_HUMAN            EALIMFDKDN------------LDDMGYIVENDVIMHALTKQLEAV--------------
F6YUG8_CALJA          EALIMFDKDN------------LDDMGYIVENDVIMHALTKQLEAV--------------
A0A096NUG4_PAPAN      EALIMFDKDN------------LDDMGYIVENDVIMHALTKQLEAV--------------
I3MRJ2_ICTTR          EALIMFDKDN------------LDDMGYIVENDVIMHALTKQLEAV--------------
H0VF05_CAVPO          EALIMFDKVN------------LDDMGYIVENDVVMHALTKQLEAV--------------
COQ6_MOUSE            EALIMFDRDN------------LDDMGYIVENDVIMYALTKQLEAV--------------
COQ6_RAT              EALIMFDKDN------------LDDMGYIVENDVIMHAITKQLEAV--------------
F7AKV7_MONDO          EALITFDKDD------------LDDMGYIVENNVIMSALTKQLDAV--------------
G1KSA9_ANOCA          EAMIIFDNNN------------MEDMGYIVENNVILSALTKQLDAI--------------
COQ6_XENTR            DALITFDKDA------------LEDMGYIVENDIIIEALTKQLELM--------------
W4Y3Y9_STRPU          DALIAFNKSADL----------SEDMAYIVENDVTNAALSRQLGE---------------
A7RWT5_NEMVE          DGHIVFDSSPDLN--------SDSDMACIVENNVIVAALNKQMKLL--------------
B3SDE9_TRIAD          DHSFLLLDSKFT----------DEKMGYVVENDVIMLALMKRLKLL--------------
F7B5Q2_CIOIN          DVVTHFNKHNM-----------SESLCWIVENNLLQASLNQTIDNEL-------------
COQ6_DICDI            FEGIHFQDNDIIDDG-----NNTTAMGYIIENNIVTSSLLSKVKQF--------------
F0ZRQ8_DICPU          FEGIHFKD-------------NNDIMGYIIENKVAVSSLLEKANSF--------------
D3B5F4_POLPP          GGGIHFQD-------------NTESMGYILENRLVTSALLEASKQY--------------
B9GMF8_POPTR          LGYTKYDARDV----------DKEVLGCVVENKVLHSSLLSRIEDT--------------
K7LAM2_SOYBN          LGYARYHARDV----------NKDFLGCVAENKVLHNALLSCVKDS--------------
K4CWI3_SOLLC          LGYTRYNARDV----------DADVLGCVVENKVLHKSLLSCIQNT--------------
F4J6I5_ARATH          LGYTRYNANDV----------HQDVLGCVVENKVLQSSQLSCVQES--------------
U5D2V4_AMBTC          LGYTRYNAKDV----------GREILGCVVENKVLQSSLLSRLQDA--------------
C5WT36_SORBI          LGYTRYNARDV----------GKEYLGCVVENKVLCNSLLLRLQEEL-------------
K4A8H5_SETIT          LGYTRYNARDV----------GKEYLGCVVENKVLCNSLLLRFQEEL-------------
A0A1D6GDN2_MAIZE      LGYTRYNARDV----------GKEHLGCVVENKVLCNSLLLRLQEEL-------------
Q851N5_ORYSJ          LGYTRYSARDV----------GKEYLGCVVENKVLCNSLLLRLQEEN-------------
I1GL38_BRADI          LGYTRYNARDV----------GKQYLGCVVENKVLCNSLLLRLQEQK-------------
A9RFL2_PHYPA          LGYTRYTADDV----------GAYVLGYVVENKVLLGALRSRIENA--------------
D0NQJ6_PHYIT          DGHIRFDAKKM----------DKEVLGHVVEHRVLVRALHDRMNQLA-------------
COQ6_YEAST            KATLDLA---------------RDSMLCMIEIINIQASLYNRISQYDSK-----------
Q752C7_ASHGO          SGALEMT---------------RENVGYMAEIFNIQSSVLHRMEQLS-------------
C4R280_KOMPG          GARMNFE---------------HPDIATMVETTNIQAGLLSRLNELNSQ-----------
Q5AHZ4_CANAL          NSRIEFDISTI----------GQSTLAAMCEVINIQSSLLAKIESLQDKSTTIKDNTKVV
Q7SHS8_NEUCR          DARIEFDWAPG------SALVEGTTIAYMNENLNLTSGLLKRLEQLGGV-----------
G2X1S4_VERDV          DARIEFDWTPD------SVTSGGKTIAYMCENLNLTSGLLKRLEELGGV-----------
C7YHL9_NECH7          GARIEFDWPPG------SAA--DKTIAYMAENLNLTSGLLKRLNELGGV-----------
A7EXF8_SCLS1          GGRIEFDVEEGQGAVQ-DNTAEGKVVAYMNENANLVRGLLRRIEGLGGV-----------
M2UK16_COCH5          GARISFDWHTAKPLLTPRNSAQPTTIAYMIENVNTVSGLLSRLEELGGV-----------
D5GIZ9_TUBMM          GSRIVFDWGAE----------NSSTIAYMTENVNLVHGLLSRLGELGGA-----------
Q4WQI4_ASPFU          GSRISFDWSME-----TSPFEDLPTVATMTENANLVRGLLSRIEVSGEEN----------
C8V4E3_EMENI          GSKISFDWSME-----TSPFEDLRTVATMTENANLVHALLSRIAASGDEN----------
C0NN36_AJECG          GASISFDWSLE-----PQS-TQMQTIATMTENLNLTRGLIACIESSGGE-----------
F2Z6J4_YARLI          GSKVQFNTTQL--------MGEGRDIAYMTENFNLQNGLLKQLANKPNL-----------
COQ6_SCHPO            NSSIHLDQKPG-----------SEPMAFMSENVNLQYALLNSIIDKMNNNIK--------
Q5KB25_CRYNJ          TETPTIHFPPV-----------GRPLARMTENLNLQKALLRRIEEAGKGI----------
                                               :  : *      .                      

COQ6_DROME            ---SPNVEILNKARIQCVRLPRDS-------------NSNHSEL-------------QLE
Q29NU4_DROPS          ---AANVQILNKARIECVRLPKDT-------------SGSHSEL-------------QLQ
Q0IFQ5_AEDAE          ---VKNVDIRYGARMEGCGLIRD--------------GAEMSTV-------------RLS
Q7QER0_ANOGA          ---VPNVRVRYSSKLASCELIRD--------------GADRSTV-------------RLA
A0A088A361_APIME      ---KENVNIIYNSKVENIKLPKT--------------QEEDAVI-------------QLQ
E0W075_PEDHC          ---LKNVTVKYESRIKKIVPPSD--------------KNKMVHL-------------EME
E9HGJ4_DAPPU          ---IEQVEVQYKTKVTNYRLPKN--------------ADELVQV-------------TLE
COQ6_CAEEL            ---YKNVDVKTGAKVEDCSIPNA--------------LENMATI-------------KLE
A8XV72_CAEBR          ---YKNVDVKTGAKVEVCFIPNG--------------LENMATI-------------KLE
A0A2H2IKS5_CAEJA      ---YKNIDVKTSVKVDECSIPNS--------------LEHLAYV-------------KLE
COQ6_DANRE            ---SDHVKVQYRTKVVKYTWPHPY-------------HVSESIP---------WVQVALA
W5K4Y2_ASTMX          ---SDQVEVQYRTRVVKYTWPRPY-------------QVADSIP---------WVQVTLA
W5MYN5_LEPOC          ---PDKVTVQYRSRAVKYIWPQPF-------------QAANAIP---------WVQVELA
I3KWA8_ORENI          ---SENVQVKYRSKVVKYTWPMPS-------------QEADYIP---------WVRVTLA
A0A087YDN3_POEFO      ---PENVQVKYKSKVVKYTWPMPH-------------HAAESIP---------WVKVTLA
G3NYE7_GASAC          ---SDNVQVKYRSKVVKYSWPMPH-------------QQANAIP---------WVKVTLA
H3DJ31_TETNG          ---SDNVQVKYRSKVVKYVWPMPH-------------Q-ADAVP---------WVKIKLA
H2VBJ8_TAKRU          ---SDNVQVKYRSKVVKYIWPMPH-------------H-ADSIP---------WVQIKLA
F1PBF7_CANLF          ---SDRVTVLYRSKAVGYTWPYPF-------------TMADSSP---------WVHITLG
M3WSL0_FELCA          ---SDRVTVLYRSKAVGYTWPYPF-------------PMTDSSP---------WVHITLG
M3YDS0_MUSPF          ---SDRVTVLYRSRAVGYTWPYPF-------------TMADSSP---------WVHITLG
COQ6_BOVIN            ---SDQVTVLYKSKAVSYTWPYPF-------------SMADSSP---------WVHITLG
H2Q8L0_PANTR          ---SDRVTVLYRSKAIRYTWPCPF-------------PMADSSP---------WVHITLG
COQ6_HUMAN            ---SDRVTVLYRSKAIRYTWPCPF-------------PMADSSP---------WVHITLG
F6YUG8_CALJA          ---SDRVTVLYRSKAIRYTWPCPF-------------PMADSSP---------WVHITLG
A0A096NUG4_PAPAN      ---SDQVTVLYRSKAIRYTWPCPF-------------PMADSSP---------WVHITLG
I3MRJ2_ICTTR          ---SDRVTVLYRSKAVGYTWPGPF-------------SMADSSP---------WVHITLG
H0VF05_CAVPO          ---SDRVKVLYRSKAVGYSWPGPF-------------SMADSSP---------WVHITLG
