CLUSTAL format seed alignment for MF_03212

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NCPR_YEAST            -------------------MPFGIDNTDFT--------------------------VLAG
Q75F49_ASHGO          -------------------MALKFDKLDFA--------------------------VICA
NCPR_CANMA            ---------------------MALDKLDLY--------------------------VIIV
NCPR_CANTR            ---------------------MALDKLDLY--------------------------VIIT
NCPR_ASPNG            --------------------MAQLDTLDLV--------------------------VLAV
NCPR_ASPNC            --------------------MAQLDTLDLV--------------------------VLAV
NCPR_ASPOR            --------------------MAQLDTLDLV--------------------------VLVA
NCPR_EMENI            --------------------MAQLDTLDVV--------------------------VLAV
NCPR_ASPTN            --------------------MAQLDTLDLV--------------------------VLVV
NCPR_ASPFU            --------------------MAQLDTLDIV--------------------------VLVV
NCPR_SCHPO            -----------------------MKTYEYV--------------------------LLVI
NCPR_BOVIN            -MADSNMDAGTTTSEMVAEEVSLFSTTDVI------------------------LFSLIV
NCPR_PIG              -MGDSNVDTGTTTSEMVAEEVSLFSATDMV------------------------LFSLIV
NCPR_HUMAN            -MGDSHVDTSSTVSEAVAEEVSLFSMTDMI------------------------LFSLIV
NCPR_RABIT            -MADSHGDTGATMPEAAAQEASVFSMTDVV------------------------LFSLIV
NCPR_RAT              -MGDSHEDTSATMPEAVAEEVSLFSTTDMV------------------------LFSLIV
NCPR_MOUSE            -MGDSHEDTSATVPEAVAEEVSLFSTTDIV------------------------LFSLIV
NCPR_CAVPO            -MGDSHVDTGATSTEAVAEEVSLFSMTDMI------------------------LLSVLV
NCPR_DROME            -MASEQTIDGAAAIPSGGGDEPFLGLLDVA------------------------LLAVLI
NCPR_MUSDO            -MSAEHVEEVVS-------EEPFLGTLDIA------------------------LLVVLL
Q09590_CAEEL          ---------------MLAWIVSGLDTSDLV------------------------VLTLLA
NCPR_CATRO            -MDSSSEKLSPFELMSAILKGAKLDGSNSSDSG--VAVSPAVMAMLLENKELVMILTTSV
NCPR2_ARATH           MSSSSSSSTSMIDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSI
NCPR_VIGRR            -MASN---SDLVRAVESFLGVSLGDSVSD---------------------SLLLIATTSA
NCPR1_ARATH           -MTSALYASDLFKQLKSIMGTD--SLSDD---------------------VVLVIATTSL
NCPR_DICDI            -----------MEILESIDFIEVLILDNLG-------------------------AIIIV
NCPR_PHACH            -----------------MAVSSSSDVIVLS--------------------------VGII
Q5KIY3_CRYNJ          -------------------MLSAIDIVIIT--------------------------LTIA
A0A0D1CA24_USTMA      -------------------MASQLDLFVLG--------------------------LGGL
                                                                                  

NCPR_YEAST            LVLAVLLYVKRNSIKE----LLMSDDGDITAVSSG--NRDIAQVVTENNKNYLVLYASQT
Q75F49_ASHGO          LALAVVAYLKLDVLKE----LFAADDSALAVQSS---SRDIVEVLRENKKDYLVVYASQT
NCPR_CANMA            LAVAVAAYFAKNQFLD----QPQ-DTGFLSNDTAGGNSRDILETLKKNNKNTLLLFGSQT
NCPR_CANTR            LVVAIAAYFAKNQFLD----QQQ-DTGFLNTDSGDGNSRDILQALKKNNKNTLLLFGSQT
NCPR_ASPNG            LLVGSVAYFTKGTYWAVAKDPYASTGPAMNGAAKAGKTRNIIEKMEETGKNCVIFYGSQT
NCPR_ASPNC            LLVGSVAYFTKGTYWAVAKDPYASTGPAMNGAAKAGKTRNIIEKMEETGKNCVIFYGSQT
NCPR_ASPOR            LLVGSVAYFTKGTYWAVAKDPYASSGPAMNGAAKAGKTRDILEKMEETGKNCVIFYGSQT
NCPR_EMENI            LLAGSIAYFTKGTFWAVAKDPYASSGPAMNGVAKAGKSRNIIEKMDETGKNCVIFYGSQT
NCPR_ASPTN            LLVGSAAYFTKGTYWAVPKDPYAASGPAMNGGAKAGKSRDIIEKMEETGKNCVIFYGSQT
NCPR_ASPFU            LLVGSVAYFTKGSYWAVPKDPYAAANSAMNGAAKTGKTRDIIQKMEETGKNCVIFYGSQT
NCPR_SCHPO            ILILSLCYFIYNNFLNKPKAPER----------RVVATDSIVELMEAEKLTAAVFFGSQT
NCPR_BOVIN            GVMTYWFLFRKKKEE--VPEFTKIQTTTSS--VKDRS---FVEKMKKTGRNIIVFYGSQT
NCPR_PIG              GLLTYWFIFRKKKDE--VPEFSKIETTTSS--VKDSS---FVEKMKKTGRNIIVFYGSQT
NCPR_HUMAN            GLLTYWFLFRKKKEE--VPEFTKIQTLTSS--VRESS---FVEKMKKTGRNIIVFYGSQT
NCPR_RABIT            GLITYWFLFRKKKEE--VPEFTKIQAPTSSS-VKESS---FVEKMKKTGRNIVVFYGSQT
