CLUSTAL format seed alignment for MF_03198

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EFM6_YEAST            ----------------------------------------------MESI----------
E7QK24_YEASZ          ----------------------------------------------MESI----------
E7KHC1_YEASA          ----------------------------------------------MESI----------
E7KTP1_YEASL          ----------------------------------------------MESI----------
J5P978_SACK1          ----------------------------------------------MDTI----------
G0VHG6_NAUCC          ----------------------------------------------MDGI----------
G0WDI3_NAUDC          ----------------------------------------------MDDI----------
J7S1S8_KAZNA          ----------------------------------------------MNEI----------
Q6FJE7_CANGA          ----------------------------------------------MEDI----------
H2AZI3_KAZAF          ----------------------------------------------MNEV----------
Q6CP15_KLULA          ----------------------MSLLEVLTRDRKERTVLETCKAFIMGDVP---------
Q75AY2_ASHGO          ----------------------------------------------MTET----------
G8JRP9_ERECY          ----------------------------------------------MTDV----------
C5DMN9_LACTC          ----------------------------------------------MAELLD--------
Q6C9L2_YARLI          ----------------------------------------------MEILQI--------
A0A0B1P713_UNCNE      -------------------------MQRLGVCVIIIILIANKNQPKMQSSSNDDV-----
K1X0N5_MARBU          -------------------------------------MSSRSVSPEFSPRAMD-------
L8G153_PSED2          -------------------------------------MISRVPSPEFLPLSIG-------
M7UC15_BOTF1          ------------------------------------MTSSRSPSPEFSPLAIG-------
G2XXP1_BOTF4          ------------------------------------MTSSRSPSPEFSPLAIG-------
N1JDZ6_BLUG1          ------------------------------------MTTASTLMPDDELLAIG-------
V6RQR4_GIBZE          -------------------------------------MSSPPSSPLMDPVT---------
K3UUC8_FUSPC          -------------------------------------MSSPPSSPLMDPVT---------
F9FJQ3_FUSOF          -------------------------------------MSSPPSSPLMDPVT---------
N4UFW0_FUSC1          -------------------------------------MSSPPSSPLMDPVT---------
N1RAG4_FUSC4          -------------------------------------MSSPPSSPLMDPVT---------
S0E0M6_GIBF5          -------------------------------------MSSPPSSPLIDAVT---------
W7LZF3_GIBM7          -------------------------------------MSSPPSSPLMDAVT---------
C7YS03_NECH7          -------------------------------------MSSPPSSPLMDPVA---------
G9MJ65_HYPVG          -------------------------------------MDSRSSSPDLDPVAG--------
G0RT91_HYPJQ          -------------------------------------MDSRSSSPDLDPVAG--------
G9PBB1_HYPAI          -------------------------------------MESRSPSPPLDPVAG--------
E9DY77_METAQ          --------------------------------------MSRSPSPLLDPVA---------
E9ET70_METRA          --------------------------------------MSRSPSPLLDPVA---------
M1W8T0_CLAP2          --------------------------------------MSRPSSPPLDPLV---------
T5A6T5_OPHSC          --------------------------------------MSRSPSPQLDPIA---------
J4W6K1_BEAB2          -------------------------------------MGDLAASPPLGAIH---------
G0SD92_CHATD          -----------------------------------MTEKKQTPSPEFSPLG---------
G2QAG8_MYCTT          -----------------------------------MDDKERSPSPEFSPLA---------
Q2HGY2_CHAGB          -----------------------------------MSEQEISSSPEFSPLA---------
G2QWP9_THITE          -----------------------------------MTNGDRSPSPEFDPLA---------
B2B475_PODAN          -----------------------------------MNGRSRSSSPEISPLD---------
V5ILY6_NEUCR          -----------------------------------MSARSRSSSPEFDPLA---------
G4UGZ5_NEUT9          -----------------------------------MSARSRSSSPEFDPLA---------
F7W4K1_SORMK          -----------------------------------MSARSRSLSPEFDPLA---------
T0LLH1_COLGC          -----------------------MRILNNPLIPEQMDSAERSPSPEFSPLA---------
L2FMX8_COLGN          -----------------------MRILNNPLIPEQMDSAERSPSPEFSPLA---------
N4VLN2_COLOR          -----------------------MRILNIPLIPEKMDSADRSPSPEFSPLA---------
G2WR35_VERDV          -----------------------MKILDSPLAAALHPAA----SPEFSPLA---------
A0A0C4E4R7_MAGP6      ------------------------MKQQLASCIMAIDSDQRPESPEFSPLA---------
J3NGK6_GAGT3          ---------------------------------MAIDSSRRSESPEFSPLA---------
U7Q390_SPOS1          -----------------------------------MATASRASSLELNPLSVGDLHYHYG
S3D8R6_OPHP1          ------------------------------------MAVSPDSSPELNPLSLGDLKYQYG
F0XCP8_GROCL          ----------------------------MESIVHRGAQPSPTSSPELNPLRLGDRGSRS-
A0A0A2JGC8_PENEN      --------------------------------MIEIPMPTLPGPDLSPPSS---------
A0A0A2L210_PENIT      --------------------------------MIEIPMPTLSDSESSPPSS---------
B6HFD0_PENRW          --------------------------------MIETPMTTPPGPELSPPSS---------
K9FRE1_PEND2          --------------------------------MSNLPGPQ-SSPQSSPPSS---------
S8B5I5_PENO1          --------------------------------MSRSP---------SPDTV---------
A1CGP6_ASPCL          --------------------------------------MEDISSNPPFPD----------
Q4WNI7_ASPFU          ------------------------------MGAKILPMEATIPDKPSSPNL---------
B8NZ42_ASPFN          -------------------------------------MMEASNSPDQQSVL---------
Q2UG14_ASPOR          -------------------------------------MMEASNSPDQQSVL---------
A2QHJ3_ASPNC          --------------------------------------------------M---------
G3Y9U3_ASPNA          --------------------------------------------------M---------
C8V996_EMENI          --------------------------------------MEDIHPGSATSD----------
V5FDS0_BYSSN          --------------------------------------MAD-RGDSGDSDQ---------
B6Q2Q4_TALMQ          ----------MEETNVASPAQQRIPNTIEDAEITNTYFSFTEPSSPADDPD---------
B8LTP5_TALSN          ----------MEETNLASPAQHQPPNTTGDAEITNTYSSST--GSPADDSD---------
C1H9Q5_PARBA          --------------------------------------MGETDLFTVS------------
C1GD53_PARBD          --------------------------------------MGETDLFTES------------
C6H7R2_AJECH          --------------------------------------MGEIDLPTES----AEQ-----
F0U4L8_AJEC8          --------------------------------------MGEIDLPTES----AEQ-----
C0NIE5_AJECG          --------------------------------------MGEIDLPTES----AEQ-----
C5G876_AJEDR          --------------------------------------MGEIDHSAEATLVLSEP-----
F2SCS7_TRIRC          --------------------------------------MGDIAELASA------------
F2PNY9_TRIEC          --------------------------------------MGDIAEPVSA------------
E5R1Z7_ARTGP          --------------------------------------MGDIAEQASA------------
C5FCB2_ARTOC          --------------------------------------MGDIGEQSPD------------
E9CVE6_COCPS          -------------------------------MDHEDRIIPNQNSSPTE------------
B2W1N4_PYRTR          -------------------------------------------MLDSEEND---------
E3RCY5_PYRTT          -------------------------------------------MLDSEEND---------
M2VCS7_COCH5          -------------------------------------------MLELDG-----------
M2STR1_COCSN          -------------------------------------------MLELDG-----------
R0JY20_SETT2          -------------------------------------------MLDLDG-----------
E5R4I7_LEPMJ          -------------------------------------------MSDSEESS---------
R1ENU5_BOTPV          ------------------------------------------MADDD--GF---------
R7YLR4_CONA1          ------------------------------------------MENDDDTNY---------
M3B4T7_PSEFD          ----------------------------------------MPWSDSESDAG---------
N1PM93_DOTSN          --------------------------------------MSTLAREFEADAN---------
M3BQA6_SPHMS          ----------------------------------------------MSDLG---------
H6BVP9_EXODN          -------------------------------------MSASRS---PSPEN---------
U1GT42_ENDPU          -------------------------------------MAEEHSYQLSLTEH---------
S8B9D4_DACHA          ------------------------------------MAETRARSSSLSSLDPT-------
U4LLQ3_PYROM          ---MHVTLHGPTLNIPHYIPNSLVNFWQLHAQLSSIQLSTNSSSAPPSSQAPC-------
F4P186_BATDJ          ----------------------------MSILTNIFHRDSDSSELSISDHS---------
S2J6R2_MUCC1          -------------------------------------------MSSITEQP---------
A0A0D1E1Y5_USTMA      ---MPSTQ-AADDVRAELEREE---------ELDLVDPLRHFLAVDDDEQGQLHDATHSA
R9NWX4_PSEHS          ---MPSDL-TPTDVQSELIREE---------QLDLVDPLRHFLAMNDEP---------SP
V5GR85_KALBG          ---MPTTQQSQDDVRAELEREE---------ALDLADPLRHFLAIDDDEP-----SASSS
M9LSR4_PSEA3          -MATVVDTSASHDVRAELERQE---------ALDLADPLRHFLIVDEAVP---------G
M5E9B2_MALS4          ------------------------------------MATRWLFGTSEDE-----------
Q5KN92_CRYNJ          ------------------------------------------------------------
G7E6F6_MIXOS          ---------------------------------MLGGLVAGIEAGDDDEG----------
A0A060SIR3_PYCCI      --------------MLDLALEE---------QLDELDPLRHLR----QDASD--------
M2R9C0_CERS8          --------------MLDLALEE---------KLDELDPLRHLR----EDD----------
S8DTD8_FOMPI          --------------MLDLALEE---------KLDELDPLRHLR----DDPDP--------
S8DXL2_FOMPI          --------------MLDLALEE---------TLDELDPLRHLR----DDPDP--------
K5WJK8_PHACS          -------------MASELELEE---------QFDTLDPLRHLR----NGGE---------
F8PQG3_SERL3          -MGAPANDIPSYPTLNEIAQDE---------ALDALDPLRHLRN---DDHDT--------
B0CRW5_LACBS          --------------------------------------------M--ASSSP--------
A8NWW4_COPC7          -----MGLVVEPGVNAELEVEE---------EQDLKDPLRHLMDT--EESIV--------
V2XMR1_MONRO          MAQLVDEDDTRHGDRVDEDEYQ---------ISDDEDPLKQLRIVNGDENTG--------
K5W0U2_AGABU          --------------MLKGSRKS---------QSE--------------------------
B8PMJ3_POSPM          --------------MADLLREE---------TLDDLDPLRHLRGS---------------
B8P3X1_POSPM          --------------MADLLREE---------NLDDLDPLRHLRGS---------------
G4TKF2_SERID          ------------MSDSDLSEQE---------RLDNLDPLRHFR-----------------
M5FRR8_DACPD          --------------MAEILREEE--------RLDELDPLRHLRDNDADAAG---------
D8PKW2_SCHCM          ----------MSSHLEVIPDEEVGRERELEENLDYADPLRHLMHGADDFSDD--------
I4YC93_WALMC          -------------MREDIENEE--------------------------------------
R4XA11_TAPDE          -------------------------------MLDDDDTRVEYDFFPEDDDDD--------
                                                                                  

