CLUSTAL format seed alignment for MF_03199

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PFA4_CANGA        ------------------------------------------------------------
PFA4_YEAST        ------------------------------------------------------------
PFA4_ASHGO        ------------------------------------------------------------
PFA4_KLULA        ------------------------------------------------------------
PFA4_CANAL        ------------------------------------------------------------
PFA4_DEBHA        ------------------------------------------------------------
PFA4_YARLI        ------------------------------------------------------------
M2T9U0_COCH5      ------------------------------------------------------------
Q0UUW7_PHANO      ------------------------------------------------------------
PFA4_ASPFU        ------------------------------------------------------------
PFA4_EMENI        ------------------------------------------------------------
A7EK21_SCLS1      ------------------------------------------------------------
PFA4_GIBZE        ---------------------------------------------------------MAG
PFA4_NEUCR        ---------------------------------------------------------MTN
PFA4_CRYNH        ------------------------------------------------------------
A8N304_COPC7      ------------------------------------------------------------
PFA4_USTMA        MTNQDPDDGAYPSSQSDDDGIEALAINRQSRPLLAYEDQAAGQSDAFTDRDIPASTAPLT
E3KH04_PUCGT      ------------------------------------------------------------
A8PWF8_MALGO      ------------------------------------------------------------
D5GFW6_TUBMM      ------------------------------------------------------------
                                                                              

PFA4_CANGA        ---MPVKLKWPWLGIAIPSFLIASIGYCAHYFILL------NFLSL----RKQLWYQFCQ
PFA4_YEAST        ---MPVKLRWPWLGIAIPTFLISFIGYGAHYFILS------NFLSV----PKQITFEFCL
PFA4_ASHGO        ---MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLT------NFLSF----KELLWFQVSL
PFA4_KLULA        ---MAIKLKNRWLGVAIPAFLVALIGYGSHYFILS------NFLSW----NEQIFYQTCQ
PFA4_CANAL        ---MAVQLKWPILGVIIPCIIIFSLSYGSHYFILR------HHLTM----KQQLIYEFYV
PFA4_DEBHA        ---MAVQLKWPIIGVVIPCVLIAMVAYGSHYFVFR------TNLSR----TEQILYEVYV
PFA4_YARLI        ----MITFSNPWIGVIIPCIIIFTLSTFSAIYILP------HHVSN----NELTLFICAS
M2T9U0_COCH5      -------MELSQLAVPAVYALILFLGYPSQYLLMQ---LEPAPLSK----NEIIAANVIL
Q0UUW7_PHANO      -------MELSQLAVPSVYVLIFFLGYPSQWLLTQ---LEPRPLTK----NELIFANVIL
PFA4_ASPFU        --MLCRSFNISQLAIPFVSVLISFLAYTSQLFFYY---FEEAPLRS----EEFWRLNIFA
PFA4_EMENI        --MLCSSFSVSRLAIPAVCILIAFLAYTSQIFFLY---FEDAPLKE----DEVWRINILA
A7EK21_SCLS1      ---------------------MSFLTYGSQILFHY---LEPGPLGR----KEMVVFNMCA
PFA4_GIBZE        LNDVPFIKGL---AVPSVCALIIFLGYASQFLFNYSTTLEPGPPTR----RETIIFNGLL
PFA4_NEUCR        LQTGPTTRGLQRFAIPAVCGLIIFLGYYSQYLFNTSADLAPGPLTC----RESLIFNILL
PFA4_CRYNH        ----MAARNWSRVWVGGTVILISFIAFSSQIFVIWPWYGREISLD---LLMLLVPLNLAA
A8N304_COPC7      -----MNPILGRIAVGFVLCLISFIAYTSQIFVIWPWYGREWSIE---LLQLLVPFNILV
PFA4_USTMA        GRRRTPLSWTEVIWVSLTLLLIAVLGYSSQLYVMLPYYEKTPSFSPQALAAVLVPFNLGL
E3KH04_PUCGT      ----MWSIDTGRLWIIGTTSLISFIAFTPQIFIIIPLFDHPSTNPD--CLSLLIPFNILV
A8PWF8_MALGO      --------------------MWPYYQRTPSFTFKQ-------------LAVVLGIFNVLI
D5GFW6_TUBMM      ----MLDHSFSRLAVVGVVLLIAFLAYASQYFLLY------SHLSE----PEYVLFNICV
                                              .   .                           