COQ6_MOUSE            ---ADRVKVLYESKAVGYSWPGAF-------------SMADSSP---------WVHITLG
COQ6_RAT              ---ADRVKVLYESKAVGYAWPGPF-------------SLADSSP---------WVHITLG
F7AKV7_MONDO          ---PDQVEVLYRSKVISYTWPGPF-------------FNTDTNP---------WVQITLA
G1KSA9_ANOCA          ---SDRVEVLYKSRAVGYTRPTHY-------------QTSDSSP---------WVQIDLA
COQ6_XENTR            ---SDHVEVMYRSRALSYSWPPPY-------------NNGKATP---------WVEIELA
W4Y3Y9_STRPU          ---RGNIEVQYEKRLTSIQIP-PQ-------------GLFEEES---------WAQLHLD
A7RWT5_NEMVE          ---EPTVTVKYGARIKKINFPDPA-------------WAMESETRGN-----PWMEVELE
B3SDE9_TRIAD          ---DSNVEILH-CKVDDISLQISN-------------GDIGNVS------------IKLD
F7B5Q2_CIOIN          ---SNNVSVKYNSTLTDCFIPNNY-------------ARSDTRTPL------PPATVTLS
COQ6_DICDI            ----ENIELFEQLSVKSMNDYNE--------------ETIRTTSI--------LPSVTLS
F0ZRQ8_DICPU          ----ENVDIISPLTVKSLENYNP--------------NTSTTTNI--------LPCLKLS
D3B5F4_POLPP          ----ESITIKSPASVKSV-------------------QLQSTTQQ--------QTTVTLA
B9GMF8_POPTR          ----DFQKKIYHSRLTSMSLNPS--SSSIVVDSTASTEASYARGR--------LAKLELS
K7LAM2_SOYBN          ----DFKTTIYPLRLSSMTLNTS--SMSMAEENPTSKEPPSAQGH--------GAELQLS
K4CWI3_SOLLC          ----DFQKTIHSSRLSSITFPAM--SSVTS----SSGTSSSASGS--------SAKLELD
F4J6I5_ARATH          ----DLQKTVYPARLNAMDMLPS--SSLTGLGEVPSTTDLFMRGR--------LAKLELS
U5D2V4_AMBTC          ----GVGERIYPAKLTSMSLQSHFPSAVDMLDIETSNYSSRTSGDPK--RHGCLAKLDLS
C5WT36_SORBI          ---DDIENVIYPTRLVSLTFPLKSRQ---AGMKPTSSEPLSVGHTTEELHRSNLVKLDLS
K4A8H5_SETIT          ---DDIESVIYPTRLVSLTFPSISKQ---AGMKPTSSEPLSAGHATEELHRSNLVKLDLS
A0A1D6GDN2_MAIZE      ---DDIENVIYPTRLVSLTFPLKTRQ---AGMKPTSREPLSVGHTTEEFHRSHLVKLDLS
Q851N5_ORYSJ          ---GDIEKMIYPTRLISLALPSKSR-------QAPTREAISSGYPPEELNRSNLVKLELS
I1GL38_BRADI          ---EDIENMIYPARLVSLAFPSKNRQVRVAGLKPPSTEAVSIGHTSGELHRSSLVKLDLS
A9RFL2_PHYPA          ----GSVDFICPAQVKSVLLPTP------------SGQGLDSPQD--------RAEVGLN
D0NQJ6_PHYIT          ---ADSGDSAPLKLYCPAKVKHF--------------QRPTAVSS--------ISEIGLE
COQ6_YEAST            ---KDSIDIIDNTKVVNIKHSDPND-------------------------PLSWPLVTLS
Q752C7_ASHGO          ---HSGLDLIENAKVTSIEHSDPAD-------------------------PQSWPIVTLD
C4R280_KOMPG          -----QEVKLVIQEDTKVTSIAKDS-------------------------ITQWPTLKLS
Q5AHZ4_CANAL          EIVNPIEPDLDNHNLTEIDTNVSDP-------------------------KLDWPIVKLE
Q7SHS8_NEUCR          -------SVFEGAKVENITFGEETE----------------------DLDLRQWPVVHIS
G2X1S4_VERDV          -------SVFDAAKVQDITLGEETE----------------------ELDLSQWPVVHLE
C7YHL9_NECH7          -------DIFDKTKVENIDLGKETE----------------------EVDLSEWPIVQLS
A7EXF8_SCLS1          -------DVLEG-KVANIELGQETE----------------------EGDFSGWPIVKVE
M2UK16_COCH5          -------DFYTSTKVNSIGLGTDTD----------------------KMDFSSWPVLTLS
D5GIZ9_TUBMM          -------QLIDKTRVEGIYFGGDHG----------------------TLDLRTWPIVQIT
Q4WQI4_ASPFU          ------LSIFSNTTVSSIENGIDYS---------------------SGPDLSAWPVLSLS
C8V4E3_EMENI          ------LSMFSRSTVSSIENGAANGP--------------------NGADLSAWPVLSIA
C0NN36_AJECG          ------VSIFSNTSVSEITNGEDYT---------------------DGPDLSSWPVLTLK
F2Z6J4_YARLI          -------TILDKTKVEGVERTPESH---------------------------NKPLVKLS
COQ6_SCHPO            ------KPNLEFLMPCTITKLSKGE------------------------NIYRTHIHTTT
Q5KB25_CRYNJ          ------VDIRENSRVREMRLGEGGR----------------------------WVGLRIG
                                                                                  

COQ6_DROME            DG---------RNFSCDLLIGADGANSVVRKEMNVDVFSLNYDRMGLVATLELGEDA---
Q29NU4_DROPS          DG---------RSFSCELLIGADGANSIVRKEMGVDVFSMNYDRMGLVATLELGDDV---
Q0IFQ5_AEDAE          NG---------EQLQCELLVGADGYNSLVRRTMGVDNFTLAYDQMGVVATLKLGGAA---
Q7QER0_ANOGA          DG---------ETLKCDLLVGADGYNSLVRRQMGVQNFALAYNQMGVVATLRLANAP---
A0A088A361_APIME      DG---------TKYKSKLLIGADGVNSLVRKTMNTQYVKWDYNQMGIVATLKLSEP----
E0W075_PEDHC          NG---------DEYTCNLLVGADGFKSKTREVIGGQYLSWNYDQKGIVATVKLSEP----
E9HGJ4_DAPPU          DG---------SCLTTDLIIGADGFNSGLRQTIKTQYISYDYNQMAVVATLRISEG----
COQ6_CAEEL            NG---------DVIETSLLIGADGVNSKVRHASNLDYTTFNYNQHGLVAIVNIETAN---
A8XV72_CAEBR          NG---------DVIETSLLIGADGVNSKVRHASNVDYTTFNYNQHGLVGIVNIETAN---
A0A2H2IKS5_CAEJA      NG---------DVIETSLLIGADGVNSKVRHASDLNYTTFNYNQHGLVAIVEIQTAS---
COQ6_DANRE            NG---------KTLHTKLLIGADGPNSMVRREAGIPTVKWNYDQSAVVAVLHLSEP----
W5K4Y2_ASTMX          SG---------QTLQTKLLIGADGPNSMVRREAGIPTVKWNYDQSAVVAVLHLSEP----
W5MYN5_LEPOC          NG---------QKLQTKLLIGADGPNSMVRRDTGIPLVKWNYDQSAVVAVLHLSEP----
I3KWA8_ORENI          NG---------ETLQTKLLIGADGPNSMVRRELGIPTVKWNYDQSAVVAVLHLSEP----
A0A087YDN3_POEFO      NG---------ETLQAKLLIGADGPNSMVRQKLGIPTVKWNYDQSAVVAVLHLSEP----
G3NYE7_GASAC          SG---------ESVETKLLIGADGPNSMVRQELGIPTVKWNYDQSAVVAVLHLSEP----
H3DJ31_TETNG          SG---------DTLQTKLLIGADGPNSMVRKGLGIPTVKWNYDQSAVVAVLHLSEP----
H2VBJ8_TAKRU          NG---------DTLKTKLLIGADGPNSMVRKSLGIPTVKWNYDQSAVVAVLHLSEP----
F1PBF7_CANLF          DG---------STLQTKLLVGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEA----
M3WSL0_FELCA          DG---------STLQTKLLIGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEA----
M3YDS0_MUSPF          DG---------STLQTKLLIGADGHNSGVRQAAGIQNVSWSYDQSAVVATLHLSEA----
COQ6_BOVIN            DG---------RTLQTKLLIGADGHNSGVRQAAGIRNVSWNYDQSAVVATLHLSEA----
H2Q8L0_PANTR          DG---------STFQTKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSEA----
COQ6_HUMAN            DG---------STFQTKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSEA----
F6YUG8_CALJA          DG---------STFQTKLLIGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEA----
A0A096NUG4_PAPAN      DG---------STFQTKLLIGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEA----
I3MRJ2_ICTTR          DG---------STLQTKLLIGADGYNSGVRQAAGIQNVSWNYDQSAVVATLHLSEA----
H0VF05_CAVPO          DG---------STLQTTLLIGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEA----
COQ6_MOUSE            DG---------STLQTKLLIGADGHKSGVRQAAGIQNVSWKYDQSAVVATLHLSEA----
COQ6_RAT              DG---------STLQTKLLIGADGHNSGVRQAAGIQNVGWNYDQSAVVATLHLSEA----
F7AKV7_MONDO          DG---------HQLQTKLLIGADGQNSGVRHAAGIQNVCWPYDQSAVVATLHLSEP----