EFM6_YEAST            ----------FGG-FGDLVVPR--------PKE-HLGQTDLSFGGKLL------------
E7QK24_YEASZ          ----------FGG-FGDLVVPR--------PKE-HLGQTDLSFGGKLL------------
E7KHC1_YEASA          ----------FGG-FGDLVVPR--------PKE-HLGQTDLSFGGKLL------------
E7KTP1_YEASL          ----------FGG-FGDLVVPR--------PKE-HLGQTDLSFGGKLL------------
J5P978_SACK1          ----------FGG-FEDLVVPR--------ATE-HLGQTDLSFGGKLL------------
G0VHG6_NAUCC          ----------FGD-FEGLVVPR--------PVE-HLGNSDLSFGGKLR------------
G0WDI3_NAUDC          ----------FGSGFDDLVVAR--------PLE-HLGNSDLSFGGRLK------------
J7S1S8_KAZNA          ----------FGS-FGDLVVAR--------PIE-HCGSHDMSFGGRLN------------
Q6FJE7_CANGA          ----------LGF--GDLIESR--------PVE-HMGQSDLTFNGMLV------------
H2AZI3_KAZAF          ----------FGE-YVGLIDTR--------PIE-HLGSADLSFDGQLS------------
Q6CP15_KLULA          ----------FSSCFEELVPAR--------PIE-HLGKIDMSFNGKLP------------
Q75AY2_ASHGO          ----------FTAVFEDLVEPR--------PIE-HLGQSDLSYQGQLD------------
G8JRP9_ERECY          ----------FASVFEELVPTP--------PIE-HLGASDLSFQGRLD------------
C5DMN9_LACTC          ----------FTAQFTDLVPSR--------PLE-HFGDSDLTFGGRIF------------
Q6C9L2_YARLI          ----------ETEVLPAAVVDV--------PERLNLGRSNLNFDGLLKG-----------
A0A0B1P713_UNCNE      -------IDYSLFVREDLTPIP---------SYKTASTISHHFTNLL-------------
K1X0N5_MARBU          ---------------EDLAPVP---------AYKSASTTSIDFSGLL-------------
L8G153_PSED2          ---------------EDLTPLP---------VYKAASTTSIDFDGLL-------------
M7UC15_BOTF1          ---------------TDLAPLP---------TYKAATTGTVNFSGLL-------------
G2XXP1_BOTF4          ---------------TDLAPLP---------TYKAATTGTVNFSGLL-------------
N1JDZ6_BLUG1          ---------------EELTPLP---------TYKLASTTLLSFDNLL-------------
V6RQR4_GIBZE          -------------ISEDIAPLP---------SFKASGVADVDFDGVL-------------
K3UUC8_FUSPC          -------------ISEDIAPLP---------SFKASGVADVDFDGVL-------------
F9FJQ3_FUSOF          -------------ISEDIAPLP---------SFKASGVATVDFDGVL-------------
N4UFW0_FUSC1          -------------ISEDIAPLP---------SFKASGVATVDFDGVL-------------
N1RAG4_FUSC4          -------------ISEDIAPLP---------SFKASGVATVDFDGVL-------------
S0E0M6_GIBF5          -------------ISEDIAPLP---------SFKASGVATVDFDGVL-------------
W7LZF3_GIBM7          -------------ISEDIAPLP---------SFKASGVATIDFDGVL-------------
C7YS03_NECH7          -------------ISEDLTPLP---------TLKEIGVAQVDFDGVL-------------
G9MJ65_HYPVG          -------------ITEDLVSLP---------TYKEAGDASLDFDGLL-------------
G0RT91_HYPJQ          -------------ITEDLVSLP---------ASKVAGDTNIDFDGLL-------------
G9PBB1_HYPAI          -------------VTEDLVSLP---------NSKTAGDTNIDFDGLL-------------
E9DY77_METAQ          -------------VSEDLTPLP---------TLKQAGDARIDFDGQL-------------
E9ET70_METRA          -------------VSEDLTPLP---------TLKQAGDARIDFDGQL-------------
M1W8T0_CLAP2          -------------VSEDLTPLP---------DLKSAGNAHIDFDGQL-------------
T5A6T5_OPHSC          -------------VSEELAPLP---------SLKQAGSDTIDFDGQL-------------
J4W6K1_BEAB2          -------------ISEDFAPLP---------ELKPAGNTDITFDGQL-------------
G0SD92_CHATD          -------------FDEDIAPLP---------EYKAAGTTEVDFSGLL-------------
G2QAG8_MYCTT          -------------FGEDLAPLP---------EYKAAGTTEVDFSGLL-------------
Q2HGY2_CHAGB          -------------FGEDLAPLP---------EYKEAGTTQVDFSGLL-------------
G2QWP9_THITE          -------------FGDDLAPLP---------EYKAAGTTEVDFSGLL-------------
B2B475_PODAN          -------------FGEDLAPLP---------VYKAAATTALDFSGLL-------------
V5ILY6_NEUCR          -------------FDQDFTPLP---------EYKAPTDTALDFGGLL-------------
G4UGZ5_NEUT9          -------------FDQDFTPLP---------EYKAPTDTALDFGGLL-------------
F7W4K1_SORMK          -------------FDQDFTPLP---------EYKAATDTALDFNGLL-------------
T0LLH1_COLGC          -------------IGEDLTPLP---------AYKAAQTNSFDIAGLL-------------
L2FMX8_COLGN          -------------IGEDLTPLP---------AYKAAQTNSFDIAGLL-------------
N4VLN2_COLOR          -------------IGEDLTPLP---------AYKAAQTSSFDIFGLL-------------
G2WR35_VERDV          -------------LAEDFTPLP---------AYKAAQTSNFDISGLL-------------
A0A0C4E4R7_MAGP6      -------------IDADLTPLP---------EYKKAGTTTLDFDGLL-------------
J3NGK6_GAGT3          -------------IDADLTPLP---------EYKEAGTTTLDFDGLL-------------
U7Q390_SPOS1          DNASDAGSRNGDTDKDAIAPLP---------QYKAAGETVVGFDGLLK------------
S3D8R6_OPHP1          DNDSDRGSRNGDRDVDAIAPLP---------EYKAAGETIVDFDGLLK------------
F0XCP8_GROCL          DND-------TDTDSDVLAPLP---------EYKAAGETVLDFDGLLR------------
A0A0A2JGC8_PENEN      --------PDGLRVSESLAPPR---------ELKAAVTTDISFDGLL-------------
A0A0A2L210_PENIT      --------PGGLRISESLAPPR---------ELKAAVTTDISFDGLL-------------
B6HFD0_PENRW          --------PDGLKISESLAPPR---------ELKAATTTDISFDGLL-------------
K9FRE1_PEND2          --------PDGFKISESLAPPR---------ELKAAVTTDITFDGLL-------------
S8B5I5_PENO1          --------LNAPLVSSSLAPPR---------DIKSAGTTRIDFDGLL-------------
A1CGP6_ASPCL          --------VANFNVSESLVPPQ---------ELKSAGNSSVTFDGLL-------------
Q4WNI7_ASPFU          --------VAAFDVSEHLVPVR---------ELKPAGNTLVSFDGLL-------------
B8NZ42_ASPFN          --------SESILVSESLVPAR---------DLKGVGHAEISFDGLL-------------
Q2UG14_ASPOR          --------SESILVSESLVPAR---------DLKGVGHAEISFDGLL-------------
A2QHJ3_ASPNC          --------DDSLDIDESLIPVR---------DLKPASQSTISFDGML-------------
G3Y9U3_ASPNA          --------DDSLDIDESLIPVR---------DLKPASQSTISFDGML-------------
C8V996_EMENI          ---------DPLDISESLVPAR---------EIKQAGQSYVSFDGLL-------------
V5FDS0_BYSSN          --------DSPFAISESLVPPR---------ELKSAGATNIDFDGLL-------------
B6Q2Q4_TALMQ          --------NSQLLIGESLIPVR---------ERRHAGTTVVSIDGLL-------------
B8LTP5_TALSN          --------NSQLLIGESLIPER---------ERKHAGTTVVTIDGLL-------------
C1H9Q5_PARBA          --------PLPLAISESLVPVR---------ETKTAGTALLSLDGLL-------------
C1GD53_PARBD          --------PLPLAISESLVPVR---------ESKAAGTALLSLDGLL-------------
C6H7R2_AJECH          --------VFPLAISESLVPVR---------ESKTAGTVLLSLDGLL-------------
F0U4L8_AJEC8          --------VFPLAISESLVPVR---------ESKTAGTVLLSLDGLL-------------
C0NIE5_AJECG          --------VFPLAISESLVPVR---------ESKTAGTVLLSLDGLL-------------
C5G876_AJEDR          --------DFPLAISESLVPVR---------ENKTAGTVLLSLDGLL-------------
F2SCS7_TRIRC          ----------P--VLDSLVPPR---------EIQCAGTSTVSLDDIL-------------
F2PNY9_TRIEC          ----------P--VLDSLVPPR---------EIQCAGTSTVSLDGIL-------------
E5R1Z7_ARTGP          ----------P--ELDFLVPPR---------EIQCAGTSTVSLDGIL-------------
C5FCB2_ARTOC          ----------QPLVSDSLVPPR---------EIQCACTSTVSLDGIL-------------
E9CVE6_COCPS          ----------ELAISESLVPAR---------EIKLATTLQFTFDGLL-------------
B2W1N4_PYRTR          ----------FFGVSQDLVPPA---------PIKSAGVSEVDFDGLL-------------
E3RCY5_PYRTT          ----------FFGVSQDLVPPA---------PIKSAGVSEVDFQGLL-------------
M2VCS7_COCH5          -----------FAVSQDLVPAA---------PIKSAGVSKVDFDGLL-------------
M2STR1_COCSN          -----------FAVSQDLVPAA---------PIKSAGVSKVDFDGLL-------------
R0JY20_SETT2          -----------FAVSQDLVPPA---------PIKSAGISKVDFDGLL-------------
E5R4I7_LEPMJ          ----------LFGVSQDLVPPA---------PIKAAGVSEVDFDGLL-------------
R1ENU5_BOTPV          ----------LSSFSTDFVQLP---------QYKAAGTSAVDFDGLL-------------
R7YLR4_CONA1          ----------KFGVSEDLVQSP---------AHKTAGASSIDFDGLL-------------
M3B4T7_PSEFD          ----------AFVLSEDLVQSP---------SHKAASTKTVDFGGLL-------------
N1PM93_DOTSN          ----------GCGVSEDFVHSR---------EHKAAGEKSIDFDGLL-------------
M3BQA6_SPHMS          ----------DFGLSEDLVTSP---------THKPKATKSVDFDGLL-------------
H6BVP9_EXODN          ---------DVFAMATNLVPER---------ENKTAATTSLTFDGLLP------------
U1GT42_ENDPU          ---------DPLPGLESFVPVR---------ASKPPSTTTISFNDLL-------------
S8B9D4_DACHA          ---------EFKFP-QGLVPER--------ENLPAGRVTTTTLDGTLT------------
U4LLQ3_PYROM          ---------TLTQPIMDLFGDGSFVGDDLVAPAPIMEAKITSADFGLL------------
F4P186_BATDJ          ----------DCSVQYDLAPAS-------IEPRIGTLHTHLISHAPS-------------
S2J6R2_MUCC1          ----------VPAFGTFNYIVE-------REQEVKAHTGSIAFNGLS-------------
A0A0D1E1Y5_USTMA      SHKTADVREPGSNTKYRIVPHQ--------IESIIDRRTSIRYYCDLSRRPELIDDAVQS
R9NWX4_PSEHS          PPTSSDVRDLPSSTDYSIVPQQ--------IESIIDRRTTIRYYQDLSRKPVLIDEQHPA
V5GR85_KALBG          TLPSTDIRDLPSETNYSLVPQQ--------LESIIDRRTTIRYYSDLSRRPVLLDSPTTE
M9LSR4_PSEA3          PLDTSDIRDLPSSSDYSIVPTQ--------LESIIDQRTTIRYYSDLARRPRLVDSHSSD
M5E9B2_MALS4          LPPSPDL-----EPTDDVVPDQ--------LPSLLGEKACIVYYTDGAREPTTMTGSACS
Q5KN92_CRYNJ          ------------MLESTERAHS--------RSSSVSSTAALPSFEDLAPPRPPLTGGEQE
G7E6F6_MIXOS          -------------DEDAIVPAQ--------GPS--VKRQTICFDESFPSAAP--------
A0A060SIR3_PYCCI      -----D-----EHSPNSIVPHQ--------PPSIRN--QTIRLAFPSS--PDR-------
M2R9C0_CERS8          ---------------EVVVPAQ--------PPSVRD--QVIELSYPTY--TGDV------
S8DTD8_FOMPI          -----DSGDRAHTSSDNIVPAQ--------LPSILN--QTIELMFPCS--TSANLHE---
S8DXL2_FOMPI          -----DSGDRAHSSSDSIVPAQ--------LPSILN--QTIELRFPCS--SSANLHA---
K5WJK8_PHACS          ---------------LGLVPAQ--------PPSIHN--EDLQLAFPSA--GGRV------
F8PQG3_SERL3          -----FGGTHGELEADPVVPAQ--------PRSIFD--QTLHLSFSDT--TQQN------
B0CRW5_LACBS          -----STTSSSSSDLLVVLPHQ--------SHSISN--GIFHLSFSHP--WQTL------
A8NWW4_COPC7          -----TVPPSCHTHLLSFLPSQ--------SNFLDEKGGTLKLSFSHH--WDSI------
V2XMR1_MONRO          -----TSNLTRSELVSGVLPGQ--------HYSLQD--KTLILAFSNQECNQPGDTE---
K5W0U2_AGABU          --------------LLSVLPHQ--------HFSESN--GVLDLTFSIS------------
B8PMJ3_POSPM          -------ADADDADDADLVPAQ--------PPSILD--QTIELTFPSDAS----------
B8P3X1_POSPM          -------ADADDADDTDLVPAQ--------PPSILD--QTIELTFPSDPS----------
G4TKF2_SERID          ------------VEDESILPSQ--------PPSTKE--QIQSFNYGS-------------
M5FRR8_DACPD          -------NTDEGISDGFIVPAQ--------RPSIIN--QLQILSFPV-------------
D8PKW2_SCHCM          -----GEGDDGPHADATVLPAQ--------RPSILG--DTITLTFPDSVAHVGA------
I4YC93_WALMC          --------------MILPVPDS--------SDEETSIEPVASLQSVQV------------
R4XA11_TAPDE          -------------GPKITDTGA--------TPGVKFSDSTYAVDVTSS------------
                                                                                  

EFM6_YEAST            -------------PALKICEDGGESGCGGKVWIAGELLCEYILEKS-VDHLLSKTVNGT-
E7QK24_YEASZ          -------------PALKICEDGGESGCGGKVWIAGELLCEYILEKS-VDHLLSKTVNGT-