NCPR_RAT              GVLTYWFIFRKKKEE--IPEFSKIQTTAPP--VKESS---FVEKMKKTGRNIIVFYGSQT
NCPR_MOUSE            GVLTYWFIFKKKKEE--IPEFSKIQTTAPP--VKESS---FVEKMKKTGRNIIVFYGSQT
NCPR_CAVPO            GFLTYFFLFRKKKEE--IPEFTKISTTTSS--VKESS---FVEKMKKTGRNIIVFYGSQT
NCPR_DROME            GGAAFYFLRSRKKEEEPTRSYSIQPTTVCTTSASDNS---FIKKLKASGRSLVVFYGSQT
NCPR_MUSDO            VGATWYFMRSRKKEEAPIRSYSIQPTTVSTVSTTENS---FIKKLKASGRSLVVFYGSQT
Q09590_CAEEL          GGAIIFLFMKVFNQQPSSSRYSPTVASVTTSAAASKSNQSFIDRMKNENRQVLIMYGSQT
NCPR_CATRO            AVLIGCVVVLIWRRS--SGSGKKVVEPPKLIVPKSVVE---PEEIDEGKKKFTIFFGTQT
NCPR2_ARATH           AVLIGCIVMLVWRRS--GSGNSKRVEPLKPLVIKPRE-----EEIDDGRKKVTIFFGTQT
NCPR_VIGRR            AVVVGLLVFLWKKSS-DRSKEVKPVVVPRDLMMEEEEE----VDVAAGKTKVTIFFGTQT
NCPR1_ARATH           ALVAGFVVLLWKKTTADRSGELKPLMIPKSLMAKDEDD---DLDLGSGKTRVSIFFGTQT
NCPR_DICDI            AVIVGTYLYMNKPPP-PPPVFNKPNNKINKEAQKPKKT---ITKNEDGKKVMKIFFGTQT
NCPR_PHACH            LAALYLFREQIFSAAKPKTVQVPSS---KAAAGGNGNPRDFIAKMKEGKKRIVIFYGSQT
Q5KIY3_CRYNJ          LPLLFFFRESLPFIGGKTRAAAPHAAIANKASVDEGDPSDFVGKMTRANKRCVIFYGSQT
A0A0D1CA24_USTMA      LAVLYLFRDSLFGGAKDTGSKLANGA--PLAATDQGG-ADFVSKLKSQNKRIAIFYGSQT
                                                                           :.:.:**

NCPR_YEAST            GTAEDYAKKFSKELVAK-FNLNVMCADVENYDFESLNDVP-----VIVSIFISTYGEGDF
Q75F49_ASHGO          GTGEDYAKKFAKELAAK-YSLNVMCVDVENYDFDNLNSLPKD---VIVSFFVSTYGEGDL
NCPR_CANMA            GTAEDYANKLSREIHSR-FGLKTMVADFADYDWDNFGDIPND---ILVFFIVATYGEGEP
NCPR_CANTR            GTAEDYANKLSRELHSR-FGLKTMVADFADYDFENFGDITED---ILVFFIVATYGEGEP
NCPR_ASPNG            GTAEDYASRLAKEGSQR-FGLKTMVADLEEYDYENLDQFPED---KVAFFVLATYGEGEP
NCPR_ASPNC            GTAEDYASRLAKEGSQR-FGLKTMVADLEEYDYENLDQFPED---KVAFFVLATYGEGEP
NCPR_ASPOR            GTAEDYASRLAKEGSQR-FGLKTMVADLEDYDYENLDKFPED---KVAFFVLATYGEGEP
NCPR_EMENI            GTAEDYASRLAKEGSQR-FGLKTMVADIEEYDYENLDQFPED---KVAFFVLATYGEGEP
NCPR_ASPTN            GTAEDYASRLAKEGSQR-FGLKTMVADLEDYDYENLDKFPED---KVAFFVMATYGEGEP
NCPR_ASPFU            GTAEDYASRLAKEGSQR-FGLKTMVADLEDYDYENLDKFPED---KIAFFVLATYGEGEP
NCPR_SCHPO            GTAEDFAYRFSTEAKAN-FNLTNMVFDLENYDLTDLDNFDRS---KLLVFFLATYGEGEP
NCPR_BOVIN            GTAEEFANRLSKDAHRY--GMRGMAADPEEYDLADLSSLPEI-EKALAIFCMATYGEGDP
NCPR_PIG              GTAEEFANRLSKDAHRY--GMRGMAADPEEYDLSDLSSLPEI-ENALAVFCMATYGEGDP
NCPR_HUMAN            GTAEEFANRLSKDAHRY--GMRGMSADPEEYDLADLSSLPEI-DNALVVFCMATYGEGDP
NCPR_RABIT            GTAEEFANRLSKDAHRY--GMRGMAADPEEYDLADLSSLPEI-NNALAVFCMATYGEGDP
NCPR_RAT              GTAEEFANRLSKDAHRY--GMRGMSADPEEYDLADLSSLPEI-DKSLVVFCMATYGEGDP
NCPR_MOUSE            GTAEEFANRLSKDAHRY--GMRGMSADPEEYDLADLSSLPEI-DKSLVVFCMATYGEGDP
NCPR_CAVPO            GTAEEFANRLSKDAHRY--GMRGMAADPEEYDLADLSSLPEI-DNSLAVFCMATYGEGDP
NCPR_DROME            GTGEEFAGRLAKEGIRY--RLKGMVADPEECDMEELLQLKDI-DNSLAVFCLATYGEGDP
NCPR_MUSDO            GTAEEFAGRLAKEGLRY--RMKGMVADPEECDMEELLQMKDI-PNSLAVFCLATYGEGDP
Q09590_CAEEL          GTAEEMSGRLAKDLTRY--TKKAVVVDPEDIECEDLNRLSEV-EDALLVLCIATYGEGDP
NCPR_CATRO            GTAEGFAKALAEEAKARYEKAVIKVIDIDDYAADDEEYEEKFRKETLAFFILATYGDGEP
NCPR2_ARATH           GTAEGFAKALGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEP
NCPR_VIGRR            GTAEGFAKALAEEIKARYEKAAVKVVDLDDYAADDDLYEEKLKKESLVFFMLATYGDGEP
NCPR1_ARATH           GTAEGFAKALSEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLAFFCVATYGDGEP
NCPR_DICDI            RTAEDFSRIIEKECKKI--GIPCEVVDLESYEH-----EQELHSESFVMFLVATHGEGDP
NCPR_PHACH            GTAEEYAIRLAKEAKSK-FGLASLVCDPEEYDFENLDQVPED---CCVFFVMATYGEGEP
Q5KIY3_CRYNJ          GTAEEYAIRLAKEAKSR-YGLSSLVCDPEEYDMNMLDQVPED---ACVIFVMATYGEGEP
A0A0D1CA24_USTMA      GTAEEYATKLAKEAKAR-FGTSSLVLDPEEYEFDKLDQMPQD---TVAVFVMATYGEGEP
                       *.*  :  :  :             *  .                   : ::*:*:*: 