G1KSA9_ANOCA          DG---------RRLQTKLLIGADGQNSMVRRTAGIKNIQYRYDQSAVVATLHLSES----
COQ6_XENTR            DG---------QRLHTKLLIGADGHNSMVRSAAGMQSVQWNYNHAAVVATLHLSEA----
W4Y3Y9_STRPU          DD---------SIIKTRLIIGADGARSGVRKLAGLKEIGWDYDQWGVVATLQLAEP----
A7RWT5_NEMVE          DG---------SVIHSRLLVGADGAASTVRKATDIEYLSWSYEQWGVVGTLRLGEI----
B3SDE9_TRIAD          ND---------DLIETRLLIGADGPQSSIRTAANIKHISLPYNQLAIVATLQLENQ----
F7B5Q2_CIOIN          DG---------TVLRTKLLIAADGDNSFISRCLNMNKLKWNYNQHAVVATLNFHEP----
COQ6_DICDI            ND---------QQLHAKLIIGADGGNSILKKQLQVPSIGRVYNQKAVVCTLKLGIKQDNN
F0ZRQ8_DICPU          ND---------KDLHAKLIIGADGGNSIIKKQLKLNSVGRNYNQRAVVCTIKLGK-----
D3B5F4_POLPP          NN---------EQLTTDLIIAADGGNSIIKKQLNLESLGKSYNQKAVVCTIKLAP-----
B9GMF8_POPTR          DG---------NSLYAKLVVGSDGGKSQVRELAGFKTTGWKYSQNAVICTVEHSV-----
K7LAM2_SOYBN          DG---------SSIYAKLVVGADGGKSHVRELAGIKTTGWNYSQNAIICTVEHTY-----
K4CWI3_SOLLC          NG---------NSMYAKLVVGADGSKSSVRELARIQTTGWKYSQSAIICTVEHAV-----
F4J6I5_ARATH          DG---------NRVYAKLVVGADGSKSRVRELAGIKTTGWNYSQNAIICTVEHTA-----
U5D2V4_AMBTC          DG---------NTLYTKLVVGADGAKSSVRKIAGLKTTGWNYSQHAVICTVKHAT-----
C5WT36_SORBI          DG---------QSLYSKLVIGADGSKSNVRQIAGIKTTGWNYPQSAIICTVEHVV-----
K4A8H5_SETIT          DG---------RTLYSKLVIGADGSKSNVRQIAGIKTTGWNYPQSAIICTVEHVV-----
A0A1D6GDN2_MAIZE      DG---------RSLYSKLVIGADGSKSNVRQIAGIKTTSWNYPQSAIICTVEHVV-----
Q851N5_ORYSJ          DG---------QTLYSKLVVGADGSKSNVRQTAGIKTTGWNYPQSAIICTVEHIT-----
I1GL38_BRADI          DG---------QTLYSKLVVGADGSKSNVRQIAGIKTSGWSYPQSAIICTVEHIA-----
A9RFL2_PHYPA          DG---------RSLRARLVVGADGGRSAVRATAGFQTRGWEYKQSAVICTVRVET-----
D0NQJ6_PHYIT          DG---------QRMKADLVVAADGGNSIIRTLSALGTWGWDYDQQAVVATVKTDR-----
COQ6_YEAST            NG---------EVYKTRLLVGADGFNSPTRRFSQIPSRGWMYNAYGVVASMKLEYPPFK-
Q752C7_ASHGO          NG---------RRIQTRLLVGADGKNSPVRRFSGVQSRGWSYGRWGIVANLQLEYPPFK-
C4R280_KOMPG          NG---------DSLTCRLLVGCDGYNSPVRHFAGIESRGWSYNRWGVVATFKFADTEFRF
Q5AHZ4_CANAL          NG---------ETIQTRLLVGADGYNSPVRKYAHIESRGWQYNTFGVVATVKLQYEDFR-
Q7SHS8_NEUCR          GG---------KQLTARLLVGADGANSPVRAFAGIDAKGWDYNRHGVVATLEMEGEGWG-
G2X1S4_VERDV          GG---------KQLHARLLVGADGANSPVRSFADIKSRGWDYERHGVVATLEMEGDGWG-
C7YHL9_NECH7          GG---------HSLAARLLIGADGANSPVRTFAGINSRGWDYGRHGVVATLQLEGDGWG-
A7EXF8_SCLS1          GQE--------KSLAARLLVGADGQNSPVRKFAGIESRGWDYGRVGVVATLELEAR----
M2UK16_COCH5          NG---------KSLAARLLVGADGANSPVRTFAGIESRGFDYNRHGVVASLKLEGQGWG-
D5GIZ9_TUBMM          GG---------RELAARLLVGADGANSPVRAFAGIESRGWDYGRHGVVATVKIEDM----
Q4WQI4_ASPFU          PSGPAGQSQAPSRIAARLLVGADGINSPVRRWAGITTDGWDYDRHGVVATLSLSEPVSPA
C8V4E3_EMENI          PAGSESSNAPASRIAARLLVGADGINSPVRRYADITTDGWDYQRHGIVATLSLADHIPPP
C0NN36_AJECG          HTSPNSNFPQPPAIAARLLVGADGINSPVRSYAGISTDGWDYDRHGVVATLNISPPSQTP
F2Z6J4_YARLI          NG---------STISTDLLIGADGANSPVRTFSGIEARGWDYNTHGLVATVRLANE----
COQ6_SCHPO            HG----------ELTTKLLIGADGRNSIVRKYANISMPGWNYLTHAVVGTLKIDPLKGP-
Q5KB25_CRYNJ          DE----------WVRGSLVVGADGPNSPVRHFSEIESYGHGYNTHAVVATLNHDPDPLYP
                                       *::..**  *              *   .::  .         

COQ6_DROME            --------CDNSVAWQRFLPN--GPVALLPLTDRLSSLVWSTTNEQAKMLQALPPTEFVD
Q29NU4_DROPS          --------CDNSVAWQRFLPN--GPVALLPLNEKLSSLVWSTTVSQAKHLKDLPPAEFVD
Q0IFQ5_AEDAE          --------ANNVTAWQRFLPT--GPVALLPLNDEMSSLVWSTSISEAKRLLHLDDHSFVA
Q7QER0_ANOGA          --------SDNVTAWQRFLPT--GPIALLPLSDDTSSLVWSTGVAEAKRLLQLDGDSFIA
A0A088A361_APIME      --------GENVVAWQRFLPS--GPIALLPLTNDLSSLVWSLPIDEAKRLLKVSEEEFVD
E0W075_PEDHC          --------TENVVAWQRFLPT--GPIALLPLTNELSSLVWSTETKKAEQLLGMNEETFKD
E9HGJ4_DAPPU          --------DENVTAWQRFLPT--GPIALLPLNNEFSSLVWSTDKITAKSLLDLPPDVFTD
COQ6_CAEEL            --------GKNETAWQRFTTL--GPVALLPLSDTVSGLTWSTSPEEAQRLKQLPSDQFVD
A8XV72_CAEBR          --------GKNETAWQRFTTL--GPVALLPLSDTISGLTWSTSPEEAQRLKQLPADQFVD
A0A2H2IKS5_CAEJA      --------GKNDTAWQRFTTL--GPVALLPLSDTVSGLTWSTSPEEAQRLKQLPSDQFVD
COQ6_DANRE            --------TENNVAWQRFLPT--GPIAMLPLSDTESSLVWSTSHQHAEELLQMDEESFVD
W5K4Y2_ASTMX          --------TENNVAWQRFLPT--GPIAMLPLSDTESSLVWSTSHQHAELLLQMDEESFVD
W5MYN5_LEPOC          --------TENNVAWQRFLPT--GPIAVLPLSDTESSLVWSTSHQHAEELLRLDEESFVD
I3KWA8_ORENI          --------TENNVAWQRFLPT--GPIAMLPLSDMHSSLVWSTSHSLAEELLALDEERFVD
A0A087YDN3_POEFO      --------TENNVAWQRFLPT--GPIAMLPLSDTKSSLVWSTSHHLAEELLELDEESFVD
G3NYE7_GASAC          --------TENNVAWQRFLPS--GPIAMLPLSDTESSLVWSTSHQQAQELLELDEESFVD
H3DJ31_TETNG          --------TENNVAWQRFLPT--GPVAMLPLSDTMSSLVWSTSHQLASELLELDEESFVD
H2VBJ8_TAKRU          --------TENNVAWQRFLPT--GPIAMLPLSDTMSSLVWSTSHQLAEELLELDEESFVD
F1PBF7_CANLF          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVD
M3WSL0_FELCA          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVD
M3YDS0_MUSPF          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVGMDEEKFVD
COQ6_BOVIN            --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMEEEEFVD
H2Q8L0_PANTR          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVTMDEEKFVD
COQ6_HUMAN            --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVD
F6YUG8_CALJA          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEQFVD
A0A096NUG4_PAPAN      --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAQLVSMDEEKFVD
I3MRJ2_ICTTR          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHDHAAELVSMDEEEFVD
H0VF05_CAVPO          --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHDHAAQLVSMDEEEFVD
COQ6_MOUSE            --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEEFVD
COQ6_RAT              --------TENNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHAHAAELVSMHEEEFVD
F7AKV7_MONDO          --------TDNNVAWQRFLPS--GPIALLPLSDTLSSLVWSTSHEHAAELVSMEEENFLD
G1KSA9_ANOCA          --------TDNNVAWQRFLPS--GPIALLPLSDTVSSLVWSTSHEHAIQLQNMDEESFVD
COQ6_XENTR            --------TDNNVAWQRFLPT--GPIALLPLSDTCSSLVWSTSPEHASELVSMDEESFVD
W4Y3Y9_STRPU          --------TENIVAWQRFLPS--GPIALLPLTDDQSSLVWSTSKEHSKELVNMDEQDFTE
A7RWT5_NEMVE          --------TENVVAWQKFLPT--GPLALLPLSETHSSVVWTTTREHAQELVSLPEDRFVD