E7KHC1_YEASA          -------------PALKICEDGGESGCGGKVWIAGELLCEYILEKS-VDHLLSKTVNGT-
E7KTP1_YEASL          -------------PALKICEDGGESGCGGKVWIAGELLCEYILEKS-VDHLLSKTVNGT-
J5P978_SACK1          -------------PALKICEDGGESGCGGKVWIAGELLCEYILEKS-LHHLLSEATHGR-
G0VHG6_NAUCC          -------------SPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGE
G0WDI3_NAUDC          -------------NPLKIHEDGGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNS-
J7S1S8_KAZNA          -------------PALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKV
Q6FJE7_CANGA          -------------PGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRDGELLKDWINDDS
H2AZI3_KAZAF          -------------PAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDSENLLCD------
Q6CP15_KLULA          -------------SPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDG-
Q75AY2_ASHGO          -------------PPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYE-
G8JRP9_ERECY          -------------PPLKIYEDGGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNG-
C5DMN9_LACTC          -------------PALKIHEDGGESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLG
Q6C9L2_YARLI          -------------DGLKIEEDGGAAGCGGKLWPAGEMLAYYLLRKG--------------
A0A0B1P713_UNCNE      ------------TTPIQLHEDL-KSGCGGQLWPAGMVLAKHMLRYHK--NSLTEAR----
K1X0N5_MARBU          ------------ESPLQLHEDL-KSGCGGQLWPAGMVLAQQMLRYHR--TSLRKAR----
L8G153_PSED2          ------------TAPLQLHEDL-KGGCGGQLWPAGMVLSKYMLREHK--HDLKYAT----
M7UC15_BOTF1          ------------EPPLKLHEDL-SKGCGGQLWPAGMVLAQHMLRYHK--DDLRDAK----
G2XXP1_BOTF4          ------------EPPLKLHEDL-SKGCGGQLWPAGMVLAQHMLRYHK--DDLRDAK----
N1JDZ6_BLUG1          ------------DPPLKLHEDL-SAGCGGQLWPAGMVLAKHLLRYHS--EAMARAR----
V6RQR4_GIBZE          ------------SKPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLVDAQ----
K3UUC8_FUSPC          ------------SKPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLVDAQ----
F9FJQ3_FUSOF          ------------SSPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLADAR----
N4UFW0_FUSC1          ------------SSPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLADAR----
N1RAG4_FUSC4          ------------SGPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLADAR----
S0E0M6_GIBF5          ------------SSPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLADAR----
W7LZF3_GIBM7          ------------SSPLKVHEDV-RSGCGGQTWPAGMLLGKHMLRYHK--DRLADAR----
C7YS03_NECH7          ------------SQSLKLREDV-RSGCGGQTWPAGMLLGKHMLRYHR--DRLNNAR----
G9MJ65_HYPVG          ------------AQPIQLREDL-RTGCGGQTWPAGMVLGKHMLRYHR--SKLETAR----
G0RT91_HYPJQ          ------------AQPIKLREDV-RTGCGGQTWPAGMVLGKHMLRYHR--SELANAR----
G9PBB1_HYPAI          ------------AQSIKLHEDV-RTGCGGQTWPAGMVLGKHMLRYHR--ATLETAR----
E9DY77_METAQ          ------------SEPLAYHEDV-RTGCGGQTWPAGLVLGKHMLRYHR--QEMRTAR----
E9ET70_METRA          ------------PEPLAYHEDV-RTGCGGQTWPAGLVLGKHMLRYHR--QEMRTAR----
M1W8T0_CLAP2          ------------STPLEYHEDV-RTGCGGQTWPAGLVLGKHLLRYHR--EKMQNAR----
T5A6T5_OPHSC          ------------DRPLKYHQDV-RAGCGGQMWPAGLVLAKHMLRYRR--REIQDAT----
J4W6K1_BEAB2          ------------ARPLRLREDL-RTGCGGQTWPAGMVLGKHMLRYHR--HELQHAR----
G0SD92_CHATD          ------------GEPLKLHEDL-RSGCGGQLWPAGMVLAKHMLRYHR--EKLQSAR----
G2QAG8_MYCTT          ------------GEPLKLHEDL-KSGCGGQLWPAGMVLAKHMLRYHR--ERLQSAR----
Q2HGY2_CHAGB          ------------DEPLKLHEDL-KSGCGGQLWPAGMVLAKHMLRYQR--DKLQPAR----
G2QWP9_THITE          ------------GEPLKLHEDL-RSGCGGQLWPAGLVLAKHMLRYHR--DELQHAR----
B2B475_PODAN          ------------DEPLKLHEDL-SSGCGGQLWPAGMVLAKHMLHYHR--DKLQTSR----
V5ILY6_NEUCR          ------------PEPLKLHEDL-KTGCGGQLWPAGMTLAKHMLRYHG--DKLQKAR----
G4UGZ5_NEUT9          ------------PEPLKLHEDL-KTGCGGQLWPAGMTLAKHMLRYHG--DKLQKAR----
F7W4K1_SORMK          ------------PEPLKLHQDL-RTGCGGQLWPAGMTLAKHMLRYHA--DKLQKAR----
T0LLH1_COLGC          ------------STPLKLHEDL-ASGCGGQTWPAGMVLAKHMLRYHR--EALTGAR----
L2FMX8_COLGN          ------------STPLKLHEDL-ASGCGGQTWPAGMVLAKHMLRYHR--EALTGAR----
N4VLN2_COLOR          ------------SNPLKLHEDL-ASGCGGQTWPAGMVLAKHMLRYHR--GALKDAR----
G2WR35_VERDV          ------------ATPLKLHEDL-TSGCGGQTWPAGMVLAKHMLRYHR--EEMGNAR----
A0A0C4E4R7_MAGP6      ------------SAPLRLREDL-SSGCGGQLWPAGMVLATHMLRYHQ--DKLGDAR----
J3NGK6_GAGT3          ------------SAPLQLHEDL-SSGCGGQLWPAGMVLATHMLRYHR--DRLADAR----
U7Q390_SPOS1          -----------PAPDLRLLEDL-SEGCGGQLWPAGMILAKHMLRYHR--DDMAHAR----
S3D8R6_OPHP1          -----------PAPDLRLREDL-SEGCGGQTWPAGLVLGKHMLRYRR--AEMANAR----
F0XCP8_GROCL          -----------PAPALRLREDL-TEGCGGQTWPAGMVLARHLLRHRR--AEMETAR----
A0A0A2JGC8_PENEN      ------------KEPLLLKEDL-KDGCGGQLWPAGMALAKYLLSRHT-TDLSDKT-----
A0A0A2L210_PENIT      ------------KEPLLLKEDL-KDGCGGQLWPAGMTLAKYLLSRHA-ADLSDKT-----
B6HFD0_PENRW          ------------KEPLLLKEDL-KDGCGGQLWPAGMALAKYLLSRHA-ADLSDKT-----
K9FRE1_PEND2          ------------KEPLLLKEDL-KDGCGGQLWPAGMVLAKYLLSRHA-TDLSDKT-----
S8B5I5_PENO1          ------------REPLLLKEDL-KNGCGGQLWPAGMVLSKYMLSRHA-TDMAGKT-----
A1CGP6_ASPCL          ------------EEPLVLKEDL-KEGCGGQLWPAGIVLAKYMLRKHR-QDLFDKT-----
Q4WNI7_ASPFU          ------------EEPLILKEDL-KEGCGGQLWPAGIVLAKYLLRQHR-NNLSNKT-----
B8NZ42_ASPFN          ------------KDPLIIKEDL-KEGCGGQLWPAGMVLARYLLLQHR-SDFNNKT-----
Q2UG14_ASPOR          ------------KDPLIIKEDL-KEGCGGQLWPAGMVLARYLLLQHR-SDFNNKT-----
A2QHJ3_ASPNC          ------------SNPLLLQEDL-KEGCGGQLWPAGMVLSKYLLRQHH-SSFLGKT-----
G3Y9U3_ASPNA          ------------SNPLLLQEDL-KEGCGGQLWPAGMVLSKYLLRQHH-SSFL--------
C8V996_EMENI          ------------QRPLLLKEDL-KEGCGGQLWPAGMVLAKYMLRQHR-FSLADKT-----
V5FDS0_BYSSN          ------------SEPLVLQEDL-KEGCGGQLWPAGIVLSKYMLRRHK-SDLR--------
B6Q2Q4_TALMQ          ------------KEPLQLKEDL-KEGCGGQLWPAGLLLSRYMLEEHA-TDLVGKT-----
B8LTP5_TALSN          ------------KDPLRLKEDL-KNGCGGQLWPAGLLLSRYMLEEHA-TDLVGKT-----
C1H9Q5_PARBA          ------------DPPLQIKEDL-KEGCGGKLWPAGVVLAKYMLRRHK-SDLSGKT-----
C1GD53_PARBD          ------------DPPLQIKEDL-KEGCGGKLWPAGVVLAKYMLRRHK-SDLGGKT-----
C6H7R2_AJECH          ------------EPPLQINEDL-KEGCGGQPWPAGIVLAKYMLRKHK-FDLCGKI-----
F0U4L8_AJEC8          ------------EPPLQINEDL-KEGCGGQPWPAGIVLAKYMLRKHK-FDLCGKI-----
C0NIE5_AJECG          ------------EPPLQINEDL-KDGCGGQPWPAGIVLAKYMLRKHK-FDLCGKI-----
C5G876_AJEDR          ------------TPPLQIKEDL-KDGCGGKLWPAGMVLAKYMLRKHK-SDLRGKV-----
F2SCS7_TRIRC          ------------NPPLQLREDL-RNGCGGQIWPAGVVLSKYMIENHT-AGLQGKT-----
F2PNY9_TRIEC          ------------NPPLQLREDL-RNGCGGQIWPAGVVLSKYMIENHA-AGLRGKT-----
E5R1Z7_ARTGP          ------------NPPIQLREDL-RNGCGGQIWPAGVVLSKYMIENHA-ADLQGKT-----
C5FCB2_ARTOC          ------------NPPLQLREDL-KEGCGGQIWPAGVVLSKYMIENHA-SDLLGKT-----
E9CVE6_COCPS          ------------NPPLQLREDP-KEGCGGHIWPAGMVLSKYMLRKHS-EDLLGKR-----
B2W1N4_PYRTR          ------------SPPLRLEEDL-KNGCGGQLWPAGMVLSKYMLRKHR-EDVAGKT-----
E3RCY5_PYRTT          ------------SPPLRLEEDL-TNGCGGQLWPAGMVLSKYMLRKHR-DEVAGKT-----
M2VCS7_COCH5          ------------SPPLSLHEDL-KNGCGGQLWPAGMVLSKYMLRKHR-DDVAGKE-----
M2STR1_COCSN          ------------SPPLSLHEDL-KNGCGGQLWPAGMVLSKYMLRKHR-DDVAGKE-----
R0JY20_SETT2          ------------SPPLSLHEDL-KNGCGGQLWPAGMVLSKYMLRRHR-DDVAGKK-----
E5R4I7_LEPMJ          ------------SPPLKLHEDL-RNGCGGMLWPAGMVLGKYMLRKDG-SELADKV-----
R1ENU5_BOTPV          ------------APPLKLHEDL-AGGCGGQLWPAGMVLSRYLLRQHA-HALHGRS-----
R7YLR4_CONA1          ------------STPLKLQEDL-AEGCGGQLWPAGMVLSKYLLRNHR-NTMKGRT-----
M3B4T7_PSEFD          ------------TPPLLLHEDL-ADGNGGQAWPAGMILTRYLLRRKR-SDLQNAS-----
N1PM93_DOTSN          ------------SPPLILHEDV-TNGNGGQAWIAGMILTKYLLRMRR-KELQHAS-----
M3BQA6_SPHMS          ------------TPPLLLHEDL-AKGNGGQAWPAGMILAKYVLRKKQ-DELQKASS----
H6BVP9_EXODN          -----------DSAPLLLHEDL-QEGCGGQLWPAGMVLAKYMLTYHKTQSLLGKS-----
U1GT42_ENDPU          ------------QPPLLLHENL-KQGCGGQLWPAGMVLARYMLHAHR-HNIADKT-----
S8B9D4_DACHA          ------------KTPLKLIEDL-TNGCGGQLWPAGVRLAKYFINRYRDNNDLAGKR----
U4LLQ3_PYROM          ------------EKPILIHEDL-AKGCGGMIWPAGEVLTKWVLKKYMGTTELRGKR----
F4P186_BATDJ          -------------RSITIHEDT-AGGCGGRTWPAATILSNYISHR----RLLGT-FPYSR
S2J6R2_MUCC1          -------------DPILLAQDM-SGGCGGKIWKCANVMIDYFIWKND--QLNGTLFKDQK
A0A0D1E1Y5_USTMA      DAHLEN----VRWWDVHLKLDM-TSGCGGKIWPAAEVLGAYIAGKYSCP-ADAPEDRTPT
R9NWX4_PSEHS          PDGDAG----KEWWDVHLKLDM-TTGCGGKIWPAAEVLGAYIAGKYSSPPLPGSAEGKAT
V5GR85_KALBG          EGG---------HWDVALKLDM-TTGCGGKIWPAAEVLGAYIAAKYSSPSREGS------
M9LSR4_PSEA3          ESEGG-------CWDVHLKLDM-TTGCGGKIWPAAEVLGAYIAAKYSSPPAAAGPQQQQQ
M5E9B2_MALS4          APEAPPPPSQAREYPIYLNLDM-SSGCGGKIWPAAEVLGAYIASMPSRDLALEQ------
Q5KN92_CRYNJ          TAVPVP----GLGRDVKLKVDA-GPGCGGIAWPAGEVLSRYLAYRHGLDPSHLV------
G7E6F6_MIXOS          --------------NFQLLVDA-GPGCGGITWPAAEVLTAYLANILALNPSWLE------
A0A060SIR3_PYCCI      -----------DPISIKLSVDA-SPGCGGIAWPAGEVLASYISR----------------
M2R9C0_CERS8          ----------PNPVVIKLSVDA-SPGCGGIAWPAGEVLSRYIAR----------------
S8DTD8_FOMPI          ---------DHGNIIIRLAVDA-SPGCGGIAWPAGEVLSRYIAH----------------
S8DXL2_FOMPI          ---------DHGKIIIRLAVDA-SPGCGGTAWPAGEVLSRYIAR----------------
K5WJK8_PHACS          ----------PNPVSIRLLTDA-SPGCGGITWLAGEILSAYVCR----------------
F8PQG3_SERL3          ----------DHEITIALKVDA-SPGCGGIAWPAGEVLANYLAL----------------
B0CRW5_LACBS          ----------PHPLSIDLVLDA-SPGCGGVAWPAGQILATYLVQ----------------
A8NWW4_COPC7          ----------PHPLDLSLSVDA-SPGCGGIAWPAGQILATYLVH----------------
V2XMR1_MONRO          ---------LANHLSITLAVDA-SPGCGGVVWPAAQILSSYLFR----------------
K5W0U2_AGABU          ---------VGQSLSVKLIVDS-KPGCGGIAWPAGQVMPPLIVLF---------------
B8PMJ3_POSPM          -----------ETVSITLAVSA-SPGCGGIAWPAGEVLSRYIARR---------------
B8P3X1_POSPM          -----------ETVSITLAVDA-SPGCGGIAWPAGEVLSRYIARK---------------
G4TKF2_SERID          -------------LTVQLLVDA-SPGCGGIAWPAGHVLSNYLVHR---------------
M5FRR8_DACPD          -----------LVPELRLSVDA-SPGCGGIAWPAGEVLSRYICLR---------------
D8PKW2_SCHCM          -----------TPVNVRLKVDA-SPGCGGMHWPAGQTLGNYLAWR---------------
I4YC93_WALMC          -----------AGVDLHLQHDK-TEGCGGMVWESGKVLTRYITQK---------------
R4XA11_TAPDE          -------------CRLTLAHDP-LVGTGGLLWPAGEVLARYLLTPSP-------------
                                     .    .    * **  * ..  :   .                  