NCPR_YEAST            PDGAVNFEDFICNA----------EAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSA
Q75F49_ASHGO          PDGGLEFEEWLQVL----------EEGDLGNVRYTMFGLGNSTYEFYNGAAEKTQKLLKQ
NCPR_CANMA            TDNADEFHTWLTD-----------EADTLSTLRYTVFGLGNSTYEFYNAIGRKFDRLLEE
NCPR_CANTR            TDNADEFHTWLTE-----------EADTLSTLKYTVFGLGNSTYEFFNAIGRKFDRLLGE
NCPR_ASPNG            TDNAVEFYQFFTGDDVAFES-ASADEKPLSKLKYVAFGLGNNTYEHYNAMVRQVDAAFQK
NCPR_ASPNC            TDNAVEFYQFFTGDDVAFESGASADEKPLSKLKYVAFGLGNNTYEHYNAMVRQVDAAFQK
NCPR_ASPOR            TDNAVEFYQFITGEDVAFESGASAEEKPLSALKYVTFGLGNNTYEHYNAMVRNLDAALQK
NCPR_EMENI            TDNAVEFYQFITGDDVSFEGGGSAEDKPLSSLKYVAFGLGNNTYEHYNAMVRQVDAALTK
NCPR_ASPTN            TDNAVEFYQFISGEDVAFESGASADDKPLSSLKYVTFGLGNNTYEHYQAMVRNLDAALTK
NCPR_ASPFU            TDNAVEFYQFITGEDVAFESGASAEEKPLSSLKYVAFGLGNNTYEHYNAMVRHVDAALTK
NCPR_SCHPO            TDNAEAFLQLLEGDDTVFSSGKGIEDTPFEGIRYAIFGLGNHTYEYYNAMAKKVDAAMTR
NCPR_BOVIN            TDNAQDFYDWLQE-----------TDVDLSGVKYAVFALGNKTYEHFNAMGKYVDKRLEQ
NCPR_PIG              TDNAQDFYDWLQE-----------ADVDLTGVKYAVFGLGNKTYEHFNAMGKYVDKRLEQ
NCPR_HUMAN            TDNAQDFYDWLQE-----------TDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQ
NCPR_RABIT            TDNAQDFYDWLQE-----------TDVDLSGVKYAVFGLGNKTYEHFNAMGKYVDQRLEQ
NCPR_RAT              TDNAQDFYDWLQE-----------TDVDLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQ
NCPR_MOUSE            TDNAQDFYDWLQE-----------TDVDLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQ
NCPR_CAVPO            TDNAQDFYDWLQE-----------TDLDLSGVKYAVFGLGNKTYEHFNSMGKYVDQRLEQ
NCPR_DROME            TDNAMEFYEWITS-----------GDVDLSGLNYAVFGLGNKTYEHYNKVAIYVDKRLEE
NCPR_MUSDO            TDNAMEFYEWITN-----------GEVDLTGLNYAVFGLGNKTYEHYNKVAIYVDKRLEE
Q09590_CAEEL          TDNAVTLVEYLNA-----------GDCDLSGVRFAVFGLGNKTYEHFNEIGIQMDKQLEK
NCPR_CATRO            TDNAARFYKWFVE--------GNDRGDWLKNLQYGVFGLGNRQYEHFNKIAKVVDEKVAE
NCPR2_ARATH           TDNAARFYKWFTE--------GNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVE
NCPR_VIGRR            IDNAARFYKWFTEG-------KDERGIWLQKLTYGVFGLGNRQYEHFNKIGKVVDEELAE
NCPR1_ARATH           TDNAARFYKWFTE--------ENERDIKLQQLAYGVFALGNRQYEHFNKIGIVLDEELCK
NCPR_DICDI            TDNAKEFYLWLTN--------DERPTDLLNGVPFTVFGLGNKTYEHYNAVARVIDRRMEE
NCPR_PHACH            TDNAVQLCQNLSDESFE----FSNGEHKLPGLKYVIFGLGNKTYEHYNLISRNVDRDLQK
Q5KIY3_CRYNJ          TDNANAMMELLQEPEPE----FSQGGSTLENLNYVIFGLGNRTYEFYNEVAKKLDKRLTE
A0A0D1CA24_USTMA      TDNAVGLMEFIENESPE----FSNGSERLENLNYVIFGLGNRTYEHFNAVARKLDARLQS
                       *..  :   :                 :  : :  *.***  **.::      :  .  

NCPR_YEAST            AGAIRLGKLGEADDGAGTTDEDYMAWKDSILEVLKDELHLDEQEAKFTSQFQYTVL-NEI
Q75F49_ASHGO          AGARMLGTFGKADDGAGTTDEDYMAWKDDILEELKDALALHEKEVSFISSYEYKVLPQDL
NCPR_CANMA            KGGERFADYGEGDDGTGTLDEDFLTWKDNVFDTLKNDLNFEERELKYEPNVKLTER-DDL
NCPR_CANTR            KGGDRFAEYGEGDDGTGTLDEDFLAWKDNVFDSLKNDLNFEEKELKYEPNVKLTER-DDL
NCPR_ASPNG            LGPQRIGSAGEGDDGAGTMEEDFLAWKEPMWAALSESMDLEEREAVYEPVFCVTEN-ESL
NCPR_ASPNC            LGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWAALSESMDLQEREAVYEPVFCVTEN-ESL
NCPR_ASPOR            LGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWTALSEAMGLQEREAVYEPVFNVTED-ESK
NCPR_EMENI            LGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWAALSEAMNLQEREASYEPVFCVTED-ESL
NCPR_ASPTN            LGAQRIGDAGEGDDGAGTMEEDFLAWKEPMWTALSEAMNLQEREAVYEPVFSVTED-ESL
NCPR_ASPFU            LGAQRIGTAGEGDDGAGTMEEDFLAWKEPMWAALSESMNLQEREAVYEPVFSVIED-ESL
NCPR_SCHPO            LGATRVGNLGLGDDAAGMLEEDYLQWKDDTLPEIGKLFHLQEVHKEYNPMFEVIEK-PEI
NCPR_BOVIN            LGAQRIFDLGLGDD-DGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELMV----
NCPR_PIG              LGAQRIFDLGLGDD-DGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVV----
NCPR_HUMAN            LGAQRIFELGLGDD-DGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVV----