B3SDE9_TRIAD          --------NENVVAWQRFLPD--GPIALLPLSNSRSSLVWTTNPKHGKMLLEMSNEEFID
F7B5Q2_CIOIN          --------CDNFVAWQRFLPS--GPIALLPLSNTSSSLVWSTSRDHAEELKNISTEDFVN
COQ6_DICDI            NNSSNNNNNNNNTLFQRFLPT--GPIALLPLANGYANIIWSTNLMHAQYLLELDDESFLE
F0ZRQ8_DICPU          -------SDHNDTLFQRFLTT--GPIALLPLADGYANIIWSTNNLHANYLLELDDNSFLE
D3B5F4_POLPP          -------GYQTTTLYQRFLPT--GPIAMLPLADGYASIIWSTNVAHANYLLELDDDSFMV
B9GMF8_POPTR          ---------ENYSAWQRFLPA--GPIALLPIGDKFSNIVWTMNPEESSDFKSMKEDDFVK
K7LAM2_SOYBN          ---------ENECAWQRFLPT--GPIALLPMGDKFSNIVWTMSPTESNNRKSITEEEFLK
K4CWI3_SOLLC          ---------ENFCAWQRFLPN--GPIALLPIGEKFSNIVWSMDPKEAVDRSSMSEDDFVQ
F4J6I5_ARATH          ---------ENYTAWQRFLPN--GPIALLPIGDKFSNIVWTMDPKEASDRKLMNEDDFIK
U5D2V4_AMBTC          ---------ENHCAWQRFLPS--GPIALLPIGDTYSNIVWTMTPHEASNHKSMHEDDFVK
C5WT36_SORBI          ---------ENDCAWQRFLPS--GPIALLPIGNNFSNIVWTMSPEESLRHKSMSPEEFVK
K4A8H5_SETIT          ---------ENDCAWQRFLPS--GPIALLPIGNNFSNIVWTMSPEESLRHKSMSPEEFVK
A0A1D6GDN2_MAIZE      ---------ENDCAWQRFLPS--GPIALLPIGNNFSNIVWTMSPEESLRHKSMSPEEFVN
Q851N5_ORYSJ          ---------ENDCAWQRFLPS--GPIALLPIGDNYSNIVWTMSPEESLRHKSMSPEDFVK
I1GL38_BRADI          ---------ANDCAWQRFLPS--GPIALLPVGDNFSNIVWTMSPEEASRHKSMSPEDFVK
A9RFL2_PHYPA          ---------NHATAFQRFLPT--GPFALLPLNDTYSNIVWTTTPEKADALKTMSAEQFVV
D0NQJ6_PHYIT          ---------VNETAWQRFYPT--GPVALLPMRDGYSSVVWSCTADMAKELTALSPDKFVA
COQ6_YEAST            -----------LRGWQRFLPT--GPIAHLPMPENNATLVWSSSERLSRLLLSLPPESFTA
Q752C7_ASHGO          -----------TRGWQRFLPT--GPIAHLPMPGTDACLTWSTTEPLARLLLSLEPAAFAT
C4R280_KOMPG          -----------PTGWQRFLPT--GPLALLPLPNGYTSMVWSTTPELAEMLLSLDETEFLS
Q5AHZ4_CANAL          -----------AVGWQRFLTT--GPLAILPLSEDNATIVWSSTPELADLLLKVNEKIFPH
Q7SHS8_NEUCR          -------GEHTKIAYQRFLPT--GPVAMLPMPGKYSTLVWSTTPENASILKSLSPKDFVA
G2X1S4_VERDV          -------GDYNKTAYQRFLPT--GPVAMLPLPGKYSTLVWSTTPANAALLKSLAPKDFIA
C7YHL9_NECH7          -------GEFNKIAYQRFLPT--GPVAMLPLPGNHASLVWSTTPEKATLLKSLSSKDFIA
A7EXF8_SCLS1          -------HEVGKIAYQRFLPT--GPVAMLPLPGNYATLVWSTTPENASVLKTLSLRDFIA
M2UK16_COCH5          -------GSDHKIAYQRFLPT--GPIAMLPLPGNMSTLVWSTTPERAARLKALSQQEFVA
D5GIZ9_TUBMM          -------PDVERTAYQRFLPT--GPVALLPLPGNFATLVWSTTPEIAARLKKLSPVDFVA
Q4WQI4_ASPFU          F------PTGTRTAYQRFLPSLGGPVALLPLPNNTATLVWSTTVENAAYLKSLSPRAFIA
C8V4E3_EMENI          F------PIGTRTAYQRFLPALGGPIALLPLPNNNATLVWSTTVENAAYLKSLSPGAFIA
C0NN36_AJECG          G------PP-LRTAYQRFLPGLGGPIALLPLPGNHATLVWSTTVRNAAYLKSLPAEALIA
F2Z6J4_YARLI          ----------QQSAWQRFLPT--GPIALLPLPNRFGSLVWSTTPKMAAQLKQLTPEQFVM
COQ6_SCHPO            -----------AVAFQRFLPT--GPLAYLPLPDNNATFVWSTRPHIASKLLRLPEETFVK
Q5KB25_CRYNJ          ----------NTTAFQRFLST--GPIAFLPLSDTSSTMVWSTLPENAAALKKLSHDALTQ
                                    :*:* .   **.* **:      . *:     .     :    :  

COQ6_DROME            ALNEAFCRQYPRVE--------------------------LADKAVQALNSLFGHNG---
Q29NU4_DROPS          ALNEAFCRQYARVE--------------------------LADKAVQALNSFFGQQA---
Q0IFQ5_AEDAE          ALNEALTKSYPRNN--------------------------VIEEVLKNVNSFITST----
Q7QER0_ANOGA          AVNAAFHKPMPRNT--------------------------LVDDVMKGVHSLIKQT----
A0A088A361_APIME      NINNALWKVYPKDG--------------------------IVESGMKALQQLLEGLSLQ-
E0W075_PEDHC          SLNDAFWKSYPKNE--------------------------LVSSATASLDKMLSSLTLK-
E9HGJ4_DAPPU          RINQALWNNDDRNP--------------------------MVQNVSERIFQMLKVCRVNS
COQ6_CAEEL            ELNSALFSQNNQIP--------------------------LVNQTIFALNRMNPFRTETF
A8XV72_CAEBR          ELNSALFSQDDQLP--------------------------YVNQAIFALNKMNPFRTETF
A0A2H2IKS5_CAEJA      ELNSALFSQDDQNQ--------------------------FVNQAIFALNRLNPFRPETF
COQ6_DANRE            AINSAFWSNENHSE--------------------------LVETAGSLFRMALSVLMPDS
W5K4Y2_ASTMX          AINSAFWSNENQSE--------------------------LVEAAGSLFRTALTILMPNG
W5MYN5_LEPOC          AINSAFWSNENHSE--------------------------LIETAGTMFRSALSILMPSG
I3KWA8_ORENI          AINSAFWSNENQSD--------------------------LIETAGSLFRGALSALMPSA
A0A087YDN3_POEFO      AINSAFWSNENQSD--------------------------LIETAGALFRDALSAIMPSA
G3NYE7_GASAC          AINSAFWSNENQSE--------------------------LIETAGSLFRSTLSAIMPSA
H3DJ31_TETNG          AVNSAFWSNENQSE--------------------------LIETAGSLFRGALSAIMPSA
H2VBJ8_TAKRU          AINSAFWSNENQSE--------------------------LIETAGSLFRGALSAIMPSA
F1PBF7_CANLF          AINSAFWSDANHTD--------------------------FIDSAGAMLQYAVAFLKPTK
M3WSL0_FELCA          AINSAFWSDANHTD--------------------------FIDSAGTILQYAVAFLKPTK
M3YDS0_MUSPF          TVNSAFWSDANHTD--------------------------LIDAAGSLLQSAVAFLKPTK
COQ6_BOVIN            AINSAFWSDVNHTD--------------------------FIDSAGSMLQSAVAFLKPTR
H2Q8L0_PANTR          AVNSAFWSDADHTD--------------------------FIDTAGAMLQYAVSLLKPTK
COQ6_HUMAN            AVNSAFWSDADHTD--------------------------FIDTAGAMLQYAVSLLKPTK
F6YUG8_CALJA          AVNSAFWSDADHTD--------------------------FIDTAGAMLQYAVGLLKPTK
A0A096NUG4_PAPAN      AVNSAFWSDADHTD--------------------------FIDTAGAMLQYAVGLLKPTK
I3MRJ2_ICTTR          AINSAFWSDANHVD--------------------------FIDSAGTMLQYVVTLLKPTK
H0VF05_CAVPO          AVNSAFWSDAHHTD--------------------------FISSAGTMLQYAVALLKPTK
COQ6_MOUSE            AINSAFWSDVHHTD--------------------------FVDSASAMVRHAVALLKPTK
COQ6_RAT              AINSAFWSDVHHTD--------------------------FVDSASAMVHHAVALLKPTK
F7AKV7_MONDO          AINSAFWSDASHTD--------------------------FVDSAGSVLQYAFTLLQPTK
G1KSA9_ANOCA          SINSAFWSNANHSD--------------------------FVDTAGSMFRSAISLLMPSG
COQ6_XENTR            TVNSAFWSNENHSE--------------------------FITSAGSLLHSALSFFMPTG
W4Y3Y9_STRPU          AVNNAFWDDSHHNQ--------------------------SVDAATQLFEGLLSVIKPDG
A7RWT5_NEMVE          AINNAFWEDMDRHP--------------------------AVDTASKLAQSISSFIEPFA
B3SDE9_TRIAD          SVNNAFVNNDHVIP--------------------------NINRISSTINRGLNSIPSGN
F7B5Q2_CIOIN          QINNAFWKEYPRDK--------------------------SVEMLQEMTQTCLNLFTSDE
COQ6_DICDI            QVKDSFLKSPSTS-----------------------------NSSFFEIASNLFNLNPKG
F0ZRQ8_DICPU          QLKNSFLSSVPTN-----------------------------NNSVFDALSSVFNLNPSG
D3B5F4_POLPP          QMKHAWLSGAKTNG----------------------------NNSIVDLLHNVLSTNPER