EFM6_YEAST            ---------------KQFKKVLELGSGTGLVGLCVGLLEKNTFH----------DGTKVY
E7QK24_YEASZ          ---------------KQFKKVLELGSGTGLVGLCVGLLEKNTFH----------DGTKVY
E7KHC1_YEASA          ---------------KQFKKVLELGSGTGLVGLCVGLLEKNTFH----------DGTKVY
E7KTP1_YEASL          ---------------KQFKKVLELGSGTGLVGLCVGLLEKNTFH----------DGTKVY
J5P978_SACK1          ---------------RQFKKVLELGSGTGLVGLCVGLLEKNTFH----------DGSKVY
G0VHG6_NAUCC          ---------------RRFRNVLELGSGTGLVGLCVGLLEKNRFH----------KNIGVH
G0WDI3_NAUDC          ---------------KQFRKIVELGSGTGLVGLCIGLLEKNNFH----------KDIDAY
J7S1S8_KAZNA          ---------------QKFRNIIELGSGTGLVGLCVALLEKQFFH----------KGIKVT
Q6FJE7_CANGA          ---------------VSFGNVLELGSGTGLVGLCVGLVTKKQSQ----------RMVKTY
H2AZI3_KAZAF          ---------------GSIKNILELGSGTGLVGICVGLMEKQRFH----------KDIKVS
Q6CP15_KLULA          ----------------NCNSVLELGSGTGLVGLCVGLMDQANEY----------SDREVY
Q75AY2_ASHGO          ---------------RQFKNIIELGSGTGLVGLCVGLHGKYNGA----------TDTNVY
G8JRP9_ERECY          ---------------KQFNKVLELGSGTGLVGLCIGMHNIMHEV----------NDMDVY
C5DMN9_LACTC          R-------------DKPFVNILELGSGTGLVGLCAGSLARAN-G----------GNAKVH
Q6C9L2_YARLI          --------------IQSYPRVLEIGSGTGLTGLAIALSESAP------------PNLKVW
A0A0B1P713_UNCNE      --------------------ILELGAGVGLVGLSVAMGCQ--------------INKPIY
K1X0N5_MARBU          --------------------ILELGAGGGLVGLAVAVGCE--------------LDHPIY
L8G153_PSED2          --------------------ILELGAGGGLVGLAVALACN--------------ITAPIY
M7UC15_BOTF1          --------------------ILELGAGGGLVGLAVALACD--------------LQHPLI
G2XXP1_BOTF4          --------------------ILELGAGGGLVGLAVALACD--------------LQHPLI
N1JDZ6_BLUG1          --------------------ILELGAGGGLVGLAVALACR--------------PQEPVF
V6RQR4_GIBZE          --------------------ILELGAGGGLIGLAIALECS--------------LRNPLL
K3UUC8_FUSPC          --------------------ILELGAGGGLIGLAIALECS--------------LRNPLL
F9FJQ3_FUSOF          --------------------ILELGAGGGLIGLAVALECQ--------------LQNQLL
N4UFW0_FUSC1          --------------------ILELGAGGGLIGLAVALECQ--------------LQNQLL
N1RAG4_FUSC4          --------------------ILELGAGGGLIGLAVALECQ--------------LQNQLL
S0E0M6_GIBF5          --------------------ILELGAGGGLIGLAVALECQ--------------LQNQLL
W7LZF3_GIBM7          --------------------ILELGAGGGLIGLAVALECQ--------------LQNQLL
C7YS03_NECH7          --------------------ILELGAGGGLVGLAVALECD--------------LQNPLL
G9MJ65_HYPVG          --------------------ILELGAGGGLVGLAVAAGCD--------------LKAPLI
G0RT91_HYPJQ          --------------------ILELGAGGGLVGLAVAAGCD--------------LQAPLI
G9PBB1_HYPAI          --------------------ILELGAGGGLVGLAVAAGCN--------------LQAPLI
E9DY77_METAQ          --------------------ILELGAGGGLVGLAVALGCG--------------GENQLL
E9ET70_METRA          --------------------ILELGAGGGLVGLAVALGCG--------------GENQLL
M1W8T0_CLAP2          --------------------ILELGAGGGLVGLAVALGCG--------------GNASLL
T5A6T5_OPHSC          --------------------ILELGAGGGLVGLAVALGCST------------TAKGSLL
J4W6K1_BEAB2          --------------------ILELGAGGGLVGLAVALGCG--------------VESRLM
G0SD92_CHATD          --------------------ILELGAGGGVVGLTVAKGCK-------------NLKHPLY
G2QAG8_MYCTT          --------------------ILELGAGGGVVGLTVAKGCA-------------RLDHPLY
Q2HGY2_CHAGB          --------------------ILELGAGGGVVGLTIAKGCV-------------NLDHPLY
G2QWP9_THITE          --------------------ILELGAGGGVVGLTVARGCA-------------SLEHPLY
B2B475_PODAN          --------------------VLELGAGGGSVGLTIAKGC--------------RIDQPLY
V5ILY6_NEUCR          --------------------ILEIGAGGGLVGLAVAKGC--------------SFETPMY
G4UGZ5_NEUT9          --------------------ILEIGAGGGLVGLAVAKGC--------------SFETPMY
F7W4K1_SORMK          --------------------ILEIGAGGGLVGLAVAKAC--------------SYETPMY
T0LLH1_COLGC          --------------------ILELGAGGGLVGLAVALGC-------------DLQQTPLY
L2FMX8_COLGN          --------------------ILELGAGGGLVGLAVALGC-------------DLQQTPLY
N4VLN2_COLOR          --------------------ILELGAGGGLVGLAVALGC-------------GLQKKPLY
G2WR35_VERDV          --------------------ILELGAGGGLVGLAVANGAVADGH-------QGMHESPLL
A0A0C4E4R7_MAGP6      --------------------ILELGAGGGLVSLAVARGCQ-------------DIKHRIL
J3NGK6_GAGT3          --------------------ILELGAGGGLVSLAVARGCQ-------------DIKTQIL
U7Q390_SPOS1          --------------------ILELGAGGGLVGLAVALANQHADGRPAPEAADTDNIPSMY
S3D8R6_OPHP1          --------------------ILELGAGGGLTGLGVALANQAASD---AKGECPPAEPRMY
F0XCP8_GROCL          --------------------ILELGSGGGLVGLALALACRGSCS-----STTRPDSSSIF
A0A0A2JGC8_PENEN      --------------------IVELGAGGGLVGLAVARGCHLEQ--------------PIY
A0A0A2L210_PENIT      --------------------IVELGAGGGLVGLAVARGCHLEQ--------------PIY
B6HFD0_PENRW          --------------------IVELGAGGGLVGLAVARGCHLEQ--------------PIY
K9FRE1_PEND2          --------------------IVELGAGGGLVGLAVARGCHLEQ--------------PIY
S8B5I5_PENO1          --------------------IVELGAGGGLVGLAVARGCEIGL--------------PLH
A1CGP6_ASPCL          --------------------IVELGAGVGLVGLAVARGCNVGSV-------------PIY
Q4WNI7_ASPFU          --------------------IVELGAGGGLVGLAVARGCDVGPC-------------PIY
B8NZ42_ASPFN          --------------------IVELGAGGGLVGLAVARGCDIGSS-------------SVY
Q2UG14_ASPOR          --------------------IVELGAGGGLVGLAVARGCDIGSS-------------SVY
A2QHJ3_ASPNC          --------------------IVELGAGGGLVGLALARGCHPEMP-------------RIY
G3Y9U3_ASPNA          ---------------------VELGAGGGLVGLALARGCHPEMP-------------RIY
C8V996_EMENI          --------------------ILELGAGGGLVGLAVASGCEVGPP-------------QIY
V5FDS0_BYSSN          ---------------------VELGAGGGLVGLAVARGCSVDA--------------PIY
B6Q2Q4_TALMQ          --------------------IVELGAGGGLVGLAVARGCQTDK--------------PIY
B8LTP5_TALSN          --------------------IVEIGAGGGLVGLAVARGCQTDK--------------PIY
C1H9Q5_PARBA          --------------------IVELGAGGGLVGLAVARGCSIDS--------------PIY
C1GD53_PARBD          --------------------IVELGAGGGLVGLAVARGCSVDS--------------PIY
C6H7R2_AJECH          --------------------IVELGAGSGLVGLAIARGCTVDS--------------PIY
F0U4L8_AJEC8          --------------------IVELGAGSGLVGLAIARGCTVDS--------------PIY
C0NIE5_AJECG          --------------------IVELGAGSGLVGLAIARGCTVDS--------------PIY
C5G876_AJEDR          --------------------IVELGAGGGLVGLAVARGCAVDS--------------PIY
F2SCS7_TRIRC          --------------------IIELGSGSGLVGLAVAKGCAVDS--------------PIY
F2PNY9_TRIEC          --------------------IIELGSGSGLVGLAVAKGCAVDS--------------PIY
E5R1Z7_ARTGP          --------------------IIELGSGSGLVGLAVAKGCTVDL--------------PIY
C5FCB2_ARTOC          --------------------IIELGSGSGLVGLAVARGCATDS--------------PVY
E9CVE6_COCPS          --------------------IVELGAGSGLVALAVARGCKIDS--------------PIY
B2W1N4_PYRTR          --------------------IVELGAGGGLVGLAVAIGCKVDTT--------------LH
E3RCY5_PYRTT          --------------------IVELGAGGGLVGLAVAIGCNVDTR--------------LH
M2VCS7_COCH5          --------------------IVELGAGGGLVGLAVAIGCNVDKP--------------VH
M2STR1_COCSN          --------------------IVELGAGGGLVGLAVAIGCNVDKP--------------LH
R0JY20_SETT2          --------------------IVELGAGGGLVGLAVALGCNVDKT--------------LH
E5R4I7_LEPMJ          --------------------ILELGAGGGLVGLAVALGHKLQRV--------------LH
R1ENU5_BOTPV          --------------------IVELGAGGGLVGLAVALGCDAAASE----------KRPLY
R7YLR4_CONA1          --------------------IVELGAGGGLVGLAVALGCNVDKN--------------LL
M3B4T7_PSEFD          --------------------IVEIGAGGGLTGLAIAMGCGRSSV--------------LH
N1PM93_DOTSN          --------------------IVELGAGGGLTGLAIAIGSEPKYP--------------VH
M3BQA6_SPHMS          --------------------IVELGAGGGLVGLAVAVGCQPSAA--------------VH
H6BVP9_EXODN          --------------------IVEIGAGGGLVGLAVALGCEVDTK--------------IW
U1GT42_ENDPU          --------------------IIELGAGGGLVGLAVARGSQITKP--------------LI
S8B9D4_DACHA          --------------------VVELGSGGGVTGLAIGLELDQIGGG------DEKGGCDFW
U4LLQ3_PYROM          --------------------IVELGAGGGITSLAVAVGCDLEG-------------ADLY
F4P186_BATDJ          --------------------IIELGAGTGLVSLTVAVLPNEQSVLR-SSELAPTAPVSIT
S2J6R2_MUCC1          --------------------IVEIGSGTGLVGLAVAKLC--------------PGIKQMV
A0A0D1E1Y5_USTMA      SNQ----RFNNHNFDWRNKSIIELGSGTGLVGYLVHALGLSN--------------CRIW
R9NWX4_PSEHS          VNA----GFNNHNFDWRNKRIVELGSGTGLVGFLVHALHLSN--------------CTIS
V5GR85_KALBG          -------------FDWRHKRIIELGSGTGLVGYLVHALHLEG--------------CQIW
M9LSR4_PSEA3          QQQQQQEGFNNHGWDWRGKTVLELGSGTGLVGFLVHAMQLE---------------AKVY
M5E9B2_MALS4          -------------HPWRGKSIVELGSGTGLIGFLVAKLGIG---------------CTTW
Q5KN92_CRYNJ          -----------------GKTVIELGSGTGLVGIAAAMLEPT---------------SDVW
G7E6F6_MIXOS          -----------------GKRIVELGAGTGAVSMALARMMKKRGSR-----------TTIY
A0A060SIR3_PYCCI      ----------TAS--LDGKTVLELGSGTGLVGLVAGKLGA-----------------RVC
M2R9C0_CERS8          ----------RGS--LKGKRIVELGSGTGLVGLVAGVLGA-----------------RTC
S8DTD8_FOMPI          ----------RGS--LEGQTVLEVGSGTGLVGLVAGKLGA-----------------EVW
S8DXL2_FOMPI          ----------RGS--LEGQTVLELGSGTGLVGLVAGKLGA-----------------EVW
K5WJK8_PHACS          ----------RGS--LKGKNVLELGSGTGLVGLVTGVLGA-----------------QVW
F8PQG3_SERL3          ----------RGRQYIAGKTILELGSGTGLVGLVAGVLEG-----------------KVW
B0CRW5_LACBS          ----------KGSDFVSGRNTIELGSGTGLVGLLAGILGG-----------------KVW
A8NWW4_COPC7          ----------KGPTHLRNRNVLELGSGTGLVGLVAGLFGNC----------------KVW
V2XMR1_MONRO          ----------KGPAYLRGRNVLELGSGTGLVGLIAAMLDAR----------------HVW
K5W0U2_AGABU          --------TYKTANPLGNKCIVELGSGTGLVGLVAGKLDPTC---------------KVY
B8PMJ3_POSPM          --------G---PAYFKDKTVLELGSGTGLVGLVAAKLGAP----------------RVW
B8P3X1_POSPM          --------G---PAYFKDKTVLELGSGTGLVGLVAAKLGAP----------------RVW
G4TKF2_SERID          --------G---PSYLQDRHILELGSGTGLVGLVAAKLGAS----------------KVT
M5FRR8_DACPD          --------ETREPGWMKTRTVLELGAGTGLVGLVAAKLGAK----------------HVV
D8PKW2_SCHCM          --------G---ASALAGRTIVELGAGTGLVGFVAGALGG-----------------NVL
I4YC93_WALMC          -----------KLASYENTTVLELGAGTGIVGLALSKLVPSS---------------KVY
R4XA11_TAPDE          --------SLDPAACLRDKKVVEVGSGTGVVGLSCAQTLDLG-LR-----------GHLI
                                           :*:*:* *  .                            