PFA4_CANGA        TMIWLSYYLAIYTPPGKPPTNFKPSKN---------------------------------
PFA4_YEAST        SMIWLSYYLAICTNPGRPLPNYKPPPD---------------------------------
PFA4_ASHGO        SMIWISYWKAIYKNPGRPTKGFRPLRY---------------------------------
PFA4_KLULA        TMIWVSYYLAIYTNPGIPPKDFKPSAE---------------------------------
PFA4_CANAL        TMIWISYLLAIYTNPGRVPKNYKPSLASSTRIEQTEDDSDGLGLESREDETLIREEPISG
PFA4_DEBHA        CIVWLSYYLAIVVDPGSPPKNFTPKAG---------------------------------
PFA4_YARLI        AMVWISYIIAIIVPPGSPPKNYTPPEN---------------------------------
M2T9U0_COCH5      VLIFITYTQSVFVDPGTIPKDWNVGGAVKAEGKEGTGNEA------------------ED
Q0UUW7_PHANO      VLIFITYTKSVFVDPGRIPKDWAE--------KQELGLSE------------------EK
PFA4_ASPFU        VCIWVCYYRACTVDPGRIPKDWTP---------PNLKQLE------------------KD
PFA4_EMENI        ICIWICYYRACTVDPGHVPKGWMP---------SDRERLK------------------AD
A7EK21_SCLS1      GAMMWCYFRTCHVDPG--EKGWVDRVMIDGVEKENLGKVVREGQG-------------EE
PFA4_GIBZE        LVLWITYYRTVATDPGRYIFKDRV--------IEAEGQ----------------------
PFA4_NEUCR        VCLWLTYYQACTVDPGQYKFPPKE--------KEDGDNNNKR----------------GG
PFA4_CRYNH        FMIFWNYRLCVITSPGTVPEGWRPNIGAM-------------------------DGMEVK
A8N304_COPC7      AILFYNYYLCVTTDPGTVPPGWKPDTHS--------------------------DGYEVK
PFA4_USTMA        LAIYYNYWLCVTTDAGSVPAGWQPEWSALEPVASLAELEHLHLVAEEE------PSLELK
E3KH04_PUCGT      GLLFINYYLCITTDPGRVPKEWDPIGLIESE----------------------EHDRAKI
A8PWF8_MALGO      LYMYYTYYCCVTADAGGVPIGWRVPEG---------------------------------
D5GFW6_TUBMM      ACIWITYARSILTSPGSPPVTWTPVDIDLDNADAEDGS---------------AREETRS
                    :   *       .*                                            

PFA4_CANGA        ---EWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVI
PFA4_YEAST        ---IWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWII
PFA4_ASHGO        ---EWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCVGYKNFPHFIRFLFWII
PFA4_KLULA        ---EWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVI
PFA4_CANAL        DRCEWIRYCKKCNNYKPPRSHHCKICQQCVLQMDHHCPWTLNCVGNNNLPHFMRFLGWII
PFA4_DEBHA        ---EWRRWCKKCQNYKPERSHHCKTCNKCVLKMDHHCPWTYNCVGHNNLPHFLRFVFFLI
PFA4_YARLI        ---GMKMYCLKCKAYKPERTHHSKALGVCVLKMDHHCPWTNNTVGHRNMPHFMRFLVWVD
M2T9U0_COCH5      VVGKSRKWCFRCEAAKPPRAHHCKECKRCIPKMDHHCPWTNNCVSHTTFPHFIRFLFYTT
Q0UUW7_PHANO      KKKITRKWCRKCEAPKPPRAHHCKACKRCIPKMDHHCPWTSSCVSHTTFPHFLRFLVSTT
PFA4_ASPFU        CAGGRQRWCRRCEAFKPPRAHHCKTCQRCIPKMDHHCPWTSNCVSHFTYPHFMRFLFYAV
PFA4_EMENI        RASGRQRWCRRCEAYKPPRAHHCKTCERCVPKMDHHCPWTSNCVSHFTFPHFARFLFYAV