NCPR_RABIT            LGAQRIFELGMGDD-DANLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVL----
NCPR_RAT              LGAQRIFELGLGDD-DGNLEEDFITWREQFWPAVCEFFGVEATGEESSIRQYELVV----
NCPR_MOUSE            LGAQRIFELGLGDD-DGNLEEDFITWREQFWPAVCEFFGVEATGEESSIRQYELVV----
NCPR_CAVPO            LGAQRIFELGLGDD-DGNLEEDFITWREQFWPAVCEFFGVEATGEESSIRQYELVL----
NCPR_DROME            LGANRVFELGLGDD-DANIEDDFITWKDRFWPAVCDHFGIEGGGEEVLIRQYRLLE----
NCPR_MUSDO            LGATRVFELGLGDD-DANIEDDFITWKDRFWPSVCDFFGIEGSGEEVLMRQFRLLE----
Q09590_CAEEL          LGAKRIFHLGLGDD-DANLEEDFMIWREAFLPKVAEEFGWELNTEAETMRQYQLEP----
NCPR_CATRO            QGGKRIVPLVLGDD-DQCIEDDFAAWRENVWPELDNLLR---DEDD-TTVSTTYTA----
NCPR2_ARATH           QGAQRLVQVGLGDD-DQCIEDDFTAWREALWPELDTILR---EEGD-TAVATPYTA----
NCPR_VIGRR            QGAKRLVAVGLGDD-DQSIEDDFSAWKESLWSELDQLLR---DEDDANTVSTPYTA----
NCPR1_ARATH           KGAKRLIEVGLGDD-DQSIEDDFNAWKESLWSELDKLLK---DEDD-KSVATPYTA----
NCPR_DICDI            LGGKRVFERGEGDD-DATLEEDFNRWKKDMWPVVCKFLGYELKSTEDDKFVPRFRM----
NCPR_PHACH            MGAIRIGERGEGDD-DKSMEEDYLEWKDGMWEAFAKAMNVEEGQGGDSPDFVVTEV---F
Q5KIY3_CRYNJ          LGAKRIGERGEGDD-DKSMEEDYLAWKDPMWTAFAERMGVEEGGAGDVPDFVVKEL---H
A0A0D1CA24_USTMA      LGAKRIGERGEGDD-DKSMEEDYLAWKDSMFEALATSLNFEEGGGGDVPDFKVTEL---A
                       *   .     .**     ::*:  *:.     .   :                      

NCPR_YEAST            TDS---MSLGEPSAHYLPSHQLNRNADGIQLGPFDLSQPYIAPIVKSRELFSSN--DRNC
Q75F49_ASHGO          MGS---ISLGEPNSQYLPGKTLAKK-ENMQLGPFDATHPYVAPITSTKELFKKK--DRNC
NCPR_CANMA            TVDDSEVSLGEPNKKYIQSEEIDLT-----KGPFDHTHPYLAKISKTRELFASK--ERNC
NCPR_CANTR            SGNDPDVSLGEPNVKYIKSEGVDLT-----KGPFDHTHPFLARIVKTKELFTSE--DRHC
NCPR_ASPNG            SPEDETVYLGEPTQSHLQGT---------PKGPYSAHNPFIAPIAESRELFTVK--DRNC
NCPR_ASPNC            SPEDETVYLGEPTQSHLQGT---------PKGPYSAHNPFIAPIAESRELFTVK--DRNC
NCPR_ASPOR            SAEDETVYLGEPTKGHLEGQ---------PKGPFSAHNPFIAPIVESRELFTVK--DRNC
NCPR_EMENI            TPEDNSVYLGEPTKGHLEGQ---------PNGPYSAHNPYIAPIVESRELFTVK--DRNC
NCPR_ASPTN            SPEDEAVYLGEPTKGHRDGT---------PSGPYSAHNPFIAPIVESRELFNVK--DRNC
NCPR_ASPFU            SPEDDSVYLGEPTQGHLSGS---------PKGPYSAHNPYIAPIVESRELFTAK--DRNC
NCPR_SCHPO            SNTSSTVFLGEPSRQQLKGNV-------ASKAPRSQANPFFSSPVRSLELFKSG--SRNC
NCPR_BOVIN            HTDMDMAKVYTGEMGRLKSYE-------NQKPPFDAKNPFLAVVTTNRKLNQGT--ERHL
NCPR_PIG              HTDMDTAVVYTGEMGRLKSYE-------NQKPPFDAKNPFLAVVTTNRKLNQGT--ERHL
NCPR_HUMAN            HTDIDAAKVYMGEMGRLKSYE-------NQKPPFDAKNPFLAAVTTNRKLNQGT--ERHL
NCPR_RABIT            HTDIDVAKVYQGEMGRLKSYE-------NQKPPFDAKNPFLATVTTNRKLNQGT--ERHL
NCPR_RAT              HEDMDVAKVYTGEMGRLKSYE-------NQKPPFDAKNPFLAAVTANRKLNQGT--ERHL
NCPR_MOUSE            HEDMDTAKVYTGEMGRLKSYE-------NQKPPFDAKNPFLAAVTTNRKLNQGT--ERHL
NCPR_CAVPO            HADTDPAKVYTGEMGRLKSYE-------NQKPPFDAKNPFLAAVTTNRKLNQGT--ERHL
NCPR_DROME            QPDVQPDRIYTGEIARLHSIQ-------NQRPPFDAKNPFLAPIKVNRELHKGG--GRSC
NCPR_MUSDO            QPDVQPDRIYTGEIARLHSMQ-------NQRPPFDAKNPFLASVIVNRELHKGG--GRSC
Q09590_CAEEL          VE--EGKALFKGEFGRLGAYE-------RPRPPFDVKNPYLATVAINDELHTEHS-DRSC
NCPR_CATRO            AIPEYRVVFPDKSDSLISEANGHANGYANGNTVYDAQHPCRSNVAVRKELHTPAS-DRSC
NCPR2_ARATH           AVLEYRVSIHDSEDAKFNDIN-MANG--NGYTVFDAQHPYKANVAVKRELHTPES-DRSC
NCPR_VIGRR            AILEYRVVIHDPTAASTYDNH---STVANGNTEFDIHHPCRVNVAVQKELHKPES-DRSC
NCPR1_ARATH           VIPEYRVVTHDPRFTTQKSME---SNVANGNTTIDIHHPCRVDVAVQKELHTHES-DRSC
NCPR_DICDI            VTLNQDSKDINDPFIKIVSTPLKPKLSTDNKVIYDMKNPYYAEVLENRELHSNES-DRSC
NCPR_PHACH            DHPEEKVYLGELSARALTRTK----------GIHDAKNPYPAPIIAAKELFAPG-SDRNC
Q5KIY3_CRYNJ          DHSPEKVYHGELSSRALLASASGTN---TPVGAYGVKNPYPAPVLSSKELFSVG-GDRNC
A0A0D1CA24_USTMA      NHPDDKVYHGELSARALLGTK----------GIHDAKNPYNAVVKEARELFVQGTADRTC
                                                        .  :*         :*       *  