EFM6_YEAST            VTDIDKLIPLLKRNIELDEVQY----------------EVLARELWWG---EPLSADFSP
E7QK24_YEASZ          VTDIDKLIPLLKRNIELDEVQY----------------EVLARELWWG---EPLSADFSP
E7KHC1_YEASA          VTDIDKLIPLLKRNIELDEVQY----------------EVLARELWWG---EPLSADFSP
E7KTP1_YEASL          VTDIDKLIPLLKRNIELDEVQY----------------EVLARELWWG---EPLSADFSP
J5P978_SACK1          VTDIDKLVPLLERNIELDKVQY----------------EVLARELWWG---EPLSVDFSP
G0VHG6_NAUCC          ITDIDQLVPLMQRNIELNGVSK----------------EVVAEGLWWG---EPLLESFAP
G0WDI3_NAUDC          ITDIDQIVPLMKQNIQLNGIEN----------------EVSAEELWWG---EPLRKTFAP
J7S1S8_KAZNA          ITDIDQLVPLMQKNIELNCVNT----------------EMIAEELWWG---EPLSGAFAP
Q6FJE7_CANGA          ITDIDQLVPLMEKNVELNLIDQ----------------QVFAKELLWG---EALPIEFAP
H2AZI3_KAZAF          ITDIGGLVPLMERNILLNKIAD----------------ATVAKELMWG---QQLPSEYMT
Q6CP15_KLULA          ISDIDQLLGLMESNIQVNGLDD----------------KVHAEVLWWG---NPLPDVFV-
Q75AY2_ASHGO          ITDIEGLCPLMQKNVELNGLDG----------------MVHPRPLFWG---EPLSDEFTR
G8JRP9_ERECY          ITDIDTLCPLMARNVRMNNLEG----------------RVHPRELFWG---DELPAEFRN
C5DMN9_LACTC          ITDIDQLVRLMEGNVELNGLAS----------------VVSAEKLWWG---EPLKYEFGP
Q6C9L2_YARLI          VTDQENMIPLMNQNIELNNLQD----------------KVVAEVLDWG---EELPEFLEG
A0A0B1P713_UNCNE      ITDQENMMDLMRKNIKINGLES----------------MAQELVLEWG---NPLPDEVLK
K1X0N5_MARBU          ISDQENMLDLMQQNIKLNGLES----------------RVKEIVLNWG---DPLPEAVVK
L8G153_PSED2          ITDQINMLPLMEQNVKLNNLES----------------RVTPLVLNWG---EPLPEVLSS
M7UC15_BOTF1          LSDMEVMYELMKQNIALNEVSS----------------KVEPLILNWG---EPLPELVVK
G2XXP1_BOTF4          LSDMEVMYELMKQNIALNEVSS----------------KVEPLILNWG---EPLPELVVK
N1JDZ6_BLUG1          ITDQTPMLKLMRQNIALNLLES----------------RVNEFLLDWG---SPLPTEIVE
V6RQR4_GIBZE          VTDQLEMFELMQHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
K3UUC8_FUSPC          VTDQLEMFELMQHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
F9FJQ3_FUSOF          VTDQLEMYELMKHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
N4UFW0_FUSC1          VTDQLEMYELMKHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
N1RAG4_FUSC4          VTDQLEMYELMKHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
S0E0M6_GIBF5          VTDQLEMYELMKHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
W7LZF3_GIBM7          VTDQLEMYELMKHNIELNNLQD----------------KAKAMVLNWG---EDLPAAVLE
C7YS03_NECH7          LTDQTEMFELMQHNIKLNGLQS----------------KAKAMVLNWG---EPLPATVLE
G9MJ65_HYPVG          LTDQDVMLELMKHNIQLNKLES----------------KASASILNWG---ETLPDAVVA
G0RT91_HYPJQ          LTDQDVMLELMRHNIQLNKLES----------------KATASILDWG---EPLPEAVVA
G9PBB1_HYPAI          LTDQDVMLELMKHNIQLNELEG----------------KATASILDWG---ETLPEAVVA
E9DY77_METAQ          LTDQDEMLELMQTNIRLNRVDS----------------RARALILHWG---EPLPREVVA
E9ET70_METRA          LTDQDEMLELMQTNIRLNQVDS----------------RAQALILNWG---EPLPREVVT
M1W8T0_CLAP2          VTDQQEMFELMDTNIRLNKLEG----------------RAKALILNWG---ESLPEEVVA
T5A6T5_OPHSC          LTDQDEMLGLMQHNIQLNDVES----------------RATALVLNWG---EPLPDVVVQ
J4W6K1_BEAB2          LTDQAEMLELMKHNIALNEVGN----------------KATASILNWG---EPLPQEVVD
G0SD92_CHATD          ITDMVEMEPLMKYNISLNGLAD----------------RVRARILNWG---EPLSQEVVD
G2QAG8_MYCTT          LTDMVEMEPLMRQNISLNGLED----------------RVKARVLNWG---EPLSQEVLE
Q2HGY2_CHAGB          LTDILEMEPLMQHNISLNGLDD----------------RVKARVLKWG---EPLSQEVLQ
G2QWP9_THITE          ITDMVEMESLMQHNIALNGLDD----------------RVRARVLNWG---EPLSEEVLG
B2B475_PODAN          ITDMIDMEPLMQHNIALNELDD----------------RVRGRILNWG---EPLSQEIID
V5ILY6_NEUCR          ITDQLEMEELMAYNTTLNGLND----------------KVKSMILNWG---EPLPEEIVA
G4UGZ5_NEUT9          ITDQLEMEELMAYNTTLNGLND----------------KVKSMILNWG---EPLPEEIVA
F7W4K1_SORMK          ITDQLEMEELMAHNITLNGLDD----------------KVKSMILNWG---EPLPAEIVA
T0LLH1_COLGC          LTDQDEMFELMGRNTKLNGLDG----------------KVKPMILNWG---EPLSQEVVD
L2FMX8_COLGN          LTDQDEMFELMGRNTKLNGLDG----------------KVKPMILNWG---EPLSQEVVD
N4VLN2_COLOR          LTDQDEMFELMGRNTKLNNLEG----------------TVKPMILNWG---ESLSQEIVE
G2WR35_VERDV          LTDQDEMFALMQHNIALNELGS----------------NVKPLILNWG---EPLPKDVID
A0A0C4E4R7_MAGP6      VTDQEEMFSLMEHNVRLNGVED----------------RAKAMVLNWG---DELPQEVVE
J3NGK6_GAGT3          VTDQEEMFSLMEHNIRLNGVEA----------------RAKAMLLNWG---EELPQEVVE
U7Q390_SPOS1          ITDQLPMFALMGHNIALNGLQR----------------DVQPLILNWG---EPLPDEVRK
S3D8R6_OPHP1          ITDQEMMLSLMKHNIVLNGLER----------------EAKALVLNWG---EPLPEEVRT
F0XCP8_GROCL          VTDQEPMLSLMKHNIALNGLQD----------------RARAVVLNWG---DVLPEEVRA
A0A0A2JGC8_PENEN      ITDQEPMFSLMKSNIQLNNLGA----------------NATAAILNWG---EPIPSQIPS
A0A0A2L210_PENIT      ITDQEPMFSLMKSNIQLNNLGA----------------NATAAILNWG---EPIPDQIPS
B6HFD0_PENRW          ITDQEPMFSLMKSNIQLNNLGP----------------NATAAILNWG---EPIPKQIPS
K9FRE1_PEND2          ITDQQPMFSLMKSNIQLNNLGA----------------NATAAILNWG---EPIPNQIPS
S8B5I5_PENO1          ITDQIPMFDLMKDNIALNQLDS----------------TVVASVLDWG---EPIPSHVPS
A1CGP6_ASPCL          VTDQEPMLPLMKTNIELNNLSS----------------AVAATVLNWG---EPLPDCIPT
Q4WNI7_ASPFU          ITDQEPMLHLMKTNIELNNLST----------------AVAATVLNWG---ERLPDCIPT
B8NZ42_ASPFN          ITDQAPMLPLMETNIKLNNVSS----------------RVAATVLNWG---ESLPDCIPK
Q2UG14_ASPOR          ITDQAPMLPLMETNIKLNNVSS----------------RVAATVLNWG---ESLPDCIPK
A2QHJ3_ASPNC          ITDQAPMLPLMKTNIKLNNLSS----------------TVEATVLNWG---DSLPDCIPK
G3Y9U3_ASPNA          ITDQAPMLPLMKTNIKLNNLSS----------------TVEATVLNWG---DSLPDCIPK
C8V996_EMENI          ITDQVPMLPLMKSNIALNNLSR----------------KVKAAVLDWG---TTLSDEIPR
V5FDS0_BYSSN          ITDQKPMLALMEANIKLNNLSP----------------LVKASVLDWG---TPIPEDIPQ
B6Q2Q4_TALMQ          VTDQKPMMQLMADNISLNGLST----------------KVKPVLLDWA---ESPPAEIPE
B8LTP5_TALSN          ITDQEPMMQLMRDNISLNDLSM----------------KVKPALLDWA---RPPPAEIPE
C1H9Q5_PARBA          ITDQIPMLSLMQDNVQLNRLSD----------------IVYPAVLDWG---CEIPKTVPS
C1GD53_PARBD          LTDQIPMLSLMQDNVQLNRLSD----------------IVYPAVLDWG---CEIPKTVPS
C6H7R2_AJECH          ITDQTPMLSLMQSNVQLNSLSN----------------IVYPTVLEWG---RPLPETVPS
F0U4L8_AJEC8          ITDQTPMLSLMQSNVQLNSLSN----------------IVYPTVLEWG---RPLPETVPS
C0NIE5_AJECG          ITDQTPMLSLMQSNVQLNGLSN----------------IVYPTVLEWG---RPLPETVPS
C5G876_AJEDR          ITDQIPMLSLMQSNVQLNGLSD----------------IVHPAVLDWG---SALPEGVPS
F2SCS7_TRIRC          ITDQMAMFELMKQNIELNGLNG----------------SVHAALLDWGD--EGAVRALP-
F2PNY9_TRIEC          ITDQMAMFELMKQNIELNGLNG----------------SVHAALLDWGD--EGAVRALP-
E5R1Z7_ARTGP          ITDQMAMFELMKQNIELNGLNG----------------SVHAALLDWGD--EGAVRALP-
C5FCB2_ARTOC          ITDQMAMFPLMQQNIELNGLTG----------------VVHAALLDWGD--EEAVRALP-
E9CVE6_COCPS          VTDQKPMLPLIEENIILNDLSG----------------SVVAALLDWGD--SDALTTLPS
B2W1N4_PYRTR          ITDQEPMFELMKRNIALNNLQD----------------RVSASIYDWG---EPTPSELPA
E3RCY5_PYRTT          ITDQEPMFELMKRNIVLNNVQD----------------RVSASIYDWG---EPTPSDLPA
M2VCS7_COCH5          ITDQIPMFDLMERNIALNGLES----------------RVKASVYDWG---EPTPSQLPS
M2STR1_COCSN          ITDQIPMFDLMGRNIALNGLES----------------RVKASVYDWG---EPTPSQLPS
R0JY20_SETT2          ITDQIPMFDLMERNITLNGLDS----------------RVKASIYDWG---EATPPQLPA
E5R4I7_LEPMJ          ITDQEPMFDLMKRNIKLNTLDS----------------RVLATIYDWG---APTPSHLPL
R1ENU5_BOTPV          ITDQAPMLALMQRNTALNALAA----------------RVRPVVYDWG---AAPPPEIPV
R7YLR4_CONA1          ITDQKPMFALMQQNITLNNLQG----------------RVEADIYDWG---EAPPPSVPT
M3B4T7_PSEFD          ITDMQSMLPLMQRNISLNTLQS----------------KVSASVYDWG---NARPEGIPE
N1PM93_DOTSN          TTDMQSMLELMERNITLNSLQD----------------QVIASVYNWG---ESRPCKIPP
M3BQA6_SPHMS          ITDMDTMLALMEQNIALNDLGD----------------RVKATVYEWG---TAAPDAIPQ
H6BVP9_EXODN          VTDQLPMLALMQKNVELNKLEA----------------KVGAAIYDWG---SPPPADILR
U1GT42_ENDPU          ITDQLPMLGLMQQNIALNSLEN----------------RVIAGRLDWG---TSISPSLEA
S8B9D4_DACHA          MTDMSAMMELMEKNVAFNDLGG----------------RIQCGLLDWA---DPLPTFVTS
U4LLQ3_PYROM          MTDMKAMYELMKDNVKLNKLED----------------KIKVELLDWA---NPVPDAIAE
F4P186_BATDJ          ITDLEEFVPLISFNAKLNLTEQELK-------------TISIETCRWG---DPLSQHIKA
S2J6R2_MUCC1          ITDQLPMMGLMQENIKLNHLEQ----------------SVTADILNWG---EVIPD-ISQ
A0A0D1E1Y5_USTMA      VTDQDVMLPLMRDNLALNFHLDPNSPCSSIAYSPDQSGFVQVAELNW-------GQRLPE
R9NWX4_PSEHS          VTDQDVMLPLMRDNLQLNFPSSTDS--------------ISVDELNW-------GTRLPP
V5GR85_KALBG          VTDQDVMLHLMRENLALNFQLSPTDTPSS---TTTNDGFVKVAELDW-------GTEL--
M9LSR4_PSEA3          VTDQDAMLALMRDNLALNFPTTSPNTARTE----DGRGELHVAELDW-------GSPIP-
M5E9B2_MALS4          ITDQAPMLPLMAENAQLNPDMIDAC---------------HVAELNW-------GEPLPP
Q5KN92_CRYNJ          VTDQSMLLGLMEDNAKLNLADLQRDN-------------VHVAELNW-------GEPLPA
G7E6F6_MIXOS          STDQAILLDLMDANTVLNDVGDTVN----------------VRELSW-------GETIAS
A0A060SIR3_PYCCI      ITDQAPLLDIMKRNVSLNGLESRVS----------------VAELNW-------GEPIPD
M2R9C0_CERS8          ITDQAPLLEIMLRNVAMNALESSVA----------------VKELNW-------GEPLPS
S8DTD8_FOMPI          ITDQAPLLSIMRRNVEMNDLSSRVH----------------VTELDW-------GSPIPQ
S8DXL2_FOMPI          ITDQAPLLLIMRRNVEMNDLSSRVH----------------VTELDW-------GSPIPR
K5WJK8_PHACS          ITDQAPLLGIMAHNVEINNLSHRVS----------------VMELNW-------GESLPS
F8PQG3_SERL3          ITDQAPLLDIMRCNVKINQLQSSVS----------------VSELNW-------GDPLPS
B0CRW5_LACBS          ITDQSPLLPIMGRNVFINNLCNNVK----------------VAELNW-------GSPIPP
A8NWW4_COPC7          ITDQSPLLPIMQRNVLLNDLNDNVV----------------VAELDW-------AQPIPS
V2XMR1_MONRO          VTDQAPLLDIMEKNVAMNSLTSKCT----------------VAELDW-------GTPVPA
K5W0U2_AGABU          ITDQAPLLDIMNKNVALNSLEENVE----------------VSQLNWALIEEIRGEPIPS