B9GMF8_POPTR          AVNHALDYGYG-----PHHKS--------------------SLPGSAGMFSWLGGNVTIF
K7LAM2_SOYBN          DVNYALDYGHG-----PHPTS--------------------SLSGTRDVFSWFKTDATLS
K4CWI3_SOLLC          AVNHALDDGYG-----PQPRS--------------------KSFEGGNVFSWLKADSTSS
F4J6I5_ARATH          AVNDALDSGYG-----PNPET--------------------TSS--RDSLSWLTGDATIS
U5D2V4_AMBTC          AINHALDYGYG-----PHPHS--------------------NLG-FIDKFSWLAGGAISS
C5WT36_SORBI          SVNHALDFGYG-----PHPRST-------------------ALDRYMEQFFSGIGNTAAS
K4A8H5_SETIT          SVNHALDFGYG-----PHPRSS-------------------ALDHYMEKFFSGIGNTAAS
A0A1D6GDN2_MAIZE      SVNHALDFGYG-----PHPHST-------------------ALDHYMEQFFSGIGSSAAS
Q851N5_ORYSJ          SVNNALDFGYG-----PHPHSG-------------------SLDYYMEKLFSDIGSTAAS
I1GL38_BRADI          SVNHALDFGYG-----PHPNSS-------------------SLDYYMEKLFSGIGDTAAS
A9RFL2_PHYPA          EANKALIDDHG-----PKPGSKI-----------------AEIVGNVVTSSPLLGAMGPS
D0NQJ6_PHYIT          RLNDAYSAPPMIPVPPEFPGIPV-----------------LSDLVKGVHHAANTIMSAAA
COQ6_YEAST            LINAAFVLEDADMNYYYRTLE---------------DGSMDTDKLIEDIKFRTEEIYATL
Q752C7_ASHGO          LVNAAFILDDADMQFYYKHLQ---------------EGTLSTSELIADVEHRIQQVFSNL
C4R280_KOMPG          MVNAGTRLSTEELSMIYDLAK---------------SKSPD---LLEQIQWRLNLFAGKL
Q5AHZ4_CANAL          LVTAAMVLEEVDLNYIYSVLQ---------------EDPNDFS-VLKDIEWRLSKFNPE-
Q7SHS8_NEUCR          MVNAAFRLSPVDLAFMHTQGA----------------------NQDYEYSWRLQHTSFNP
G2X1S4_VERDV          LVNAAFRLSPVDVKFMHTTSS----------------------GQDEELQWRLDHTPVDV
C7YHL9_NECH7          IVNAAFRLSPIDIGYMHTQAD----------------------GQAEEFSWRMEHTTIDA
A7EXF8_SCLS1          MVNAAFRLSTVDLKYMHTQPS----------------------GQAEEVSWRLGHTPIS-
M2UK16_COCH5          MVNAGFRLSPTDLEYLHTLSS----------------------GHEEEVAWREKHTPVDE
D5GIZ9_TUBMM          MVNSAFRLSHVDIAYMAKMDG----------------------GILEEYQWRQSVTPSDK
Q4WQI4_ASPFU          MVNAAFRLSMADLKYMINMER------PANP------IADAENPHEDELTWRLQHTPQP-
C8V4E3_EMENI          MVNAAFRLGMPDLQYMMRMER------PSSSS----VTNLDEDLHESELTWRLQHTPSP-
C0NN36_AJECG          MVNAAFRLSMIDLKYMFTLPPSPTAALPTDSVRSDPLSTTLSTEHSDELSWRLENTAIP-
F2Z6J4_YARLI          MVNCAFNLEPTDIEYLVEHPD----------------------EIMTDAPYRLSQRSSN-
COQ6_SCHPO            FLNASFRLDYPDLSYLYQMDFS------------------EPSKVNEQLDWRLQVKRNSN
Q5KB25_CRYNJ          MVNAAFTLPEETLSSLCEAMLSAQ--------------SEGTPLTAPQIVTLIATLPTPL
                        . .                                                       

COQ6_DROME            ----SQHQVQYPPRVCGVLDKSRATFPLGFLHASSYVCNGAALVGDAAHRVHPLAGQGVN
Q29NU4_DROPS          ----TQNQLQYPPRVCAVKDGSRATFPLGFLHASSYVCSGAALVGDAAHRVHPLAGQGVN
Q0IFQ5_AEDAE          ----TGQRLEQPPLVEAVVEKSRAAFPLGLGHTSTYVGHGVCLIGDAAHRVHPLAGQGVN
Q7QER0_ANOGA          ----TGQRLEAAPVVEAEVASSRAAFPLGLGHTSTYVGQGVCLIGDAAHRVHPLAGQGVN
A0A088A361_APIME      ----TGVVRQLQPSISTISEGSRAAFPLQFGHSVSYVQTGTVLVGDAAHRVHPLAGQGVN
E0W075_PEDHC          ----SFGSHQLPPSVSSIVPGSRAAFPLGFGHSIKYYRPGIVLVGDAAHRIHPLAGQGVN
E9HGJ4_DAPPU          LEGSASDIRQLPPSVVEIK-GRQAAFPLGLGHAVDYISNKAVLIGDAAHRVHPLAGQGVN
COQ6_CAEEL            ---GRKAEGTTPPHVITVQDKSRASFPLGFGNAHSYITTRCALIGDAAHRMHPLAGQGVN
A8XV72_CAEBR          ---GRKAEGTTPPHIISVQDKSRASFPLGFGNAHSYITTRCALIGDAAHRMHPLAGQGVN
A0A2H2IKS5_CAEJA      ---GRKAEGTIPPHVINVQDKSRASFPLGFGNAHSYITTRCALIGDAAHRMHPLAGQGVN
COQ6_DANRE            -----GSARQLPPSVSGIGPKSRVMFPLGMGHATEYIRHRVALIGDAAHRVHPLAGQGAN
W5K4Y2_ASTMX          -----TSTRQLPPSVAGIGPKSRVMFPLGMGHASEYIRHRVALIGDAAHRVHPLAGQGAN
W5MYN5_LEPOC          -----TSARQLPPSVSGIGAQSRAIFPLGMGHASEYIRHRVALIGDAAHRVHPLAGQGVN
I3KWA8_ORENI          -----GSPRQLPPSVAGIGPKSRVMFPLGMGHASEYIRHRVALIGDAAHRVHPLAGQGVN
A0A087YDN3_POEFO      -----GSPRQLPPSVAGIGPKSRVMFPLGVGHASEYIRHRVALIGDAAHRVHPLAGQGVN
G3NYE7_GASAC          -----GSPRQLPPSVAGIGPKSRVKFPLGIGHASEYIRHRVALIGDAAHRVHPLAGQGAN
H3DJ31_TETNG          -----GSPRQLPPSVAGIGPKSRVMFPLGMGHASEYVRHRVALIGDAAHRVHPLAGQGVN
H2VBJ8_TAKRU          -----GSPRQLPPSVAGIGPKSRVMFPLGMGHASEYIRHRVALIGDAAHRVHPLAGQGVN
F1PBF7_CANLF          -----VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRLALIGDAAHRVHPLAGQGVN
M3WSL0_FELCA          -----VSARQLPPSVARVDARSRMSFPLGLGHAAEYVRPRLALIGDAAHRVHPLAGQGVN
M3YDS0_MUSPF          -----VSARQMPPSVARVDAKSRVLFPLGLGHAAEYVRPRLALIGDAAHRVHPLAGQGVN
COQ6_BOVIN            -----VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRLALIGDAAHRVHPLAGQGVN
H2Q8L0_PANTR          -----VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
COQ6_HUMAN            -----VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
F6YUG8_CALJA          -----VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
A0A096NUG4_PAPAN      -----VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
I3MRJ2_ICTTR          -----VSARQLPPSVAKVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
H0VF05_CAVPO          -----VSARQLPPSVAKVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
COQ6_MOUSE            -----VSARQLPPSIAKVDAKSRALFPLGLGHAAEYVRPRVALIGDAAHRIHPLAGQGVN
COQ6_RAT              -----VSARQLPPSVAKVDAKSRALFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVN
F7AKV7_MONDO          -----SSARQLPPSVAKVDPQSRALFPLGMGHAVEYVRPRVALIGDAAHRVHPLAGQGVN
G1KSA9_ANOCA          -----TAARQLPPSVAKVDPKSRAVFPLGLGHATEYVQHRVALIGDAAHRVHPLAGQGVN
COQ6_XENTR            -----SSPRQLPPSVSRVEQNSRASFPLGLKHATEYIRHRVALIGDAAHRVHPLAGQGVN
W4Y3Y9_STRPU          -----SSIRQLPPSIAGVGASSRASFPLGLCHAPRYITDRVALIGDAAHRVHPLAGQGIN
A7RWT5_NEMVE          G---SSSAVQMPPSISGVEEGSRGMFPLGLGHATHYVQPRLALIGDAAHRVHPLAGQGVN
B3SDE9_TRIAD          ----FKEAPQSPPTVAGIDNNSRGGFPLSLGHATNYVMNRLALIGDAAHRVHPLAGQGVN
F7B5Q2_CIOIN          S---SISSLQYPPSISGVQGGVFS-FPLGFSHSDEYVRPRLAFIGDAIHRIHPLAGQGLN
COQ6_DICDI            -----LSGNEIYLPPIEGLVSKRASFPLRIDHTFNYTLPRVCFIGDASHLVHPMAGQGVN
F0ZRQ8_DICPU          -----LSGNEIYVPPIESIVSKRASFPLRIDHTFQYTMPRICFIGDASHIVHPMAGQGVN
D3B5F4_POLPP          -----LSGNEISIPPIERVSSKRASFPLRLEHTKSYTQRGLCLIGDAAHVVHPMAGQGVN
B9GMF8_POPTR          -----ANESFEIPPKVVKLASERMAFPLSLMHANEYASKRVVLIGDAAHTVHPLAGQGVN
K7LAM2_SOYBN          -----TNEFFEIPPKVTRLASERMVFPLSLRHANSYALKRVVLIGDAAHTVHPLAGQGVN
K4CWI3_SOLLC          -----THEGFEVPPKVTKLASHRMAFPLSLMHANSYASKRLVLIGDAAHTVHPLAGQGVN
F4J6I5_ARATH          -----AKERFETPPKVVKLSSERMMFPLSLRHAKDYVSKRVALVGDSAHTVHPLAGQGVN