A7EK21_SCLS1      IEEKNVRWCKKCDAVKPPRAHHCKRCKRCIPKMDHHCPWTNNCVSHTTFPHFVRFLFYSV
PFA4_GIBZE        ------RWCNKCAAPKPPRAHHCRHCARCVPRMDHHCPWTRNCVSMTTFPHFLRFLIYTN
PFA4_NEUCR        RGPQKAKWCKKCDAPKPPRAHHCRHCARCIPRMDHHCPWTGNCVSLQTFPHFLRFLVYTN
PFA4_CRYNH        KGTHTPRYCKNCAHYKPPRAHHCRQCKTCWLKLDHHCPWIGNCVGFYNQGHFIRFLLWVD
A8N304_COPC7      KLTGEPRYCRMCQCYKPPRTHHCRDCNRCVLRMDHHCPWINNCVGHHNYSHFLRFLFYVD
PFA4_USTMA        QAIYRPRYCKTCSAFKPPRSHHCKTCQRCVLRMDHHCPWLANCVGHFNHAHFIRFLFYVD
E3KH04_PUCGT      LSLGQLRFCRACKVSKPPRAHHCRTCKRCVLKMDHHCPWVNNCVGHHNYGHFLRFLGFVD
A8PWF8_MALGO      --CHYKRYCFKCRAFKPPRAHHCRVCRRCVLRMDHHCPWIGNCVGFGTYAYFLQYTTSVM
D5GFW6_TUBMM      LVSRGAKWCRKCNAYKPPRCHHCKTCGVCVVRMDHHCPWTNNCVGWRNFPHFLKFLGYSA
                         :*  *   ** * **.:    *   :******  . *.  .  :* ::     

PFA4_CANGA        VGTTSLAIFLTTR-IHSIWV-HRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL
PFA4_YEAST        VTTSVLFCIQAKR-IYFIWQ-QRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCL
PFA4_ASHGO        ATTGILLHYFVKR-IKFTWV-NRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCV
PFA4_KLULA        FSTAYLLFLLIGR-IYLLWS-IRHTAFHHRSTSEIIFICIMTPMDAFVLLTVSSLLGRCI
PFA4_CANAL        WGTGYLMIQLIKL-IINYYE-NSNMPHYLFNKTELVAIIAITPLNFFVFASILVLFIRCL
PFA4_DEBHA        VGMTYVLFQLGKQ-VLHYYD-SSKLPSYLIDKKEMCAVIFLLPVTFFVFVSIIILFVRCM
PFA4_YARLI        MTVGYLFIRLCIR-IMKLWR-DKHLPSYLFDKTEVILSIVFLPASFFVLFTVGILTIRVF
M2T9U0_COCH5      VGLSLLETFIFTR-LSYLWS-NLDMPSSMGPSPFQLAHLFTILMVNSLTLFILGILFLRN
Q0UUW7_PHANO      VGLSFLQLLLFTR-LSHLWN-SRHLPASLGPSPFLLFHLFATTLANSLTLFAVGILALRN
PFA4_ASPFU        VGMGYLETLLFER-ASIVWA-SRHLPSYLGPGLGQLVHLFILLVVNSLTWLALFILLLRS
PFA4_EMENI        VGIAYLETRLWQR-VSKVWG-SRHLPSYLGPSMGQIGHLFVLFVTNSLTLFALSLLLLRT
A7EK21_SCLS1      VSIIVLSTFLFTR-LSYVIS-ESTLPSYLGPSTTSLTMLFIIFCSNGLSLFAMSLLLMRT
PFA4_GIBZE        MSLWMLGYFLWQR-FSKIWE-HRRLPAYLGPSFYGLICLSLISIVNFVTTVALGIMLINT
PFA4_NEUCR        AALVYFARLLWTRLYYGLWD-QRHVPAYLGPSVGALLGCTMLSIAWFATQFALMVLLVTT
PFA4_CRYNH        IGTTFHLIIMVRRVL-------YIAEYYHEPTLADVLFLVFNFATCVPVWLCVGMFSIYH
A8N304_COPC7      VACSYHLAMVGKRTLDAMSGNYFWASVHIEPTATELVITIMNFVACVPVLLAVGGFSIYH
PFA4_USTMA        VTCLYHLIMISCRVLDS----FNSYTYWREPCARELVWLVVNYALCIPVILLVGIFSLYH
E3KH04_PUCGT      LACWYHIWMISKR-------VFGEFAYGPEPSKTEMIILVLNYVSCLPVILAVGVFSLYH
A8PWF8_MALGO      ISCSYHLVMTTMR----VFDAWNTYYYMSHPTTLEASMLVVNYLLCIPTFLLVSFLTLYH
D5GFW6_TUBMM      FTCCWLFCLLVER-GWEVWVRRDLPSYMSPHTFLELCLLAVLLVTDLLVAFSLSLLFIRT
                                                                              

PFA4_CANGA        FNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIF-----PNLRNEHV-------