B8PMJ3_POSPM          LTDQAPLLDTMRRNTALNGLAPPVR----------------VAELNW-------GAPLPL
B8P3X1_POSPM          LTDQAPLLATMRRNTALNGLAPPVR----------------VAELNW-------GAPLPL
G4TKF2_SERID          VTDQLPLLEIMQRNINLNSLGQTVV----------------SKELDW-------GKELPE
M5FRR8_DACPD          ITDQTPLLPLIERNIVLNNVQNACI----------------AAEFNW-------GEPLSE
D8PKW2_SCHCM          ITDQAPLLPLMRENTALNGLEDRVK----------------VAELNW-------GEPLPE
I4YC93_WALMC          ITDIPQIMPLIEKGIRINELTNAIP-----------------ETLVW-------GERLPR
R4XA11_TAPDE          LTDLPAVLPILRRNVALNGLAPAVS----------------VRPLAW-------GQPVGP
                       :*   .   :  .  .:                            *             

EFM6_YEAST            QEG-------AMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHC-IN--------PPVI
E7QK24_YEASZ          QEG-------AMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHC-IN--------PPVI
E7KHC1_YEASA          QEG-------AMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHC-IN--------PPVI
E7KTP1_YEASL          QEG-------AMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHC-IN--------PPVI
J5P978_SACK1          QEG-------DLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNC-IS--------PPVI
G0VHG6_NAUCC          STV-----DNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTES-ET--------PPVI
G0WDI3_NAUDC          SEHSRDKEEDFREEKKVDLILAADCVYLEKAFPLLEKTLLDLTEG-ET--------PPTI
J7S1S8_KAZNA          HSE------GLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNC-SK--------PPVI
Q6FJE7_CANGA          VKT------GHATTSSLDLVLAADCVYLEKAFPLLEKTLLDLTEC-DN--------PPVI
H2AZI3_KAZAF          TSV----DGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNC-DN--------PPII
Q6CP15_KLULA          -------------KKPVDLVLAADCVYLEAAFPLLEKTLLELTDG-EN--------VPII
Q75AY2_ASHGO          Q--------------PIDLVLAADCVYLEKAFPLLEKTLLDLTAG-ES--------QPLV
G8JRP9_ERECY          KDS------------PVDLILAADCVYLEKAFPLLEMKLLELTANQEV--------QPVV
C5DMN9_LACTC          DAI----------SNKTDLVLAADCVYLETAFPLLEKTLLDLTKG-ET--------PPVV
Q6C9L2_YARLI          Q--------------PVDLVLAADCVYLESAFPLLEKTLIDLSNK-----------DTKI
A0A0B1P713_UNCNE      R--------------QPNLILAADCVYFEPSFPLLLTTLKDLSNLSSD---------TII
K1X0N5_MARBU          V--------------KPDLILAADCVYFEPAFPLLLATLEDLLELCEE---------SVV
L8G153_PSED2          K--------------PATHILAADCVYFEPAFPLLLLTLTQLLTACDQ---------AVI
M7UC15_BOTF1          D--------------KPDVILAADCVYFEPAFPLLLQTLEELLELSKD---------AVI
G2XXP1_BOTF4          D--------------KPDVILAADCVYFEPAFPLLLQTLEELLELSKD---------AAI
N1JDZ6_BLUG1          F--------------CPNVILAADCVYFEPAFPLLLATLEALVKLCEE---------TVI
V6RQR4_GIBZE          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPN---------AVV
K3UUC8_FUSPC          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPN---------AVV
F9FJQ3_FUSOF          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPA---------AVV
N4UFW0_FUSC1          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPA---------AVV
N1RAG4_FUSC4          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPA---------AVV
S0E0M6_GIBF5          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPA---------AVV
W7LZF3_GIBM7          Q--------------KPDVILAGECVYFEPAFPLLMSTLKALLELNPA---------AVV
C7YS03_NECH7          Q--------------KPDVILAGECVYFEPAFPLLMSTLKTLLELNPS---------AVV
G9MJ65_HYPVG          H--------------KPDVILAGECVYFEPAFPLLMQTLKDLFELNEN---------AVV
G0RT91_HYPJQ          H--------------KPDVILAAECVYFEPAFPLLMQTLKDLFELNEH---------AVV
G9PBB1_HYPAI          H--------------KPDVILAAECVYFEPAFPLLMQTLKDLFELNSD---------AVV
E9DY77_METAQ          Q--------------KPNVIIAAECVYFEPAFPLLLDTLKNLLALNEE---------AVV
E9ET70_METRA          Q--------------KPNVIIAAECVYFEPAFPLLLDTLKDLLALNEE---------AVV
M1W8T0_CLAP2          Q--------------KPDVIIAAECVYFEPAFPLLMQTLRDLFALNDK---------AIV
T5A6T5_OPHSC          R--------------RPNVILAAECVYLEPAFPLLMQTLKDLLALNHG---------AVV
J4W6K1_BEAB2          Y--------------KPDVILAGECVYFEPAFPLLMQTLRDLVALNPD---------VVI
G0SD92_CHATD          F--------------KPDVILAADCVYLEAAFPLLMQTLKDLLELEPK---------ATV
G2QAG8_MYCTT          H--------------KPNIILAADCVYFEPAFPLLLQTLQDLLAVEPS---------ATI
Q2HGY2_CHAGB          F--------------KPDIILAADCVYFEPAFPLLMQTLQDLLALTPS---------ATV
G2QWP9_THITE          F--------------KPDIILAADCVYFEPAFPLLLQTLQDLLTLVPD---------AVV
B2B475_PODAN          F--------------KPDTILAADCVYFEPAFPLLLQTLEDLLTLNPS---------AIV
V5ILY6_NEUCR          L--------------KPDTILAADCVYFEPAFPLLLQTLKDLLALEPS---------ATV
G4UGZ5_NEUT9          L--------------KPDTILAADCVYFEPAFPLLLQTLKDLLALEPN---------ATV
F7W4K1_SORMK          L--------------KPNTILAADCVYFEPAFPLLLQTLKGLLALEPN---------ATV
T0LLH1_COLGC          F--------------KPNVILAADCVYFEPAFPLLLETLTNLLTLEPD---------ATI
L2FMX8_COLGN          F--------------KPNVILAADCVYFEPAFPLLLETLTNLLTLEPD---------ATI
N4VLN2_COLOR          F--------------KPNVILAADCVYFEPAFPLLLQTLSDLLALEPD---------ATI
G2WR35_VERDV          S--------------KPTVVLAADCVYFEPAFPLLLETLSDLLALNED---------ATI
A0A0C4E4R7_MAGP6      S--------------RPNVILAADCVYFEPAFPLLQKTMADLLALCPED--------ATI
J3NGK6_GAGT3          S--------------RPNVILAADCVYFEPAFPLLQKTMADLLTLCPE---------ATI
U7Q390_SPOS1          Q--------------QPNVILAADCVYFEPAFPLLLATLEELLALADD---------VVI
S3D8R6_OPHP1          L--------------RPNIILAADCVYFEPAFPLLLTTLEDLLSIDDEATPQ--EDQMVI
F0XCP8_GROCL          L--------------RPNVVLAADCIYFEPAFPLLMATLEELLQLGEAGEP------VTV
A0A0A2JGC8_PENEN      ---------------KPDVILAADCVYFEPAFPLLITTLQDL--LGP---------DTVC
A0A0A2L210_PENIT      ---------------KPDVILAADCVYFEPAFPLLITTLQDL--LGP---------DTVC
B6HFD0_PENRW          ---------------KPNVIIAADCVYFEPAFPLLITTLQDL--LGP---------NSVC
K9FRE1_PEND2          ---------------TPDVILAADCVYFEPAFPLLITTLQDL--LGP---------NTVC
S8B5I5_PENO1          ---------------KPDVILAADCVYFEPAFPLLITTLQDL--LGP---------NSVC
A1CGP6_ASPCL          ---------------HPAIILAADCVYFEPAFPLLISTLQDL--LGP---------DSVC
Q4WNI7_ASPFU          ---------------HPEIVLAADCVYFEPAFPLLISTLQDL--LGP---------ESVC
B8NZ42_ASPFN          ---------------HPAIVLAADCVYFEPAFPLLISTLKNL--LGP---------ESIC
Q2UG14_ASPOR          ---------------HPAIVLAADCVYFEPAFPLLISTLKNL--LGP---------ESIC
A2QHJ3_ASPNC          ---------------HPAIILAADCVYFEPAFPLLISTLNDL--LGP---------ESVC
G3Y9U3_ASPNA          ---------------HPAIILAADCVYFEPAFPLLISTLNDL--LGP---------ESVC
C8V996_EMENI          ---------------RPDVILAADCVYFEPAFPLLISTLRDL--LGP---------DSVC
V5FDS0_BYSSN          ---------------HPAVVLAADCVYFEPAFPLLVDTLQSL--IGP---------DTVC
B6Q2Q4_TALMQ          ---------------HPEIVLAADCVYFEPAFPLLISTLQRL--LGP---------DTIC
B8LTP5_TALSN          ---------------HPELVLAADCVYFEPAFPLLISTLQRL--LGP---------DTIC
C1H9Q5_PARBA          ---------------DPAIILAADCVYFEPAFPLLLSTLEGL--LASP--------HSVC
C1GD53_PARBD          ---------------DPAVILAADCVYFEPAFPLLLSTLEGL--LASP--------HSVC
C6H7R2_AJECH          ---------------TTAIILAADCIYFEPAFPLLLSTLQSL--LTSS--------HSLC
F0U4L8_AJEC8          ---------------TTAIILAADCIYFEPAFPLLLSTLQSL--LTSS--------HSLC
C0NIE5_AJECG          ---------------TTAIILAADCVYFEPAFPLLLSTLQSL--LTSS--------HSLC
C5G876_AJEDR          ---------------DPAVIIAADCVYFEPAFPLLLSTLQNL--LSSS--------HSLC
F2SCS7_TRIRC          ---------------RAKVILAADCVYFEPAFPLLLLTLEAL--LDEE--------DVVC
F2PNY9_TRIEC          ---------------RAKVILAADCVYFEPAFPLLLLTLEAL--LDEE--------DVVC
E5R1Z7_ARTGP          ---------------KAKVILAADCVYFEPAFPLLLLTLEAL--LDEE--------DVVC
C5FCB2_ARTOC          ---------------KAKVILAADCVYFEPAFPLLLSTLEAL--LEEE--------DAVC
E9CVE6_COCPS          ---------------HPEVILAADCVYFEPAFPLLVSTLDGL--MGE---------NSMC
B2W1N4_PYRTR          ---------------HPDIILAADCVYFEPAFPLLQHTLKDL--IGE---------NTVC
E3RCY5_PYRTT          ---------------HPDIILAADCVYFEPAFPLLQHTLKDL--IGE---------NTVC
M2VCS7_COCH5          ---------------HPDIILAADCVYFEPAFPLLQQTLRDL--IGE---------NTVC
M2STR1_COCSN          ---------------HPDIILAADCVYFEPAFPLLQQTLKDL--IGE---------NTVC
R0JY20_SETT2          ---------------HPDIILAADCVYFEPAFPLLQQTLKDL--IGE---------NTVC
E5R4I7_LEPMJ          ---------------HPDVILAADCVYFEPAFPLLQQTLQDL--IGE---------DTVC
R1ENU5_BOTPV          ---------------PPDVILAADCVYFEPAFPLLRRTLEDL--IGP---------NTVC
R7YLR4_CONA1          ---------------HPDIILAADCVYFEPAFPLLQRTLQDL--IGE---------RSVC
M3B4T7_PSEFD          ---------------HPDVLLAADCVYYEPAFPLLQKTLQDL--IGP---------NTVC
N1PM93_DOTSN          ---------------SPDIVIAAECVYFEPAFPLLQQTLRDL--IGT---------NTVC
M3BQA6_SPHMS          ---------------HPDIVLAADCVYFEPAFELLQQTLQDL--IGP---------NTVC
H6BVP9_EXODN          NGTEQ-----------PDIVLAADCVYFEPAFPLLLQTLTDL--IGP---------STTC
U1GT42_ENDPU          HFSTHA---LLPDERFPDVVLAADCVYFEPAFPLLLQTMHRL--LGP---------ETLC
S8B9D4_DACHA          K--------------PVDILLAADCVYFEPAFPLLEKTLCDI--AGPD---------TEV
U4LLQ3_PYROM          K--------------PVDIILAADCVYFEPAFPLLEKTLVDM--VGEN---------TVV
F4P186_BATDJ          AF-------------PFDLILVADCVYLEAAFDPLIKTLTDLSTRSTEI-----------
S2J6R2_MUCC1          VL-------------NADVILASDCIYLEMAFIPLLETFFALTNKPTSII----------
A0A0D1E1Y5_USTMA      F----------ATTHPPDVLLLADCVYLESAFQPLIDTMVHLST-----------QRTEI
R9NWX4_PSEHS          I----------FREPLPDVLLLADCVYLESAFQPLIDTMLDLST-----------RETEI
V5GR85_KALBG          ------------TFDKPDVLLLADCVYLESAFQPLIDTMTQLST-----------SDTEI
M9LSR4_PSEA3          -----------ASIPAPDVLLLADCVYLEVAFQPLIDTMEALAT-----------SQTEI
M5E9B2_MALS4          -----------DVPTHPDVILLADCVYREEAFQPLVDTLVAMST-----------PTTEI
Q5KN92_CRYNJ          E----------IPLEKSSLILAADCVYFEPAFPLLVQTLCDLAPI---------GKDIEI