U5D2V4_AMBTC          -----MKESFEVPPKIDQLVSERMAFPLSLMHAHEYASHRVVLIGDAAHAVHPLAGQGVN
C5WT36_SORBI          -----TRECFEVPPKATGVVSERMAFPLSLMHSHDYVSKRLALVGDAAHTVHPLAGQGVN
K4A8H5_SETIT          -----TKECFEVPPKATGVVSERMAFPLSLMHSHDYVSKRLALVGDAAHTVHPLAGQGVN
A0A1D6GDN2_MAIZE      -----TKECFEVPPKATRVVSERMAFPLSLMHSHDYVSKRLALVGDAAHTVHPLAGQGVN
Q851N5_ORYSJ          -----TKECFEVPPKAIGVVCERMAFPLSLKHSHDYISKRLALVGDAAHTVHPLAGQGVN
I1GL38_BRADI          -----TKESFQVPPKAIGLISERMAFPLSLMHSHDYVSKGLALVGDAAHTVHPLAGQGVN
A9RFL2_PHYPA          -----ASEPFQEPPRIVDCATPRLSFPLSLMHASNYVGHRVALVGDAAHTVHPLAGQGVN
D0NQJ6_PHYIT          -----MTEPFVAPPKAVATVGHRFAFPLKLKHATKYIKPGVALVGDSAHTIHPLAGQGLN
COQ6_YEAST            KDE-SDIDEIYPPRVVSIIDKTRARFPLKLTHADRYCTDRVALVGDAAHTTHPLAGQGLN
Q752C7_ASHGO          QDE-GLIDEIYPPKVVDVYEGSRARFPLSMAHADTYVADRIALVGDAAHSTHPLAGQGLN
C4R280_KOMPG          K---PADEENFPLQVSEIVTGSRARFPLKLSHADTYVEDRVALVGDAAHTTHPLAGQGLN
Q5AHZ4_CANAL          -----ELEERYPLPVVDVLSGSRARFPLKMSHADTYVAPRVALVGDAAHTIHPLAGQGLN
Q7SHS8_NEUCR          --------RAIPQTVVGVQEGTIASFPLKMRHADTYIGERVALVGDAAHTIHPLAGQGLN
G2X1S4_VERDV          --------AAIPQTAVGVQEGTIASFPLKLRHADTYIGERVALIGDAAHTIHPLAGQGLN
C7YHL9_NECH7          --------ESIPQTVVGVQEGTVASFPLKLRHADTYTGERVALVGDAAHTIHPLAGQGLN
A7EXF8_SCLS1          --------DSVPAPVTGVQENSIASFPLKMRHADTYIGERIALVGDAAHTIHPLAGQGLN
M2UK16_COCH5          --------HAIPMRVTNVQAGTVASFPLRMRHADTYTGERVALVGDAAHTIHPLAGQGLN
D5GIZ9_TUBMM          --------AEVPSKILEVQENSIASFPLKMRHVDSYISERVALVGDAAHTIHPLAGQGLN
Q4WQI4_ASPFU          --------SHIPPMVNGVQEGSVASFPLRFRHASSYISPRVALVGDAAHVIHPLAGQGLN
C8V4E3_EMENI          --------SHLPPMVTGVQEGSVASFPLRFRHASTYISPRVALVGDAAHVIHPLAGQGLN
C0NN36_AJECG          --------PYAPPTVTSVQPGTVASFPLRHRHASTYISPRIALVGDAAHVIHPLGGQGLN
F2Z6J4_YARLI          --------PDVPCPIVAVQDKSRASFPLKMKHADTYIAENVALVGDAAHTTHPLAGQGLN
COQ6_SCHPO            --------MQVPPVITEIVSGSRAAFPLRLAHVDEYVKEGIALCGDAAHNTHPLAGQGLN
Q5KB25_CRYNJ          TS---SDQPIIPPAITSIHPPSVASFPLRISHATSYLGERTALVGDAAHTIHPLAGQGLN
                                               ***   :   *      : **: *  **:.*** *

COQ6_DROME            LGFSDVRYLVESLAAGAYAGFKLG---DKQHLIKYERKCLAKNVPIMLGVHGLHTLYATQ
Q29NU4_DROPS          LGFSDVRYLVESLAAGAYAGFKLG---DKQHLIKYERKCLAKNVPIMLGVHGLHALYSTE
Q0IFQ5_AEDAE          LGFGDVQCLTDVLADANYSGLGLN---NLAQLVKYEQERLRHNVPVILTTHGLQRLYTTD
Q7QER0_ANOGA          LGFGDVQTLVDVLADANYAGLGIS---NVSELLKYEQQRLKHNVPVLLTTHSLQRLYTTD
A0A088A361_APIME      LGFGDITVLVQLLAEAVISGVPIG---NMMYLRKYETLRQRYNVPIMFAIDALHRLYNGT
E0W075_PEDHC          LGFGDVELLTNKLGDSVYNGNKIG---CSRVLADYESERQREILPMLITTDFLQKLYSTS
E9HGJ4_DAPPU          LGFGDVIALNDAICEAVNNGADHG---SSLYLKQYQSNRQMRNLPVMASVHGLHLLYGTT
COQ6_CAEEL            LGWSDVQILDKVLGDAVREGADIG---SITYLREYDSAAQKHNLPVMVSVDLLNRLYRTD
A8XV72_CAEBR          LGWSDVQILDKILGDAVREGADIG---SITYLREYDSAAQKHNLPVMVSVDLLNRIYRTD
A0A2H2IKS5_CAEJA      LGWSDAQILNKVLGDAAREGADIG---SITYLSEFDSAAQKHNLPVMVSVDLLNRLYRTD
COQ6_DANRE            LGFGDVSYLTQVLSQAAYNGKDIG---AMQHLLEFETERQRHNLPMMTAIDLMKRLYSSN
W5K4Y2_ASTMX          LGFGDVASLTQVLSQAAFNGKDLG---AMQHLLEYETDRQRHNLPMMAAIDLMKRLYSTN
W5MYN5_LEPOC          LGFGDVACLTRLLSQAAFNGRDLG---AMQHLLEYETERQRHNLPMMAAIDLMKRLYSTK
I3KWA8_ORENI          LGFGDVACLTQILSQAAFNGKDLG---AIQHLLEYETERQRHNLPMMGAIDLMKRLYSTN
A0A087YDN3_POEFO      LGFGDVACLTHLLSQAAFNGKDLG---AIQHLLEYETERQRHNLPMMTAIDLMKRLYSTN
G3NYE7_GASAC          LGFGDVACLTRILSQAAFDGKDLG---AMQHLLEYETERQRHNLPMMAAIDLMKRLYSTN
H3DJ31_TETNG          LGFGDVTCLTRLLSQAAFNGRDLG---AIHHLLEYETERQRHNLPMMSAIDLMKRLYSTS
H2VBJ8_TAKRU          LGFGDVTCLTQLLSQAAFNGKDLGQSGAIHHLLEYETERQRHNLPMMTAIDLMKRLYSTN
F1PBF7_CANLF          MGFGDVSSLVHHLSAAAFNGKDLG---SMSHLTGYETDRQRHNTALLAATDLLKRLYSTS
M3WSL0_FELCA          MGFGDISSLVHHLSAAAFNGKDLG---SMSHLTGYETDRQRHNTALLAATDLLKRLYSTS
M3YDS0_MUSPF          MGFGDVSSLVRHLSAAAFNGKDLG---SMSHLTGYETDRQRHNTALLAATDLLKRLYSTR
COQ6_BOVIN            MGFGDISSLLHHLSTAAFNGKDLG---SMSHLTSYETDRQRHNTALLAATDLLKRLYSTR
H2Q8L0_PANTR          MGFGDISSLAHHLSTAAFNGKDLG---SMSHLTGYETERQRHNTALLAATDLLKRLYSTS
COQ6_HUMAN            MGFGDISSLAHHLSTAAFNGKDLG---SVSHLTGYETERQRHNTALLAATDLLKRLYSTS
F6YUG8_CALJA          MGFGDISSLAHHLSTAAFNGKDLG---SMSHLTGYETDRQRHNTALLAAIDLLKRLYSTS
A0A096NUG4_PAPAN      MGFGDISSLAHHLSTAAFNGKDLG---SMSHLTGYETERQRHNTALLAATDLLKRLYSTS
I3MRJ2_ICTTR          MGFGDISSLVHHLSTAAFNGKDLG---SMSHLASYETDRQRHNTALLAATDLLKRLYSTR
H0VF05_CAVPO          MGFGDISSLLHHLSTAAFNGKDLG---SMSHLTCYETDRQRHNTALLAATDLLKRLYSTS
COQ6_MOUSE            MGFGDISSLVHHLSTAAFNGKDLG---SMSHLTGYETDRQRHNTALLAATDLLKRLYSTS
COQ6_RAT              MGFGDISSLIHYLSTAAFNGKDLG---SMSHLTGYETDRQRHNTALLAATDLLKRLYSTS
F7AKV7_MONDO          MGFGDISSLLRHLSTAAFNGKDLG---SMSHLTEYETERQRHNVSLIAATDLLKRLYSTT
G1KSA9_ANOCA          MGFGDIACLTHHLSSAAFDGKDLG---SLKHLLKYEAERQKYNLSLLAATDLLKRLYSTS
COQ6_XENTR            MGFGDVACLAHHLSQAAFNGSDLG---STKHLLEYETERQRHNLPLMAAVDLLKRLYNTK
W4Y3Y9_STRPU          LGFGDVTSLTQVLSEAASMGKDLG---SVSHLEEYETQRQRHILPVMGTIDALKRLYSTD
A7RWT5_NEMVE          LGFGDVACLRDVLVAAAKDGCDLG---SLDHLLQYETERQRSVVPMMAAVDFLKRLFSTS
B3SDE9_TRIAD          LGFKDVEVLSKVLAEAVTEGNDIG---ALPHLLKYESTRQLQVLPIMATIDNLNRLFSNK
F7B5Q2_CIOIN          LGMRDVKSLLDVVETSLYNGMDIG---SLESLLRYESDRQRGNLPMLTAVDGIKKLYSTD
COQ6_DICDI            LGMADVKTLSSIIEQSVQSGYDIG---DAMMLKRFEEIRKPENLKMLLSIDTLFNLFTNN
F0ZRQ8_DICPU          LGMADVKALTQMIEQSVQSGYDIG---DAMMLKRFEEERKPENVKMMLSIDTLFNIFTNN
D3B5F4_POLPP          LGLADVIALTQILSEGQATGYNVG---NEMMLERYQENRKLENIKMMASIDTLFHLFGSS
B9GMF8_POPTR          LGFGDAFALSRIIAEGIAVGMDIG---EVSLLKKYEAERKLANMTMMAILDGFQKAYSVD
K7LAM2_SOYBN          LGFGDAFSLSRIIAEGIALGTDIG---EVNMLKKYEAERKTANIMMMAILDGVQKAYSID
K4CWI3_SOLLC          MGFADALCLSKVIAEGVAVGSDIG---EITLLQRYESERKAANITMMAILDGFQKAYSID
F4J6I5_ARATH          LGFADACALSKAIAEGIALGTDIG---EANLLKRYEAERKPANIAMMAVLDGIQKMYSLD
U5D2V4_AMBTC          LGFGDAICLSNIIAEGILVGSDIG---ELSLLKKYEKERKMANLTMMAILDGFQKAFSVD
C5WT36_SORBI          LGFGDAAALAKVIAEGVSVGSDVG---DLTLLQRYEKDRKAANVAMTAVLDGFQKMYSVD
K4A8H5_SETIT          LGFGDAAALAKVIAEGVSVGSDVG---DLTLLQRYEKDRKAANVAMTAVLDGFQKMYSVD
A0A1D6GDN2_MAIZE      LGFGDAAALAKVIAEGVSVGSDVG---DLTLLQRYEKERKAANVAMAAVLDGFQKMYSVD