PFA4_YEAST        FNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIY-----PESRSFQN-------
PFA4_ASHGO        KNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIY-----PGSLEGQ--------
PFA4_KLULA        YNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERR-----PEILPAK--------
PFA4_CANAL        INI-CKGMTQIEIWEWERLELQWSSKRLWRLIRFNYGRLHKGKPFPELNTWTNTTNNVNY
PFA4_DEBHA        INLLFRGMTQIEVWEMERIGSQFHTERLWLQIRKNYFKLH-GKEMPHLVSWNRTTRYYEV
PFA4_YARLI        VNM-CNGITQIESWECDRIESLV-------------------------------------
M2T9U0_COCH5      VWCLAVNTTTIEGWEIERHRTLLRRA---RQHGGYLPSPDGT------------------
Q0UUW7_PHANO      IWVLAINVTTIEGWEIERHRTLLRRA---RHFGGYLETPDG-------------------
PFA4_ASPFU        IWSLALNTTTIESWEIERHETLLRRA---RHFGGYLSGPGG-------------------
PFA4_EMENI        LWSLGSNTTTIESWEIERHETLLRRA---RRLGGSLPGPGG-------------------
A7EK21_SCLS1      IYSLATNTYMIEAWEIERHDAIIERSKT-RNMRGYVYANGG-------------------
PFA4_GIBZE        VKSWVFNQTMIEGWEQERHEALMDKGPK--EWWDIMGPDGE-------------------
PFA4_NEUCR        VRSWMLGKTMIEEWEAERHETLLARSYDGDDYWGADGHGG--------------------
PFA4_CRYNH        VYLACGNSTTIEGWEKDKVATLIRRG----------------------------------
A8N304_COPC7      LFNLLGNSTTIEGFEKDKVATMIRKG----------------------------------
PFA4_USTMA        FYCLAVNQTTIESWEKDRTATMIRRG----------------------------------
E3KH04_PUCGT      LWAVLSNTTTIEGWEKEKARELRRKG----------------------------------
A8PWF8_MALGO      YYLLSTNTTSIESWEMDRVYRQIRRG----------------------------------
D5GFW6_TUBMM      LWSTGEGYTTIETWEQDRHNALVRQK----------------------------------
                        .   ** :: ::                                          

PFA4_CANGA        ------------------ESQAEALLNKKRLSLDELVNFPYDLGPFRNAIQLLG---TPP
PFA4_YEAST        ------------------KKDAEEHLTKKRPRFDELVNFPYDFDLYTNALLYLG---PIH
PFA4_ASHGO        ------------------EKEVEEFLSSSTCSFDEVINFPYDINPWVNLLNCMG---SPL
PFA4_KLULA        ------------------QHEINKLLSKRYVNQEDFTNFPYDVNPWTNINNAMG---PWY
PFA4_CANAL        NDNDDDGDEDVELINLATNNNEDSTIVPQNFTIDDLI-FPYNLGIWKNLVNALG---YPY
PFA4_DEBHA        DENSNN------------DNSNENNIVPKDFTSDDIV-FPYDLGVSSNMINACD---YPW
PFA4_YARLI        ---------------------------RRKIVTEERAEFPYDIELFTNIFNAVG---SPL
M2T9U0_COCH5      -----------------------------QQIRIRKQEFPYDIGIWANIVQGMN-SANPI
Q0UUW7_PHANO      -----------------------------QAIRIKKQEFPYDIGILRNICQGMG-SANPL
PFA4_ASPFU        -----------------------------IQIRIKKQEFPYDIGIWSNIRAGMGGSANVL
PFA4_EMENI        -----------------------------ISVHITKQEFPYDIGIWSNIRAGMGGSANVL
A7EK21_SCLS1      -----------------------------RKVRVEKVEFPFDIGIWENIVQAMG-TANIL