G7E6F6_MIXOS          ------------EMQTPDIILAADCVYFEPAFPLLMKTLRLLAT-----------PTSEI
A0A060SIR3_PYCCI      S----------IP--EPDLVLAADCVYFEPAFPLLVKTLVDLV----------HDLSTEV
M2R9C0_CERS8          D----------IS--RPDIVLAADCVYFEPAFPLLVKTLAHLV----------ADDSTEV
S8DTD8_FOMPI          K----------IS--PPSLILAADCVYFEPAFPLLVKTLADLVPRSGGVGGQRRRERPEV
S8DXL2_FOMPI          D----------IP--PPSLILAADCVYFEPAFPLLVKTLADLVPRSEKIDDQRRREHPEV
K5WJK8_PHACS          D----------LP--RFDIILAADCVYFEPAFPLLVQTLDKLA----------ARGDPEI
F8PQG3_SERL3          D----------LP--MPDLILAADCVYFEPAFPLLVQTLSDLA-----------TETTDI
B0CRW5_LACBS          E----------IP--RPDLILAADCVYFEPTFPLLVQTLADLA-----------DATTEI
A8NWW4_COPC7          T----------IP--KPDVILAADCVYFEPAFPLLVETLDRLS-----------TKDTEI
V2XMR1_MONRO          T----------IP--APDMVLAADCVYFEPAFPLLIQTLCELG-----------GEKTEI
K5W0U2_AGABU          G----------VPS-KADIILAADCVYFEPAFPLLVQTLSDLS-----------DAKTVI
B8PMJ3_POSPM          L----------PRP---DVVLAADCVYFEPAFPLLVHTLAALVPRGSPSPD----PDPDV
B8P3X1_POSPM          L----------PRP---DVVLAADCVYFEPAFPLLVRTLAALVPRDAPGP------DADV
G4TKF2_SERID          L----------GPI---DVILAADCVYFEPSFPHLVNTLEALSRQ--PGR------DCEI
M5FRR8_DACPD          A----------IRTGAFDLILAADCVYLEPAFPLLVQSLCDLTNE---SP------RAEL
D8PKW2_SCHCM          E----------LQEKV-DMVLAADCVYFEPAFPLLVQTLFDLVHE-----------DTEV
I4YC93_WALMC          LDSN------------PSVLLLADCVYYEPSFQPLVDTLVELTDR---------YTIKEI
R4XA11_TAPDE          D------------LANCDVVLAADCVYLEHLFQPLLDTLLALMLR----------PGAVA
                                         :: .:*:* *  *  *   :  :                  

EFM6_YEAST            LMAYKKRRKADKHFFNKIKRNFDVLEITDFSK--FEHYLKERTHLFQLIRK---------
E7QK24_YEASZ          LMAYKKRRKADKHFFNKIKRNFDVLEITDFSK--FEHYLKERTHLFQLIRK---------
E7KHC1_YEASA          LMAYKKRRKADKHFFNKIKRNFDVLEITDFSK--FEHYLKERTHLFQLIRK---------
E7KTP1_YEASL          LMAYKKRRKADKHFFNKIKRNFDVLEITDFSK--FEHYLKERTHLFQLIRK---------
J5P978_SACK1          LMAYKKRRKADKHFFSKIKRNFDVLEITDFSK--FDHYLKQRTHLFQLIRKHTV------
G0VHG6_NAUCC          LMSYRKRRKADKHFFNKIKKNFDVIEVKDFTK--YEMYLKMRTHLFQLARRF--------
G0WDI3_NAUDC          LMAYRKRRKADKHFFQKIKKNFDIVEIKDFEK--YEYYLKQRTHLFQLIRQ---------
J7S1S8_KAZNA          LMAYRKRRNADKRFFRKIGKHFTVREITDFST--YDQYLKQRTHLFELIRN---------
Q6FJE7_CANGA          LMAYRKRRKADKHFFQKIRKNFNVIVINDFKN--YDQYLKQRTHLFQLVRK---------
H2AZI3_KAZAF          LMAYRKRRKADKRFFVRIRKNFDVIEIDDFSS--HEKYMKQRTHLFELKRK---------
Q6CP15_KLULA          LMAYKKRRKADKHFFQKIKKNFKIVEIRDFIN--FDKYLKQRTHLFQLMREK--------
Q75AY2_ASHGO          LMSYKKRRKADKKFFIKIKKEFDIIEIKDFKS--YEDYRRQRTYLFQLVRKPARAPHALA
G8JRP9_ERECY          LMSYRKRRKADKKFFLKIKKHFVITELTDFKR--YDEYIKQRTHIFQLVRRSSIKQQQAR
C5DMN9_LACTC          LMSYRKRRKADRIFFKAIRKNFKVVPITSFDR--CDDFLKQRTHLFQLIRVQK-------
Q6C9L2_YARLI          LMSYKKRRKADSRFFKSVKKHFTIVEISDFEE--HARFKKDGVTLMELKKKTK-------
A0A0B1P713_UNCNE      YFCFKKRRKADIRFLKAARKIFIVEEP-EDED--RVQFSRQGLYLFTFKLKHWNILTRG-
K1X0N5_MARBU          YFCFKKRRRADMQFIKNAKKKFLVEEI-EDQD--RQTFSREGLFLYTFKRKP--------
L8G153_PSED2          YFCFKKRRRADAQFMKAARKIFLIEEI-EDKD--KEVWTREQLFMYTFRSKIPKPNGHKA
M7UC15_BOTF1          YFCFKKRRKADMQFMKKAKKKFLVEEI-EDQD--RDTFTREALFLYTFKRKP--------
G2XXP1_BOTF4          YFCFKKRRKADMQFMKKAKKKFLVEEI-EDQD--RETFTREALFLYTFKRKP--------
N1JDZ6_BLUG1          YFCFKRRRRADMQFLKQAKKKFQVDEI-EDED--REIFSRERLFLYTFRRKM--------
V6RQR4_GIBZE          YFCFKKRRRADMNFVKMAKKAFKVEEI-FDED--RPVFQRQGLFLFSFTSRP-----SPT
K3UUC8_FUSPC          YFCFKKRRRADMNFVKMAKKAFKVEEI-FDED--RPVFQRQGLFLFSFTSRP-----SQT
F9FJQ3_FUSOF          YFCFKKRRRADMTFVKMAKKAFKVEEI-FDED--RPVFQRQGLFLFSFTSRPTT---SQT
N4UFW0_FUSC1          YFCFKKRRRADMTFVKMAKKAFKVEEI-FDED--RPVFQRQGLFLFSFTSRPTT---SQT
N1RAG4_FUSC4          YFCFKKRRRADMTFVKMAKKAFKVEEI-FDED--RPVFQRQGLFLFSFTSRPTT---SQT
S0E0M6_GIBF5          YFCFKKRRRADMTFVKMAKKAFKVEEI-FDED--RPVFQRQGLFLFSFTSRPTT---SQT
W7LZF3_GIBM7          YFCFKKRRRADMTFVKMAKKAFKVEEI-FDED--RPIFQRQGLFLFSFTSRPTT---GQT
C7YS03_NECH7          YFCFKKRRRADMNFVKMAKKAFKVEEI-FDEE--RPVFQRQGLFLFSFTRRTGQQQGQQK
G9MJ65_HYPVG          YFCFKKRRRADMQFVKAAKKAFVVEEI-FDED--RPVFQRESLFLFTFRKRATG---GTT
G0RT91_HYPJQ          YFCFKKRRRADMQFVKAAKKAFVVEEI-FDED--RPVFQRESLFLFTFRKRASG---GTT
G9PBB1_HYPAI          YFCFKKRRRADMQFVKAAKKAFVVEEI-FDED--RPVFQRESLFLFTFRKRAAG---GTT
E9DY77_METAQ          YFCFKKRRRADMQFVKMAKKAFVVEEL-FDED--RPVFQRQSLFLFSFKCRPSAKST---
E9ET70_METRA          YFCFKKRRRADMQFVKMAKKAFVVEEL-FDED--RPVFQRQSLFLFSFKCRPSAKST---
M1W8T0_CLAP2          YFCFKKRRRADMQFVKLAKKAFLVEEL-FDQD--RPVFERQSLFLFSFQRKPTNPSQGRP
T5A6T5_OPHSC          YFCFKRRRRADLQFIKMARKAFKVDQV-SDED--RPVFERQQLFLFSLRYKTAGV-----
J4W6K1_BEAB2          YFCFKKRRRADMQFVKMARKAFTVEEI-FDDD--RPVFSRQSLFLFTFTAKRGKAAGGTR
G0SD92_CHATD          YFCFKKRRRADMQFLKNARKAFTVTEI-EDED--RPVFSRDNLFLYTFTRKDSGSSSSLS
G2QAG8_MYCTT          FFCFKKRRRADMQFLKAARKTFTVTEI-EDED--RPVFSRDCLFLYTFTRK---------
Q2HGY2_CHAGB          FFCFKKRRRADMQFIKAAKKAFTVTEI-EDED--RPVFSRSSLFLYAFTHKQ--------
G2QWP9_THITE          FFCFKKRRRADMQFLKAARKAFTVTEI-EDED--RPVFSREGLFLYTFTRKQ--------
B2B475_PODAN          FFCFKKRRRADMQFLKSARRAFRVTEL-EDED--RPVFTREGLFLYTITAK---------
V5ILY6_NEUCR          YFCFKKRRRADMQFLKAARKTFKITEL-EDQD--RPVFSREGLFLYAFTRK---------
G4UGZ5_NEUT9          YFCFKKRRRADMQFLKAARKTFKITEL-EDQD--RPVFSREGLFLYAFTRK---------
F7W4K1_SORMK          YFCFKKRRRADMQFFKAARKTFKITEL-EDED--QPVFTRQGLFLYAITRK---------
T0LLH1_COLGC          YFCFKKRRRADMQFLKKAQKAFQVTEI-VDDD--RAIFSREGLFLYTFASKKPTANGARQ
L2FMX8_COLGN          YFCFKKRRRADMQFLKKAQKAFQVTEI-VDDD--RAIFSREGLFLYTFASKKPTANGARQ
N4VLN2_COLOR          FFCFKKRRRADMQFLKKAQKAFQVTEV-VDED--RSIFSREGLFLYTFASKTPTANKARQ
G2WR35_VERDV          YFCFRKRRRADMHFMKKAKKRFRVEEA-FDED--QPVFSRENIFLYTFRNKKASTNGSTS
A0A0C4E4R7_MAGP6      YFCFKKRRRADMQFLKKAQKLFSVVEV-ADQA--RPVFSREGLFLYAISSKQRQQ-----
J3NGK6_GAGT3          YFCFKKRRRADMQFLKKAQKLFSVVEV-ADQA--RPVFSREGLFLYAISSKQRQQLGGGG
U7Q390_SPOS1          YFCFKKRRRADNQFIKKAQKKFCITEV-VDED--RPVFSREGLFLYTFTRKEAKTT----
S3D8R6_OPHP1          YFCFKKRRRADNQFLKKAQKKFCLTEV-FDEE--RPVFSRENLFLYTITRKPAKTANGNA
F0XCP8_GROCL          YFSFKKRRRADMQFVKKAQKRFCVTDL-ADED--RPVFSRQGLFLYSITRKGQQRV----
A0A0A2JGC8_PENEN      YFCYKRRRRADMRFMKMAKKAFEMEQVRDDPG--AEAYNRENIFLYTIRAKRLDQKRDTK
A0A0A2L210_PENIT      YFCYKRRRRADMRFMKMAKKAFEMEQIRNDPG--AEAYNRENIFLYTIRAKRLDQKSETR
B6HFD0_PENRW          YFCYKRRRRADMRFMKMAKKAFEMELVRDDPG--AEGYNRESIFIYTIRAKRLDQKSETR
K9FRE1_PEND2          YFCYKRRRRADMRFMKMAKKAFEMEQVHDDPG--AEAYNRDNIFLYTIRAKRLDRK----
S8B5I5_PENO1          YFCYKRRRRADLRFMKMAKKAFDVQEVRDDPH--AAEYSRESLYMYTIRVKPTKQPATSK
A1CGP6_ASPCL          YFCFKRRRRADLRFMKSAKKIFDIKHVEDDPD--LDMYKKENIFLCSIRLKSGSGNSQFD
Q4WNI7_ASPFU          YFCFKRRRRADLRFMKAAKRVFDIKEVRDDPE--ADTYRRENIFLYSLRLRFRPENGSLR
B8NZ42_ASPFN          YFCFKRRRRADSRFLKLAKKLFHIVEVCDDPM--AETYKRENIFLYSIRSK---------
Q2UG14_ASPOR          YFCFKRRRRADSRFLKLAKKLFHIVEVCDDPM--AETYKRENIFLYSIRSK---------
A2QHJ3_ASPNC          YFCFKRRRRADLRFMKHARKMFDVDEIRDDPE--AETYRRENIFLYQIRLKSSKRGV---
G3Y9U3_ASPNA          YFCFKRRRRADLRFMKHARKMFDVDEIRDDPE--AETYRRENIFLYQIRLKSSKRGV---
C8V996_EMENI          YFCFKKRRRADLRFLKLAKRAFQVTEIDDDPE--AGTYKRENINLYTIRSKPGTGHHCID
V5FDS0_BYSSN          YFCFKRRRRADLRFIKLAKKAFDITEVADDPD--RPTYSRENITIYVIRSKSAAKTTAVK
B6Q2Q4_TALMQ          YFCFKRRRRADLRCIKMVKKLFNVTEVNSFST--CDGYNRENLFLYKIQSRQKSKD----
B8LTP5_TALSN          YFCFKRRRRADLRCIKMIKKLFHVTEITKFST--CDGYNRENLFLYKIQSRQ-HRD----
C1H9Q5_PARBA          YFCFKRRRRADLRFMKQARKLFEVVEVIDDPD--QKVYSKQNIFL---------------
C1GD53_PARBD          YFCFKKRRRADLRFMKQVRKLFEVVEVMDDPD--QKVYSKQNIFLYTIRSRGEKGTKHNQ
C6H7R2_AJECH          YFCFKKRRRADLRFMKQAKKLFNLVEVKDDPD--RECYSKENIFMYAITKRDVKAEEPGE
F0U4L8_AJEC8          YFCFKKRRRADLRFMKQAKKLFNLVEVKDDPD--RECYSKENIFMYAITKRDVKAEEPGE
C0NIE5_AJECG          YFCFKKRRRADLRFMKQAKKLFNLVEVKDDPD--RECYSKENIFMYVITKGDVKAEEPGE
C5G876_AJEDR          YFCFKKRRRADLRFMKQAKKLFNVVEVKDDPD--RDRYSKESIFLYIIRKREVKSEEPGK
F2SCS7_TRIRC          YFCFKKRRKADMRFVKQMKKKFDVVEVTEGVD--RDFCKQERIFLYILRQRMEKP-----
F2PNY9_TRIEC          YFCFKKRRKADMRFIKQMKKKFDVVEVTEGVD--RDFCKQERIFLYILRQRMEKP-----
E5R1Z7_ARTGP          YFCFKKRRKADMRFIKQMKKKFDVVEVTEGVD--REFCKQERIFLYILRQRMEKS-----
C5FCB2_ARTOC          YFCFKKRRKADLRFIKQVKKKFDFTEVTDGVD--REFCKQERIFLYTLRRRMAKH-----
E9CVE6_COCPS          YFCFKKRRKADLRFIKMARKVFEITEVTDGIN--HVACKHQSIFLYILKRKPQPARKNNI
B2W1N4_PYRTR          YFCFKRRRRADLTFMKTARKMFDVKEEDDDPD--KEVYSREKLFL---------------
E3RCY5_PYRTT          YFCFKRRRRADLTFMKTARKMFDVKEVDDDPD--KEVYSREKLFLYRITKKSA-------
M2VCS7_COCH5          YFCFKRRRRADLTFMKTARKMFDVQEVDDDPD--KDVYSREKLFLYRITKKKA-------
M2STR1_COCSN          YFCFKRRRRADLTFMKTARKMFDVQEVDDDPD--KDVYSREKLFLYRITKKKA-------
R0JY20_SETT2          YFCFKRRRRADLTFMKTARKMFDVQEVDDDPD--KQIYSREKLFLYRMTKKKV-------
E5R4I7_LEPMJ          YFCFKRRRRADLTFMKTARKMFHVEEVADDPD--KCTWEREKLFLYKITKKR--------
R1ENU5_BOTPV          YFCFKRRRRADLHFIKAIKKTFDVQEVLDDPD--KDVYARQNIFLLKITKRKNGTL----
R7YLR4_CONA1          FFCFKKRRRADMNFVKAIKKMFTVEEVSDDPE--KEVYARENIFL---------------
M3B4T7_PSEFD          YFCFKRRRRADMHFLKAVKKMFVVADVEDDPD--QPNYAKDNIFL---------------
N1PM93_DOTSN          YFCFKRRRRADMHFLKAVRKMFLVEDITDDPD--HERYARENIFLCTIKRKAPLR-----
M3BQA6_SPHMS          YFCFKRRRRADMHFLKTVKKRFLVENVSDDPD--QPQYTRENIFLCTIRRKRAP------
H6BVP9_EXODN          YFCFKKRRKADMRFIRDMTKKFAVEQISYAG---RDSDQREGIFLYQVRKKEKTNSVH--
U1GT42_ENDPU          YFCFMKRRKADWRFIRDMKKQFEVVDAKYDD---QHQDKRDGIYLYEVRRKPRSNAVQKE
S8B9D4_DACHA          LFCFKKRRRADMRFIKAIRRHFTIAEIKEEG---YEGYSRESIFLYTMKKKQP-------
U4LLQ3_PYROM          FFCFKRRRRADLHFVKAIRKRLHIVEVDINNDPDYEAFKRENLFLYIMTKKA--------