Q851N5_ORYSJ          LGFGDAAALAKVIAEGVSVGADFG---DISLLKRYENNRKAANVAMAALLDGFQKMYSVD
I1GL38_BRADI          LGFGDAAALAKVISEGVSVGADIG---DLSLLNRYENDRKAANVAMAAVLDGFQKMYSVD
A9RFL2_PHYPA          LGFGDAASLSKVLQKGVETGHDIG---QIDLLEEYERERKRTNLTMMAILDGFQKMYSSD
D0NQJ6_PHYIT          LGLGDVTALSNLLVEGVKSGENLS---SEYFLQQYEDERMKANITMQLAMDGFKRMFGPA
COQ6_YEAST            MGQTDVHGLVYALEKAMERGLDIG---SSLSLEPFWAERYPSNNVLLGMADKLFKLYHTN
Q752C7_ASHGO          MGQGDVEALLSALERANQRGLDLG---SLLALEPYWAERYPINNALIGGADKLHKLYSTD
C4R280_KOMPG          MGQEDVKSLVGALERATSRGLDIG---NSLALEPYFSERWPQNHVLLGVMDKIHKIYSTD
Q5AHZ4_CANAL          MGQSDVAALVEALEKGIDRGMDIG---STLVLENYVANAWPSNHALLGICDKLHKIFSTD
Q7SHS8_NEUCR          QGQGDVQSLAKTIEHAVTHGQDIG---SIMSLESYVSERYTANHVLLGVVDKLHKLYSAE
G2X1S4_VERDV          SGQGDVQSLAKTIEYAVAHGQDIG---SSLSLETYNSERYAANHVLLGVCDKLHKLYSVE
C7YHL9_NECH7          QGQGDVQSLAKTIEYAVSHGQDLG---TQLSLESYNSERYAANHVILGVCDKLHRLYSVE
A7EXF8_SCLS1          QGQGDVESLVKSIGYAVEHGMDIG---VRMSLEGYNSERYMQNHVLLGVVDKLHKLYSVE
M2UK16_COCH5          QGQGDAAALVRTISYAVQTGQDIG---STLALESYNSERYAENNAMLGVCDKLHRLYSVG
D5GIZ9_TUBMM          QGIGDAQFLIKALETAVQNGQDIG---STLSLEPYCSDQYFKNNLMIGIVDKLHKLYGTA
Q4WQI4_ASPFU          LGLGDVASLSKTIEYAVNHGMDVG---DILTLERYAAERYATNAKIGAACDVLHKLYNVP
C8V4E3_EMENI          LGLGDVASLSRTIEYAVTHGMDIG---DILTLERYTAERYATNAKIGGTCDVLHKLYNVP
C0NN36_AJECG          LGLGDVASLFRTIEYSIRHGMDIG---DLLSLERYAAERYLVNAKIGGACDLLHKAYNVP
F2Z6J4_YARLI          MGQGDAQSLAIAIRNAAGRGADIG---STLTLEPYWADQYFKNHKLLGVVDKLHKLYSTR
COQ6_SCHPO            TGIQDVESLISALSFAIKHGQDIG---SVFSLQPYFRDRYFKNHVYLGVVDKFHKLYAME
Q5KB25_CRYNJ          MGLADVKCLAEVLEETRRLGGDLG---SLEGTKGYPKERYPLNHLMLSATDKLHYIFRAR
                       *  *   *   :      *   .          :               . .   :   

COQ6_DROME            -FSPVVLLRSLGLQLTQNLPPVKNLFMRGAMGQ---------------------------
Q29NU4_DROPS          -FSPVVLLRSLGVQLTQNLPPIKNLFMKGAMG----------------------------
Q0IFQ5_AEDAE          -FPPIVGLRSIGLTITNSLPPVKNFHGKFPQI----------------------------
Q7QER0_ANOGA          -FVPTVALRSIGLTLTNALPPVKVLILG--------------------------------
A0A088A361_APIME      -AAPIVLVRSLGLQLTNAIPVIKKALIEHASGQIET------------------------
E0W075_PEDHC          -FAPVVLVRSLGLQITNALHPLKVRFLQ--------------------------------
E9HGJ4_DAPPU          -WTPLVMLRSIGLNVFDSLSSVKSFFTQRASV----------------------------
COQ6_CAEEL            -APAIVAARAFGLNAFNSLGPVKNFLMNYLSAHR--------------------------
A8XV72_CAEBR          -APAIVAARAFGLNAFNSLGPVKNFLMNYLSAHR--------------------------
A0A2H2IKS5_CAEJA      -APAIVAARSFGLNAFNSLGPVKNYLINYLSAHR--------------------------
COQ6_DANRE            -TAPMVLLRTFGLQATNAVPPLKEQIMAFASK----------------------------
W5K4Y2_ASTMX          -AAPMVLLRTLGLQATNALPPIKEQIIAYASK----------------------------
W5MYN5_LEPOC          -MAPIVLLRTLGLQATNAVPPVKEQIMAFASK----------------------------
I3KWA8_ORENI          -AAPVVLLRTFGLQATNMLPMLKEQIMAFASK----------------------------
A0A087YDN3_POEFO      -AAPAVLLRTFGLQATNMLPTLKEQIMAYASK----------------------------
G3NYE7_GASAC          -AAPVVLLRTFGLQATNMVPALKEQIMGFASK----------------------------
H3DJ31_TETNG          -VAPVVLLRTFGLQATNMLPALKEQIMAFASK----------------------------
H2VBJ8_TAKRU          -VAPVVLLRTFGLQATNMLPSLKEQIMAFASK----------------------------
F1PBF7_CANLF          -ATPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
M3WSL0_FELCA          -ATPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
M3YDS0_MUSPF          -AAPLVLLRTWGLQATNAVSPLKVRSLTALQESCSLRKDLANDS----------------
COQ6_BOVIN            -ATLVVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
H2Q8L0_PANTR          -ASPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
COQ6_HUMAN            -ASPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
F6YUG8_CALJA          -ATPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
A0A096NUG4_PAPAN      -AAPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
I3MRJ2_ICTTR          -APPLVLLRTWGLQATNAMSPLKEQIMAFASK----------------------------
H0VF05_CAVPO          -ATPLVLLRTWGLQVTNAVSPLK-------------------------------------
COQ6_MOUSE            -ATPLVLLRTWGLQATNAVSPLKEQIMAFASK----------------------------
COQ6_RAT              -TTPLVLLRTWGLQATNAVSPLKEQIMAFASR----------------------------
F7AKV7_MONDO          -IAPLVLLRMWGLQATNAVSPLKEQIMAFASK----------------------------
G1KSA9_ANOCA          -ITPFVLLRTWGLQATNAIPPVKEQIMAFASK----------------------------
COQ6_XENTR            -QPPIVLLRTLGLQATNALTPVKEQIMAFASK----------------------------
W4Y3Y9_STRPU          -NPAAVLIRSLGLQATNALGPIKDRIIASAAT----------------------------
A7RWT5_NEMVE          -HALPVAARTLGLLTTNALTPVKEQIISFAMK----------------------------
B3SDE9_TRIAD          -NASLALARGIGFQFLNYLTPLKVICHVIPLY----------------------------
F7B5Q2_CIOIN          -KLPAVVLRTVGSIIFNRLEPIKREVFSYVTL----------------------------
COQ6_DICDI            -SIFVTGLRNFGMSLLNNISPLKNLIIGVSKGESILKFK---------------------
F0ZRQ8_DICPU          -SIAVTALRNFGMSFLNHVPILKNLIVGVSKGNSILNNIK--------------------
D3B5F4_POLPP          -SLPITAIRNLGLTLLDNLSPLKSLIMSISKGTSNLQGIGKEKFKEILQYEKKYVITKPI
B9GMF8_POPTR          -FGPLNILRAAAFHGAHFISPLKRSIISYASGEQRLPLFS--------------------
K7LAM2_SOYBN          -FGPFNILRAAAFHGANYISPLKRSIISYASGEHKLPIFF--------------------
K4CWI3_SOLLC          -FMPINVLRALAFNGAQYISPLKRKIISYASGNQMLPLFT--------------------
F4J6I5_ARATH          -FGPLNALRAAAFHGAHYISPLKKRIISYASGEQSLPLFS--------------------
U5D2V4_AMBTC          -LGPINLLRAAAFHGAQYIGPLKRNIISYATGEQKWPLFG--------------------
C5WT36_SORBI          -FGPLNVVRAAAFHGAQYISPLKKNIISYAMGDTKWPLFR--------------------
K4A8H5_SETIT          -FGPLNVVRAAAFHGAQYISPLKRNIISYAMGDTKWPIFS--------------------
A0A1D6GDN2_MAIZE      -LGPLNVVRAAAFHGAQYISPLKKNIISYATGDTKWSLFQ--------------------
Q851N5_ORYSJ          -FGPLNVLRAAAFHGAQYISPLKKNIISYAMGDAKWPLFS--------------------
I1GL38_BRADI          -FGPLNILRAAAFHSAQYISPLKKNIISYAMGDKKSPLFS--------------------
A9RFL2_PHYPA          -FGPLKYARSFGFNAVHALGPLKKQIISYAMGV---------------------------
D0NQJ6_PHYIT          -PDAVSVARNVGMGTLNAVEPLKNQIMKYAMGL---------------------------
COQ6_YEAST            -FPPVVALRTFGLNLTNKIGPVKNMIIDTLGGNEK-------------------------