PFA4_GIBZE        ------------------------------KVRFERLEFPYDIGFFSNMAQAMG-THNVL
PFA4_NEUCR        -------------------------------FVPVKVEFPYDNGFWSNMAQAMG-TNNFL
PFA4_CRYNH        --------------------------------KIKEVKYPYNIGIYKNIKSVLG--PNPL
A8N304_COPC7      --------------------------------QIQEVKFPYDLGRMRNIKAVLG--DNPL
PFA4_USTMA        --------------------------------RVRKVKYPYDLGLWRNVRQVLG--ASPL
E3KH04_PUCGT      --------------------------------RIQQFTYPFSIGIYRNLQVVLG--PNPL
A8PWF8_MALGO      --------------------------------HIPFTTFPFDVGCWQNISSILG--SRPW
D5GFW6_TUBMM      --------------------------------RVRRQQFPYDIGTWDNLCSAFCGSSNIM
                                                        :*:.     *            

PFA4_CANGA        LWLYPFSGP----------QDDGLHFQKNEESMIE---DPNSLNDIILCLPWPPDSTKHL
PFA4_YEAST        LWLWPYGVP----------TGDGNNFPKNGISKYE---ANSSLEDHILSLPWPPDGGKTN
PFA4_ASHGO        NWLNPFGGP----------KADGMVFQKNEISDYD---EATSIQDKLLALPWPPDDTRHG
PFA4_KLULA        LWLWPWSKP----------PTIGTSFAKNELFFYD---PNSSIEDMLMSLPWPPDGLTHH
PFA4_CANAL        MWLIPFGKP----------KSNGYQPQI----------SQDYKQDDQLNLPWPPDGIRQK
PFA4_DEBHA        MWLLPWGGP----------RENGYHFQ-----------KNEFMEDDQLGLPWPPDGGHQE
PFA4_YARLI        TFWLPWGQP----------RGDGITFEK----------NESGYTEEGEPLCWPPDHVDYD
M2T9U0_COCH5      AWLNPFDAT--------PSLASGLAFET------------NGFESPGTVWPPPDPDRAYR
Q0UUW7_PHANO      MWFNPLAPS--------PSVQSALQFEV------------NGFEDEGTVWPPPDPDRSYK
PFA4_ASPFU        SWFWPFAAT--------PDRSTGLEFEV------------NGFEDPNLSWPPPDPDRIPL
PFA4_EMENI        SWFWPLART--------PDRSTGLEFEE------------NGFEDPTVSWPPPDPDRIPL
A7EK21_SCLS1      MWFNPFAGG--------PSVQSAGKWEE------------NGFNDKEGMWPPPDPDK-LG
PFA4_GIBZE        LWFFPFAGN-PTVAKDG--NGQGWTWEE------------NGFNRIEGLWPPPDPDKLRR
PFA4_NEUCR        RWFLPVGGGGPKISNDTPWKGTGWEYEE------------NGFNDRVGMWPPPDPEKLRR
PFA4_CRYNH        LWLWP---QKMQ--------GDGLSFPVNPSAGDH---------MTQYFWPPQDPSR-LP
A8N304_COPC7      FWCWP---QRMP--------GNGLKFELAHHAEDEEEKKYKHTSHEHQVWPPRDPDS-VG
PFA4_USTMA        VWCLPGAGARMA--------GDGLKYPVANGLDSG----------SQYRWPPKDPSRPHP
E3KH04_PUCGT      LWWLPQRMS-----------GDGLRYPTL----------ATIDPLEQYLWPPRDLFTRRA
A8PWF8_MALGO      LWPLPKAPR-----------GDGLAFPVAPLQ---------DDPFAMYAWPPRDPHARLA
D5GFW6_TUBMM      GWFWPLSRT--------KEVGVEIKGSDGLKLKGGLEWELNGYEVVGATWPPLDPDKGVW
                   :  *                                                       

PFA4_CANGA        -----NSTSEHTSNVQIISEEGE--------QVIRIRTPE--------------------
PFA4_YEAST        -----TVFNHGSSTIEMRNESGE--------QLIRTRLPQNG------------------
PFA4_ASHGO        -----IAFP-SVSHVEKDTQGGE--------QVVRRRHVPI-------------------