NCPR_YEAST            IHSEFDLSGSNIKYSTGDHLAVWPSNPLEKVEQFLSIFNLDP----ETIFDLKPLDP---
Q75F49_ASHGO          IHVEFDLSGSNLKYSTGDHLGVWPSNPDEKVEKFLTTFGLDP----TTIFDLKPKDI---
NCPR_CANMA            VHVEFDVSESNLKYTTGDHLAVWPSNSDENIAKFIKCFGLDDK--INTVFELKALDS---
NCPR_CANTR            VHVEFDISESNLKYTTGDHLAIWPSNSDENIKQFAKCFGLEDK--LDTVIELKALDS---
NCPR_ASPNG            LHMEISIAGSNLSYQTGDHIAVWPTNAGAEVDRFLQVFGLEGK--RDSVINIKGIDV---
NCPR_ASPNC            LHMEISIAGSNLSYQTGDHIAVWPTNAGAEVDRFLQVFGLEGK--RDSVINIKGIDV---
NCPR_ASPOR            LHMEISIAGSNLTYQTGDHIAVWPTNAGAEVDRFLQVFGLEEK--RHSVINIKGIDV---
NCPR_EMENI            LHMEISIAGTNLTYQTGDHIAIWPTNAGAEVDRFLNVFGLEEK--RHSVINIKGIDV---
NCPR_ASPTN            LHMEISIAGSNLSYQTGDHIAIWPTNAGAEVDRFLQVFGLENK--RHSVINIKGIDV---
NCPR_ASPFU            LHMEIGIAGSNLTYQTGDHIAIWPTNAGVEVDRFLEVFGIEKK--RHTVINIKGLDV---
NCPR_SCHPO            LHLELDIADSGMRYQTGDYASICPMNPSQAVDDLLEVLGLKEK--RDTVIIVKPIDT---
NCPR_BOVIN            MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLD--IIMSLNNLDEES---
NCPR_PIG              MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGTDLD--IVMSLNNLDEES---
NCPR_HUMAN            MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLD--VVMSLNNLDEES---
NCPR_RABIT            MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLD--VVMSLNNLDEES---
NCPR_RAT              MHLELDISDSKIRYESGDHVAVYPANDSALVNQIGEILGADLD--VIMSLNNLDEES---
NCPR_MOUSE            MHLELDISDSKIRYESGDHVAVYPANDSTLVNQIGEILGADLD--VIMSLNNLDEES---
NCPR_CAVPO            MHLELDISDSKIRYESGDHVAVYPANDSNLVNQLGKILGADLD--VVMSLKNLDEES---
NCPR_DROME            MHIELSIEGSKMRYDAGDHVAMFPVNDKSLVEKLGQLCNADLD--TVFSLINTDTDS---
NCPR_MUSDO            MHIELDIDGSKMRYDAGDHIAMYPINDKILVEKLGKLCDANLD--TVFSLINTDTDS---
Q09590_CAEEL          RHIEFSVEGSRIRYEAGDHLAVFPTNDPVLVDRLINMLQFDPD--HAFRLVNVDEDA---
NCPR_CATRO            THLDFDIAGTGLSYGTGDHVGVYCDNLSETVEEAERLLNLPPE--TYFSLHADKEDGTPL
NCPR2_ARATH           IHLEFDIAGSGLTYETGDHVGVLCDNLSETVDEALRLLDMSPD--TYFSLHAEKEDGTPI
NCPR_VIGRR            IHLEFDISGTSITYDTGDHVGVYAENCNETVEETGKLLGQNLD--LFFSLHTDKDDGTSL
NCPR1_ARATH           IHLEFDISRTGITYETGDHVGVYAENHVEIVEEAGKLLGHSLD--LVFSIHADKEDGSPL
NCPR_DICDI            RHIEFKL-GDEVSYTTGDHLGVFPINDSKLVEQLIKRLGVNGD--DMIALVPIDQEG---
NCPR_PHACH            VHIELSTESSGITYQHGDHVGVWPSNADKEVDRLLYALGLHE--KKDTVINIESLDPA--
Q5KIY3_CRYNJ          IHIEFDITGTGMTYQHGDHVGIWPSNSDVEVDRMLAVLGLAASGRRQAIVDIESLDPA--
A0A0D1CA24_USTMA      VHIEFDIDGSGISYQHGDHIAVWAHNPEPEVDRVLAVFGLLD--KRTTVIDVESLDPT--
                       * ::      : *  **: .:   *    :                  .     :    

NCPR_YEAST            --TVKVPFPTPTTIGAAIKHYLEITGPVSRQLFSSLIQFAPNADVKEKLTLLSKDKDQFA
Q75F49_ASHGO          --TIKPPFPVPTTIGAAVRYYLEISGPVSRQVIGSLLQYVTEEQLKERLQALSKNKEKYA
NCPR_CANMA            --TYQIPFPNPITYGAVVRHHLEISGPVSRQFFLAIAGFAPDEETKKTFTRIGNDKQEFA
NCPR_CANTR            --TYSIPFPNPITYGAVIRHHLEISGPVSRQFFLSIAGFAPDEETKKSFTRIGGDKQEFA
NCPR_ASPNG            --TAKVPIPTPTTYDAAVRYYMEVCAPVSRQFVATLAAFAPDEESKAEIVRLGSHKDYFH
NCPR_ASPNC            --TAKVPIPTPTTYDAAVRYYMEVCAPVSRQFVATLAAFAPDEESKAEIVRLGSDKDYFH
NCPR_ASPOR            --TAKVPIPTPTTYDAAVRYYMEVCAPVSRQFVSSLAAFAPDEATKTEIQRLGSDKDYFH
NCPR_EMENI            --TAKVPIPTPTTYDAAVRYYMEVCAPVSRQFVSTLAAFAPDEETKTEIVRLGSDKDYFH
NCPR_ASPTN            --TAKVPIPTPTTYDAAVRYYMEIAAPVSRQFVATLAAFAPDEETKAEIVRLGSDKDYFH
NCPR_ASPFU            --TAKVPIPTPTTYDAAVRFYMEICAPVSRQFVSSLVPFAPDEESKAEIVRLGNDKDYFH
NCPR_SCHPO            --LDKAPVLSPTTYDTVFRYYYEICGIVSRQLLSFIAPFAPTPESKQELEKLGNDYDYFK
NCPR_BOVIN            --NKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPTEHEQLRKMASSSGEGK
NCPR_PIG              --NKRHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEQLRKMASSSGEGK
NCPR_HUMAN            --NKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGK
NCPR_RABIT            --NKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYAADPAEQEQLRKMASSSGEGK
NCPR_RAT              --NKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGK
NCPR_MOUSE            --NKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGK
NCPR_CAVPO            --NKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEQLHKMASSSGEGK
NCPR_DROME            --SKKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGK
NCPR_MUSDO            --SKKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCSDEKDKEFLRNMASITPEGK
Q09590_CAEEL          --SKRHPFPCPTTFRTALSHYVDICAPVKSHVLKAISEYCTDDTEKEFLNKLSTANEEGL
NCPR_CATRO            AGSSLPPPFPPCTLRTALTRYADLLNTPKKSALLALAAYASDPNEADRLKYLAS--PAGK
NCPR2_ARATH           S-SSLPPPFPPCNLRTALTRYACLLSSPKKSALVALAAHASDPTEAERLKHLAS--PAGK
NCPR_VIGRR            GGSLLPPFPGPCSLRTALARYADLLNPPRKAALLALATHASEPS-DERLKFLSS--PQGK
NCPR1_ARATH           ESAVPPPFPGPCTLGTGLARYADLLNPPRKSALVALAAYATEPSEAEKLKHLTS--PDGK
NCPR_DICDI            --SVIKASFGPMTIRRAFSEHLDITNPVRKSVLRALAESTTNEEEKKRLLYLAT--EEAN
NCPR_PHACH            --LAKVPFPVPTTYATVLRHYIDISALAGRQILGVLAKFAPNPEAEAVLKDLNSNKEHYQ
Q5KIY3_CRYNJ          --LAKVPFPTPATYDAIFRHYLDISAVASRQTIAFLARYAPSEAAREKLTRWGTDKEAYA
A0A0D1CA24_USTMA      --LAKVPFPVPTTYEAVFRHYIDITSHASRQTLNSFAKFAPSPDIQAKLEKVCANKDIFQ
                            .   * .    .  :  :        .  :    .       :           

NCPR_YEAST            VEITSKYFNIADALKYLSDGA----------KWDTVPMQFLVE-SVPQMTPRYYSISSSS
Q75F49_ASHGO          KEITSKCMDLADALLYLSSGK----------KWTQVPWEFLIE-TVPHMQPRYYSISSSS
NCPR_CANMA            NKITRKKLNVADALLFASNGR----------PWSDVPFEFIIE-NVPHLQPRYYSISSSS
NCPR_CANTR            SKVTRRKFNIADALLFASNNR----------PWSDVPFEFLIE-NVQHLTPRYYSISSSS
NCPR_ASPNG            EKVTNQCFNMAQALQSITSK-----------PFSAVPFSLLIE-GITKLQPRYYSISSSS
NCPR_ASPNC            EKVTNQCFNIAQALQSITSK-----------PFSAVPFSLLIE-GITKLQPRYYSISSSS
NCPR_ASPOR            EKITNQCFNIAQALQSITSK-----------PFSAVPFSLLIE-GLNKLQPRYYSISSSS
NCPR_EMENI            EKITNQCFNIAQALQSITSK-----------PFSNVPFSLLIE-GLNKIQPRYYSISSSS
NCPR_ASPTN            EKISNQCFTIAQALQSVTSK-----------PFSAVPFSLLIE-GLNKLQPRYYSISSSS
NCPR_ASPFU            EKISNQCFNIAQALQNITSK-----------PFSAVPFSLLIE-GLNRLQPRYYSISSSS
NCPR_SCHPO            KNVVDLHLNLAQVLRRVSPDA----------PFTKLPFSMLLE-NMAHMKPRYYSISSSS
NCPR_BOVIN            ELYLRWVLEARRHILAILQDY----------PSLRPPIDHLCE-LLPRLQARYYSIASSS
NCPR_PIG              ELYLSWVVEARRHILAILQDY----------PSLRPPIDHLCE-RLPRLQARYYSIASSS
NCPR_HUMAN            ELYLSWVVEARRHILAILQDC----------PSLRPPIDHLCE-LLPRLQARYYSIASSS
NCPR_RABIT            ELYLSWVVEARRHILAILQDY----------PSLRPPIDHLCE-LLPRLQARYYSIASSS
NCPR_RAT              ELYLSWVVEARRHILAILQDY----------PSLRPPIDHLCE-LLPRLQARYYSIASSS
NCPR_MOUSE            ELYLSWVVEARRHILAILQDY----------PSLRPPIDHLCE-LLPRLQARYYSIASSS
NCPR_CAVPO            ELYLTWVVEARRHILAILQDY----------PSLRPPIDHLCE-LLPRLQARYYSIASSS
NCPR_DROME            EKYQSWIQDACRNIVHILEDI----------KSCRPPIDHVCE-LLPRLQPRYYSISSSA
NCPR_MUSDO            EKYQNWIQNSSRNIVHILEDI----------KSCRPPIDHICE-LLPRLQPRYYSISSSS
Q09590_CAEEL          KEYARYIVKERRSIVDVLTDQ----------KTCKPPIEYLLE-LLPRLQARYYSIASSP
NCPR_CATRO            DEYAQSLVANQRSLLEVMAEF----------PSAKPPLGVFFAAIAPRLQPRFYSISSSP
NCPR2_ARATH           DEYSKWVVESQRSLLEVMAEF----------PSAKPPLGVFFAGVAPRLQPRFYSISSSP
NCPR_VIGRR            DEYSKWVVGSQRSLVEVMAEF----------PSAKPPLGVFFAAIAPRLQPRYYSISSSP
NCPR1_ARATH           DEYSQWIVASQRSLLEVMAAF----------PSAKPPLGVFFAAIAPRLQPRYYSISSSP
NCPR_DICDI            EEYNKYIKNDFRGVVDLLESF----------PGLQPLIAHFLE-FTPRLPARMYSISSSP
NCPR_PHACH            NIVANGCMKLGEVLQYAAGNDLHADPTASNTTAWKIPFDIIVS-SIPRLQPRYYSISSSP
Q5KIY3_CRYNJ          NEIDGPALKLAEVLQSASSDS--VEPPFESQTVWPIPFDRIVS-SVPRLQPRYYSISSSS
A0A0D1CA24_USTMA      AEIGSRLLKTTEAMQWIAGDD--LQADVSSIKPWNVPFDRVIS-DLPRVGPRFYSISSSP
                                   :                          .      :: .* ***:**.