Q752C7_ASHGO          -FAPIVAARTFGLNLVDKLGPLKDLIMAKVSGPN--------------------------
C4R280_KOMPG          -FAPLVAARSFGVDVLNSLGPIKDFMVGRISGNSKR------------------------
Q5AHZ4_CANAL          -FYPLVWARGFGMKSINSFGAIKELMMKSISGR---------------------------
Q7SHS8_NEUCR          -SGPLVPLRSLGLNAVNALGPLKSFFMKQAAGSGTKLF----------------------
G2X1S4_VERDV          -SGPLVHLRSLGLNAVNAAGPLKKFIMDQAAGSGARFI----------------------
C7YHL9_NECH7          -SGPLVPLRSVGLRAVNAFGPLKNFFMQQASGTGIKLL----------------------
A7EXF8_SCLS1          -SGPVVWGRTLGLRAVDAMGPLKKFLMGQAAGTGAKIL----------------------
M2UK16_COCH5          -SGPLVGLRSLGLRAVDAMGPLKGFFMSKAAGGS--------------------------
D5GIZ9_TUBMM          -FPPVVAVRSLGLRAVNAMERLKSMIMKQAAGER--------------------------
Q4WQI4_ASPFU          GQGPVTWARSFGLDVIDRLPFVKSFLMKNAQG----------------------------
C8V4E3_EMENI          GQGPVAWGRSLGFEIIDRVPFLKGFLMRNAD-----------------------------
C0NN36_AJECG          GNGPVAWGRSFGLNMVDRLPMLKGFMMKIAAGT---------------------------
F2Z6J4_YARLI          -NPLVVGLRSLGLDAVNSVKPVKDFLMSQAS-----------------------------
COQ6_SCHPO            -NPVVTSVRTLGLSLFDRSASLKNFILSTVANGI--------------------------
Q5KB25_CRYNJ          -NGLVNWVRGTGFDVINELGPIKRILMGGAGSGVGLGGASARTEKEREFGRARAEDKLKP
                              *  .    .    :*                                     

COQ6_DROME            ------------------------------------------------
Q29NU4_DROPS          ------------------------------------------------
Q0IFQ5_AEDAE          ------------------------------------------------
Q7QER0_ANOGA          ------------------------------------------------
A0A088A361_APIME      ------------------------------------------------
E0W075_PEDHC          ------------------------------------------------
E9HGJ4_DAPPU          ------------------------------------------------
COQ6_CAEEL            ------------------------------------------------
A8XV72_CAEBR          ------------------------------------------------
A0A2H2IKS5_CAEJA      ------------------------------------------------
COQ6_DANRE            ------------------------------------------------
W5K4Y2_ASTMX          ------------------------------------------------
W5MYN5_LEPOC          ------------------------------------------------
I3KWA8_ORENI          ------------------------------------------------
A0A087YDN3_POEFO      ------------------------------------------------
G3NYE7_GASAC          ------------------------------------------------
H3DJ31_TETNG          ------------------------------------------------
H2VBJ8_TAKRU          ------------------------------------------------
F1PBF7_CANLF          ------------------------------------------------
M3WSL0_FELCA          ------------------------------------------------
M3YDS0_MUSPF          ------------------------------------------------
COQ6_BOVIN            ------------------------------------------------
H2Q8L0_PANTR          ------------------------------------------------
COQ6_HUMAN            ------------------------------------------------
F6YUG8_CALJA          ------------------------------------------------
A0A096NUG4_PAPAN      ------------------------------------------------
I3MRJ2_ICTTR          ------------------------------------------------
H0VF05_CAVPO          ------------------------------------------------
COQ6_MOUSE            ------------------------------------------------
COQ6_RAT              ------------------------------------------------
F7AKV7_MONDO          ------------------------------------------------
G1KSA9_ANOCA          ------------------------------------------------
COQ6_XENTR            ------------------------------------------------
W4Y3Y9_STRPU          ------------------------------------------------
A7RWT5_NEMVE          ------------------------------------------------
B3SDE9_TRIAD          ------------------------------------------------
F7B5Q2_CIOIN          ------------------------------------------------
COQ6_DICDI            ------------------------------------------------
F0ZRQ8_DICPU          ------------------------------------------------
D3B5F4_POLPP          QIMSDMEGNIK-------------------------------------
B9GMF8_POPTR          ------------------------------------------------
K7LAM2_SOYBN          ------------------------------------------------
K4CWI3_SOLLC          ------------------------------------------------
F4J6I5_ARATH          ------------------------------------------------
U5D2V4_AMBTC          ------------------------------------------------
C5WT36_SORBI          ------------------------------------------------
K4A8H5_SETIT          ------------------------------------------------
A0A1D6GDN2_MAIZE      ------------------------------------------------
Q851N5_ORYSJ          ------------------------------------------------
I1GL38_BRADI          ------------------------------------------------
A9RFL2_PHYPA          ------------------------------------------------
D0NQJ6_PHYIT          ------------------------------------------------
COQ6_YEAST            ------------------------------------------------
Q752C7_ASHGO          ------------------------------------------------
C4R280_KOMPG          ------------------------------------------------
Q5AHZ4_CANAL          ------------------------------------------------
Q7SHS8_NEUCR          ------------------------------------------------
G2X1S4_VERDV          ------------------------------------------------
C7YHL9_NECH7          ------------------------------------------------
A7EXF8_SCLS1          ------------------------------------------------
M2UK16_COCH5          ------------------------------------------------
D5GIZ9_TUBMM          ------------------------------------------------
Q4WQI4_ASPFU          ------------------------------------------------
C8V4E3_EMENI          ------------------------------------------------
C0NN36_AJECG          ------------------------------------------------
F2Z6J4_YARLI          ------------------------------------------------
COQ6_SCHPO            ------------------------------------------------
Q5KB25_CRYNJ          AGGWPMAVANGVEGWFALKGVMGMVGGVVGEAARNGLRRAADALDGKR