PFA4_KLULA        -----SRALGSGSSIETIVSGGE--------QVIRDKSVDLR------------------
PFA4_CANAL        EIEI-NVLQQQGYQRDREEEDEEELRSIRNYQELRRRLDPR-------------------
PFA4_DEBHA        --------PMAPVDDDFDISDSE----LQDMPSLRRRLDPR-------------------
PFA4_YARLI        P----ENVPLQNLKDGLRRRGEEP--DCLLGGIGAGKMQAEN------------------
M2T9U0_COCH5      RNAK-AVNVGAFQFAEAPEMSAEETIKAFKARQAEDALRRRGYGGQAQQRVVEDEEEEAE
Q0UUW7_PHANO      KVER-GAEGEAFVFGGEGE--GEDTIKAFRARQAQDVVRRR-------KPFVERLEERVD
PFA4_ASPFU        PAKR-ED---MSAAIAAADASYHRALQARNIQRSND-ASHS---------GGHPIQRRKR
PFA4_EMENI        PPMD-QRDSFMYDITDTSGTSGQIDIEAFNRRKEADLRRRR---------APTEIERRKP
A7EK21_SCLS1      RRAG-CHGVETYPLEEKVYGSVEEERDAFRKRQEADLKRWK----------KDHLNTASN
PFA4_GIBZE        -----AARGWPAGNRNYAEELRQANMS--SSEYKAGFLKRQ----------ADDEKRKR-
PFA4_NEUCR        ERAG-AGGKWPGARENLNTEKPEVDYYRSSEDMKTAFKRRQ----------QEDLRRRQQ
PFA4_CRYNH        NPPP-IPAHASPFVYGNNGFNPNLRPTNSLRARRSS--TPRID----------EDEYSHE
A8N304_COPC7      RPK--IDLSASPFTYGNDTLNPELQPTNLRRRSFNGRGPPAHA----------LPPYHPD
PFA4_USTMA        SRRT-WASSSSPFTYP-ERSNPILDPTLSTRFPHNSSPSSSDS----------HSSLHLP
E3KH04_PUCGT      PQLRRRQFEKEAFTYGEERLNPDLIPSGSMRGQSVPQGVPRRT----------VSPYHAD
A8PWF8_MALGO      RPSMRRMRTRPGIHVQNDVHDNVQAPRFVQHHDGPLPSLQDANHAADDHTAHLTDMYDSY
D5GFW6_TUBMM      MGANAPMPAAVNDGGDWAEGVRRRQKEDMERREGISRPQDAIVTSAIS------------
                                                                              

PFA4_CANGA        ---------------------------------------KKLSRS---EWLNDWGESLED
PFA4_YEAST        ---------------------------------------RHASRE---KWYNDWGESLDD
PFA4_ASHGO        ---------------------------------------AVPPRN---EWYNDWGESLEH
PFA4_KLULA        ---------------------------------------DRLGRN---SWYNDWGEDLSD
PFA4_CANAL        ---------------------------------------LNVQRS---DFINDMGEGLTD
PFA4_DEBHA        ---------------------------------------NNMTRS---EWMNDLGETLDD
PFA4_YARLI        ---------------------------------------DFYKRD---HWRNVEGEKLAD
M2T9U0_COCH5      YGNTRDDDGGYTYGDDASDDAQEEEEESEKKYGEK----GREGEA---AWRNAEGERLKD
Q0UUW7_PHANO      RDGYEDE---YEYGEEASDGEEEEKES----YGE------GEGEE---GWRNSEGERLQD
PFA4_ASPFU        FHDRFNE---NKAKERLSESESDFSDD------EE----VQDGEE---GWKNSEGDRLRD
PFA4_EMENI        FHVRLEE---YSNGS--SDAEADTGSD------DD----SDHGEE---GWKNSEGERLRD
A7EK21_SCLS1      GGDGFYE-------EDDDEDEDEDEDEKYVSEYEE----GLDGKE---GWTNSEGDRLRD
PFA4_GIBZE        -------------HLMAELEEVDDFDMYDDEEYDR----ELDQGL---GWVNSDGDRLRD
PFA4_NEUCR        RRQHSSE----EDEIMAELEEDEGYEQRS--RTRS----PPQDGR---AWMNSEGDTLWD
PFA4_CRYNH        QGRHYSSGDERDNGSISASSSPEPYLSDYDHYDEG----PMYPGERMTTLVPRVRRGSEG