NCPR_YEAST            LSEKQTVHVTSIVENFPN----PELPDAPPVVGVTTNLLRNIQLAQNNVN----------
Q75F49_ASHGO          SSDKQTVHITAVVENYPN----PEVSSLGPVTGVTTNLLRHIHLTRTKED----------
NCPR_CANMA            LSEKQTINITAVVEVE-------EEADGRAVTGVVTNLLKNIEIEQNK------------
NCPR_CANTR            LSEKQTINVTAVVEAE-------EEADGRPVTGVVTNLLKNIEIEQNK------------
NCPR_ASPNG            LVQKDKISITAVVESVR------LPGASHMVKGVTTNYLLALKQKQNG-D----------
NCPR_ASPNC            LVQKDKISITAVVESVR------LPGASHMVKGVTTNYLLALKQKQNG-D----------
NCPR_ASPOR            LVQKDKISITAVVESVR------LPGASHLVKGVTTNYLLALKQKQNG-E----------
NCPR_EMENI            LVQKDKISITAVVESTR------LPGATHIVKGVTTNYLLALKQKQNG-D----------
NCPR_ASPTN            MVQKDKISITAVVESTR------LPGAAHLVKGVTTNYLLALKQKQNG-D----------
NCPR_ASPFU            LVQKDKISITAVVESVR------LPGASHIVKGVTTNYLLALKQKQNG-D----------
NCPR_SCHPO            VVHPDKVHVTAVVDKKE------WTDKNHIFYGLTTNYLLAHCRHMHG-E----------
NCPR_BOVIN            KVHPNSVHICAVAVEYE-------TKTGRINKGVATSWLRAK------------------
NCPR_PIG              KVHPNSVHICAVVVEYE-------TKSGRVNKGVATSWLRAK------------------
NCPR_HUMAN            KVHPNSVHICAVVVEYE-------TKAGRINKGVATNWLRAK------------------
NCPR_RABIT            KVHPNSVHICAVAVEYE-------TKAGRLNKGVATSWLRAK------------------
NCPR_RAT              KVHPNSVHICAVAVEYE-------AKSGRVNKGVATSWLRAK------------------
NCPR_MOUSE            KVHPNSVHICAVAVEYE-------AKSGRVNKGVATSWLRTK------------------
NCPR_CAVPO            KVHPNSVHICAVVVEYE-------TKSGRINKGVATSWLQAK------------------
NCPR_DROME            KLHPTDVHVTAVLVEYK-------TPTGRINKGVATTYLKNK------------------
NCPR_MUSDO            KLYPTNVHITAVLVQYE-------TPTGRVNKGVATSYMKEK------------------
Q09590_CAEEL          RLNEEKIAICAVVTKYS-------IGD-RDINGVCTRYLTTK------------------
NCPR_CATRO            RMAPSRIHVTCALVYEK-------TPGGRIHKGVCSTWMKNA------------------
NCPR2_ARATH           KIAETRIHVTCALVYEK-------MPTGRIHKGVCSTWMKNA------------------
NCPR_VIGRR            RFAPQRVHVTCALVYGP-------TPTGRIHKGVCSTWMKNA------------------
NCPR1_ARATH           RLAPSRVHVTSALVYGP-------TPTGRIHKGVCSTWMKNA------------------
NCPR_DICDI            HNKNGVVSITSVVVNFT-------TGNQRAHNGVASTWLSHL------------------
NCPR_PHACH            KLYPNAIHATVVVLKYKSEKAP--RVEERWIYGVGSNFLLNLKYASHHDKAATLVSDDSP
Q5KIY3_CRYNJ          KLHPNAIHVTAVVLKYQPTVSPPHHHEPRWVFGLSTNFILNVKMAHSGEN--TPVEGDVS
A0A0D1CA24_USTMA      KMHPKSVHITAVVLRYQANKSA------PWVHGLATNLISSIKMAKNGEQ------PTGP
                            :                         *: :  :                     

NCPR_YEAST            -----IAETNLPVHYDLNGPRKLFANYKLPVHVRRSNFRLPSNPST--PVIMIGPGTGVA
Q75F49_ASHGO          -----IAASSLPVHYNLAGPRDLYQNYKLPVHVRRSTFRLPSNPST--PVIMVGPGTGVA
NCPR_CANMA            ------TGEKPVVHYDLSGPRNKFNKFKLPVHVRRSNFKLPKNTTT--PVILIGPGTGVA
NCPR_CANTR            ------TGETPMVHYDLNGPRGKFSKFRLPVHVRRSNFKLPKNSTT--PVILIGPGTGVA
NCPR_ASPNG            -----PSPDPHGLTYSITGPRNKYDGIHVPVHVRHSNFKLPSDPSR--PIIMVGPGTGVA
NCPR_ASPNC            -----PSPDPHGLTYSITGPRNKYDGIHVPVHVRHSNFKLPSDPSR--PIIMVGPGTGVA
NCPR_ASPOR            -----PSPDPHGLTYAITGPRNKYDGIHVPVHVRHSNFKLPSDPSR--PIIMVGPGTGVA
NCPR_EMENI            -----PSPDPHGQTYAINGPRNKYDGIHVPVHVRHSNFKLPSDPSR--PIIMIGPGTGVA
NCPR_ASPTN            -----PSPDPHGLTYTITGPRNKYDGIHVPVHVRHSNFKLPSDPSR--PIIMVGPGTGVA
NCPR_ASPFU            -----PSPDPHGLTYAITGPRNKYDGIHVPVHVRHSNFKLPSDPSK--PIIMVGPGTGVA
NCPR_SCHPO            -----KIPHPNGLEYTLEGPRKNWTG-KIPMFVKKSTFRL-APPDV--PIIMVGPGTGVA
NCPR_BOVIN            -----------------EPAGENGGRALVPMYVRKSQFRLPFKAT--TPVIMVGPGTGVA
NCPR_PIG              -----------------EPAGENGRRALVPMFVRKSQFRLPFKAT--TPVIMVGPGTGVA
NCPR_HUMAN            -----------------EPAGENGGRALVPMFVRKSQFRLPFKAT--TPVIMVGPGTGVA
NCPR_RABIT            -----------------EPAGENGGRALVPMFVRKSQFRLPFKAT--TPVIMVGPGTGVA
NCPR_RAT              -----------------EPAGENGGRALVPMFVRKSQFRLPFKST--TPVIMVGPGTGIA
NCPR_MOUSE            -----------------EPAGENGRRALVPMFVRKSQFRLPFKPT--TPVIMVGPGTGVA