F4P186_BATDJ          WIAFKKRRSADRHFWTRLAKTFHVEPITDDPN--HHDYSRKRLFLYKAMLKSPFTKNTVA
S2J6R2_MUCC1          YLTYRKRRNADKLFFQAAKKKFIFKDVTEDPK--MKVYMRDKMHLF-SVTRKPLNQQQLQ
A0A0D1E1Y5_USTMA      LFCYQKRRKADKRFFALLKRSFVFENVQDDDADRCREYQRQGTQLLRIRKK---------
R9NWX4_PSEHS          LFCYQKRRKADKRFFGLLKKNFVFEDVKDDDEVRCREYQRQGTQLLRIRRK---------
V5GR85_KALBG          LFCYQKRRKADKRFFALLKRQFTFEDVKDDDSVRTEEYRRQGTQLLRIRKK---------
M9LSR4_PSEA3          LFCYQKRRKADKRFFGLLRKKFVFTDVTDDDPARTVDYRRQGTQLLRIRKK---------
M5E9B2_MALS4          LFCYHKRRRADKRFFAMMRRHFEQKDVMDDDTARTEAYRRSGTFLMRFHKRT--------
Q5KN92_CRYNJ          LFCWKKRRKADKRFFAMLKKHFAQEIVEDDKPGERERCGREGVTLMRLMRRK--------
G7E6F6_MIXOS          LFCYKKRRKADKRFFVMLRKVFTVTAVVED-FVCHRDFRREAIFLYRLSLRSR-------
A0A060SIR3_PYCCI      LFCYKKRRKADKRFFALLKKEFSWQEVADDPQREA--YSRDAISLLRLSRRK--------
M2R9C0_CERS8          LFCYKKRRKADKRFFTLLKKEFSWSEVMDDPERPN--YTREAISLLRLTRRHASDQRRDV
S8DTD8_FOMPI          LFCFKKRRKADKRFFTLLKKDFTWTEVTDDPDHEI--YAREAISLLRLVRKR--------
S8DXL2_FOMPI          LFCFKKRRKADKRFFTLLKKEFTWTEVADDPDREI--YAREAISLLRLVRKR--------
K5WJK8_PHACS          LFCYKKRRKADKRFFTMLKKKFNWTEVDDDPNKEQ--YNRDAVSLFRPAIEISIASCHK-
F8PQG3_SERL3          LFCFKKRRKADKRFFALLKKKFSWTEIKDDPNRDV--YSREAISLLMLSKRHLGTGPVHN
B0CRW5_LACBS          LFCYKKRRKADKRFFALLKKAFTWEEVQDDPNRSV--YNREAITLLRLSKKLA-------
A8NWW4_COPC7          LFCYKKRRKADKRFFSMLKKKFNWKEVDDDPNRAS--YNREAITLMRLYKVKD-------
V2XMR1_MONRO          LFCYKKRRKADKRFFSLLKKKFIWQEIMDDPHRQI--YSRESIILIRVTRK---------
K5W0U2_AGABU          LFCYRKRRRADKRFFSLLKKRFSWCEVVDDPNRTI--YNKEAITLLRLFKTDGRKGK---
B8PMJ3_POSPM          LFCYKKRRKADRRFFALLRKEFTWTEVLDDPDRDV--YAREAISLLRLTRRQ--------
B8P3X1_POSPM          LFCYKKRRKADRRFFALLRKEFTWTEVLDDPDRDV--YAREAISLLRLSRRR--------
G4TKF2_SERID          LFCYKQRRKADKRFFTLLKKKFTWTDVDDDPQSEV--YRREGISLLRLRPKP--------
M5FRR8_DACPD          LFCYKKRRKADKRFFVLLKKHFEWEEVDDDPERPV--YSRDTISLLRFRRRGVKASF---
D8PKW2_SCHCM          LFCYKKRRKADKRFFNLLKKHFTWSEVTDDPARPI--YNKDAISLFRLHRRH--------
I4YC93_WALMC          LFAYKKRRRADKQFFKMLAKRFKYNQVTDDPDAEI--YNRDSISLFTLERRM--------
R4XA11_TAPDE          YLAYKKRRRADARFFKLLRKDFFVREVDVEPPRRE----KQGIHVYQVIRRDK-------
                       : : :** **        : :                 :    :               

EFM6_YEAST            -------------------------------------
E7QK24_YEASZ          -------------------------------------
E7KHC1_YEASA          -------------------------------------
E7KTP1_YEASL          -------------------------------------
J5P978_SACK1          -------------------------------------
G0VHG6_NAUCC          -------------------------------------
G0WDI3_NAUDC          -------------------------------------
J7S1S8_KAZNA          -------------------------------------
Q6FJE7_CANGA          -------------------------------------
H2AZI3_KAZAF          -------------------------------------
Q6CP15_KLULA          -------------------------------------
Q75AY2_ASHGO          P------------------------------------
G8JRP9_ERECY          A------------------------------------
C5DMN9_LACTC          -------------------------------------
Q6C9L2_YARLI          -------------------------------------
A0A0B1P713_UNCNE      -------------------------------------
K1X0N5_MARBU          -------------------------------------
L8G153_PSED2          K------------------------------------
M7UC15_BOTF1          -------------------------------------
G2XXP1_BOTF4          -------------------------------------
N1JDZ6_BLUG1          -------------------------------------
V6RQR4_GIBZE          RATKSQSDPQSVE------------------------
K3UUC8_FUSPC          KAAKS--------------------------------
F9FJQ3_FUSOF          KATKNQGQPQLSK------------------------
N4UFW0_FUSC1          KATKNQGQPQLSK------------------------
N1RAG4_FUSC4          KATKNQSQPQLSK------------------------
S0E0M6_GIBF5          KTTRKESQPQLSR------------------------
W7LZF3_GIBM7          KSTKKESQSQLSR------------------------
C7YS03_NECH7          AASKSQGETRLAMNGDSQAKDVSS-------------
G9MJ65_HYPVG          SSKKSG--TAANHADPIQIES----------------
G0RT91_HYPJQ          STKKRA--LAANHE--VQIAS----------------
G9PBB1_HYPAI          ASKKKSGMMAANHNGLIETER----------------
E9DY77_METAQ          ---AARGNAGKSCNGVNGINGIGPGGCCNMNNRMQKS
E9ET70_METRA          ---AVRGNAGKNSNGVNGINERH--------------
M1W8T0_CLAP2          RLPAGDVQANASQAGSNGVHESS--------------
T5A6T5_OPHSC          -------------------------------------
J4W6K1_BEAB2          LTEKLADEAAAAAAPTTA-------------------
G0SD92_CHATD          S------------------------------------
G2QAG8_MYCTT          -------------------------------------
Q2HGY2_CHAGB          -------------------------------------
G2QWP9_THITE          -------------------------------------
B2B475_PODAN          -------------------------------------
V5ILY6_NEUCR          -------------------------------------
G4UGZ5_NEUT9          -------------------------------------
F7W4K1_SORMK          -------------------------------------
T0LLH1_COLGC          -------------------------------------
L2FMX8_COLGN          -------------------------------------
N4VLN2_COLOR          P------------------------------------
G2WR35_VERDV          RTPVVQ-------------------------------
A0A0C4E4R7_MAGP6      -------------------------------------
J3NGK6_GAGT3          GKNTGNQ------------------------------
U7Q390_SPOS1          --------AKSVVANGVKPKTQAK-------------
S3D8R6_OPHP1          NGSTNGNGTKRVVKTNSNETRQQQ-------------
F0XCP8_GROCL          -------------------------------------
A0A0A2JGC8_PENEN      -------------------------------------
A0A0A2L210_PENIT      -------------------------------------
B6HFD0_PENRW          -------------------------------------
K9FRE1_PEND2          -------------------------------------
S8B5I5_PENO1          QIPATKETTLLVTEVEK--------------------
A1CGP6_ASPCL          NKASAYRC-----------------------------
Q4WNI7_ASPFU          AIKE---------------------------------
B8NZ42_ASPFN          -------------------------------------
Q2UG14_ASPOR          -------------------------------------
A2QHJ3_ASPNC          -------------------------------------
G3Y9U3_ASPNA          -------------------------------------
C8V996_EMENI          GRDTA--------------------------------
V5FDS0_BYSSN          ASSDA--------------------------------
B6Q2Q4_TALMQ          -------------------------------------
B8LTP5_TALSN          -------------------------------------
C1H9Q5_PARBA          -------------------------------------
C1GD53_PARBD          RS-----------------------------------
C6H7R2_AJECH          RK-----------------------------------
F0U4L8_AJEC8          RK-----------------------------------
C0NIE5_AJECG          RK-----------------------------------
C5G876_AJEDR          RKEEIMQ------------------------------
F2SCS7_TRIRC          -------------------------------------
F2PNY9_TRIEC          -------------------------------------
E5R1Z7_ARTGP          -------------------------------------
C5FCB2_ARTOC          -------------------------------------
E9CVE6_COCPS          SSHST--------------------------------
B2W1N4_PYRTR          -------------------------------------
E3RCY5_PYRTT          -------------------------------------
M2VCS7_COCH5          -------------------------------------
M2STR1_COCSN          -------------------------------------
R0JY20_SETT2          -------------------------------------
E5R4I7_LEPMJ          -------------------------------------
R1ENU5_BOTPV          -------------------------------------
R7YLR4_CONA1          -------------------------------------
M3B4T7_PSEFD          -------------------------------------
N1PM93_DOTSN          -------------------------------------
M3BQA6_SPHMS          -------------------------------------
H6BVP9_EXODN          -------------------------------------
U1GT42_ENDPU          LQRKTG-------------------------------
S8B9D4_DACHA          -------------------------------------
U4LLQ3_PYROM          -------------------------------------
F4P186_BATDJ          STKTVQALS----------------------------
S2J6R2_MUCC1          DLYKLKTL-----------------------------
A0A0D1E1Y5_USTMA      -------------------------------------
R9NWX4_PSEHS          -------------------------------------
V5GR85_KALBG          -------------------------------------
M9LSR4_PSEA3          -------------------------------------
M5E9B2_MALS4          -------------------------------------
Q5KN92_CRYNJ          -------------------------------------
G7E6F6_MIXOS          -------------------------------------
A0A060SIR3_PYCCI      -------------------------------------
M2R9C0_CERS8          -------------------------------------
S8DTD8_FOMPI          -------------------------------------
S8DXL2_FOMPI          -------------------------------------
K5WJK8_PHACS          -------------------------------------
F8PQG3_SERL3          -------------------------------------
B0CRW5_LACBS          -------------------------------------
A8NWW4_COPC7          -------------------------------------
V2XMR1_MONRO          -------------------------------------
K5W0U2_AGABU          -------------------------------------
B8PMJ3_POSPM          -------------------------------------
B8P3X1_POSPM          -------------------------------------
G4TKF2_SERID          -------------------------------------
M5FRR8_DACPD          -------------------------------------
D8PKW2_SCHCM          -------------------------------------
I4YC93_WALMC          -------------------------------------
R4XA11_TAPDE          -------------------------------------