A8N304_COPC7      YQEGYFVGED---GSWDESD---------EVCSEG----DVPDGR------VRVRRGSEG
PFA4_USTMA        HPPSLLDPLPHHFDPPHDPD------------TQP----VNCPKR------VSVRRGSEG
E3KH04_PUCGT      YDVESDE-------SEESDSGRLANGHAVDFSASD----EEPLSTLVARRNQASGVPSHQ
A8PWF8_MALGO      SSDGHEDDHALDGYDDDIDDQHSYAPSGHVRVRRGSEGYEVIPPHYARALWEDQGAAAFP
D5GFW6_TUBMM      ---------------------------------------NGSSKVIAPKWMNEEGETLAD
                                                                              

PFA4_CANGA        FGVDVDVE----------------------------------------------------
PFA4_YEAST        FGVDVDME----------------------------------------------------
PFA4_ASHGO        FGVDVEVE----------------------------------------------------
PFA4_KLULA        FGVDTELE----------------------------------------------------
PFA4_CANAL        FGVDEDSD----------------------------------------------------
PFA4_DEBHA        FGVDLDAEDIEHDDLVSKDEISNN------------------------------------
PFA4_YARLI        FGVEHTDI----------------------------------------------------
M2T9U0_COCH5      FGVDEDVEFYDE-------------------------QEDDIPLSRLIARRQGASTSGYS
Q0UUW7_PHANO      FGVDEDVEFYDE-------------------------QEDEIPLAELMARIQ-AASSGAS
PFA4_ASPFU        FGVDEEAEFYD---------------------------EEDIPLGILMQRRRQQ------
PFA4_EMENI        FGVDEEAEFYD---------------------------EEDIPLALLIQQRAKRQHLSQ-
A7EK21_SCLS1      YGVDEEVDIMD---------------------------EDDIPLGELLRRRKARNFESA-
PFA4_GIBZE        YGVDEEASE-----PEGVND------------DDDDDDDDDVPLAELIRRRKILKKDGLD
PFA4_NEUCR        YGVDVDEEENYGYPGQGVSESLPLVKTATGYNDGQGDEDEDVPLAELIRRRK-VKSNGVH
PFA4_CRYNH        WEVAPGGGWNAYAGMMDEEVGWDDEAGYDEAPGEDPYVERPWEMRGRYNVYDPEEESGYT
A8N304_COPC7      YEVKPQS-REDMLRRYIEELG-EDPYRYNRYEPE-PFTESEEESDDDNIPLARVAATDKN
PFA4_USTMA        YEVRPHTPWSV-------------------------------------------------
E3KH04_PUCGT      AAVMARRPLVRRGSEGVEIKPVGPHWSPAEFSADPLVDQPTHDDERWLQVEGSEGSDGWD
A8PWF8_MALGO      PGTEPPPLPSQLWRSDLSPAGADKEGWPEYPHGTFAAYGSHVDDDEDYDDDLPLATLRGA
D5GFW6_TUBMM      YGVDDDD--------------------------------EDVPLAELMRKRAGWGKSNTD
                    .                                                         

PFA4_CANGA        --
PFA4_YEAST        --
PFA4_ASHGO        --
PFA4_KLULA        --
PFA4_CANAL        --
PFA4_DEBHA        --
PFA4_YARLI        --
M2T9U0_COCH5      RP
Q0UUW7_PHANO      YP
PFA4_ASPFU        --
PFA4_EMENI        --
A7EK21_SCLS1      --
PFA4_GIBZE        D-
PFA4_NEUCR        E-
PFA4_CRYNH        H-
A8N304_COPC7      V-
PFA4_USTMA        --
E3KH04_PUCGT      --
A8PWF8_MALGO      P-
D5GFW6_TUBMM      --