NCPR_CAVPO            -----------------DPAGENGRRALVPMFVRKSQFRLPFKST--TPVIMVGPGTGVA
NCPR_DROME            -----------------QPQG--SEEVKVPVFIRKSQFRLPTKPE--TPIIMVGPGTGLA
NCPR_MUSDO            -----------------NPS---VGEVKVPVFIRKSQFRLPTKSE--IPIIMVGPGTGLA
Q09590_CAEEL          -----------------DAG------SKSPVFVRKSTMRLPHRTT--TQVIMIGPGTGFA
NCPR_CATRO            -----------------IPLEESRDCSWAPIFVRQSNFKLPADPK--VPVIMIGPGTGLA
NCPR2_ARATH           -----------------VPYEKSENCSSAPIFVRQSNFKLPSDSK--VPIIMIGPGTGLA
NCPR_VIGRR            -----------------IPSEKSQDCSSAPIFIRPSNFKLPVDHS--IPIIMVGPGTGLA
NCPR1_ARATH           -----------------VPAEKSHECSGAPIFIRASNFKLPSNPS--TPIVMVGPGTGLA
NCPR_DICDI            -----------------KVGDK------VPLFVRESHFKLPSAATEQKPVIMVGPGTGLA
NCPR_PHACH            SEPSIVSHYPTYSIEGPRGAYKQGDVVKVPIHVRRSTFRLPTNPKS--PVIMIGPGTGVA
Q5KIY3_CRYNJ          HVS--MKKVPSYKLSGPRGHYVKENVYKVPIHVRRSTFRLPTSPKV--PIIMIGPGTGVA
A0A0D1CA24_USTMA      SDP--RYGTPKYLLDGPRGAYTKDGAFRAPIHIRRSNFRLPTSPKI--PVIMVGPGTGVA
                                                   *:.:: * ::*         ::::*****.*

NCPR_YEAST            PFRGFIRERVAFLESQKKGG-------NNVSLGKHILFYGSRN-TDDFLYQDEWPEYAKK
Q75F49_ASHGO          PFRGFIRERISFLKNQE-----------NVKLGKHLLFYGCRD-DADFLYHDEWPVYAKE
NCPR_CANMA            PLRGFVRERVQQVKNGV-------------NVGKTVLFYGCRNEHDDFLYKQEWSEYASV
NCPR_CANTR            PLRGFVRERVQQVKNGV-------------NVGKTVLFYGCRNSEQDFLYKQEWSEYASV
NCPR_ASPNG            PFRGFIQERAALAAKGE-------------KVGPTVLFFGCRKSDEDFLYKDEWKTYQDQ
NCPR_ASPNC            PFRGFIQERAALAAKGE-------------KVGPTVLFFGCRKSDEDFLYKDEWKTYQDQ
NCPR_ASPOR            PFRGFIQERAALAAKGE-------------KVGTTVLFFGCRNRNEDFLYQDEFKAYEEQ
NCPR_EMENI            PFRGFIQERAALAARGE-------------KVGPTVLFFGCRKRDEDFLYKDEWKVFQDQ
NCPR_ASPTN            PFRGFIQERAALAAKGE-------------NVGPTVLFFGCRRRDEDFMYADEFKTYQEQ
NCPR_ASPFU            PFRGFIQERAALAESGK-------------DVGPTILFFGCRNRNEDFLYKEEWKVYQEK
NCPR_SCHPO            PFRGFVMERANLASKGV-------------KVAKTLLFYGCQYSDKDFLYKEEWQQYKDV
NCPR_BOVIN            PFIGFIQERAWLRQQGK-------------EVGETLLYYGCRRSDEDYLYREELAGFHKD
NCPR_PIG              PFIGFIQERAWLQEQGK-------------EVGETLLYYGCRRSDEDYLYREELAQFHAK
NCPR_HUMAN            PFIGFIQERAWLRQQGK-------------EVGETLLYYGCRRSDEDYLYREELAQFHRD
NCPR_RABIT            PFIGFIQERAWLRQQGK-------------EVGETLLYYGCRRAAEDYLYREELAGFQKD
NCPR_RAT              PFMGFIQERAWLREQGK-------------EVGETLLYYGCRRSDEDYLYREELARFHKD
NCPR_MOUSE            PFMGFIQERAWLREQGK-------------EVGETLLYYGCRRSDEDYLYREELARFHKD
NCPR_CAVPO            PFIGFIQERAWLQQQGK-------------EVGETLLYYGCRRSDEDYLYREELAQFHKD
NCPR_DROME            PFRGFIQERQFLRDEGK-------------TVGESILYFGCRKRSEDYIYESELEEWVKK
NCPR_MUSDO            PFRGFIQERQFLRDGGK-------------VVGDTILYFGCRKKDEDFIYREELEQYVQN
Q09590_CAEEL          PFRGFLQDRQFHKNAGK-------------EIGAMHLYYGCRHPDHDYIYKDELAKFQED
NCPR_CATRO            PFRGFLQERLALKEEGA-------------ELGTAVFFFGCRNRKMDYIYEDELNHFLEI
NCPR2_ARATH           PFRGFLQERLALVESGV-------------ELGPSVLFFGCRNRRMDFIYEEELQRFVES
NCPR_VIGRR            PFRGFLQERYALKEDGV-------------QLGPALLFFGCRNRQMDFIYEDELKSFVEQ
NCPR1_ARATH           PFRGFLQERMALKEDGE-------------ELGSSLLFFGCRNRQMDFIYEDELNNFVDQ
NCPR_DICDI            PFRGFLQELQHRNHS---------------QQQQSLLFFGCRSDTVDYIYREELEQYHQS
NCPR_PHACH            PFRGFVQERVAMARRTIEKH----GPEGLADWGPIRLYYGCRRSDQDFLYKDEWPEYAKE
Q5KIY3_CRYNJ          PFRGFVQERIALARKAIDKN----GPDALKDWAPMYLFYGCRRADEDFLYREEWPKYEQE
A0A0D1CA24_USTMA      PFRSFVQDRVCSAEKALEKSNGKSAQEALKDWGNLWLFYGCRKADEDFLYRDEWPQYAQK
                      *: .*: :                            :::*.:    *::* .*   :   

NCPR_YEAST            LDGSFEMVVAHSRL----PNTKKVYVQDKLKDYEDQVFEMI-NNGAFIYVCGDAKGMAKG
Q75F49_ASHGO          LGSSFELMVAYSRI----PNKKKVYVQDHLLERENEVLELI-NKGAFIYVCGDAKGMSQD
NCPR_CANMA            LGENFEMFTAFSRQ----DPSKKVYVQDKIAENSKVVNDLL-NEGAIIYVCGDASRMARD
NCPR_CANTR            LGENFEMFNAFSRQ----DPTKKVYVQDKILENSALVDELL-SSGAIIYVCGDASRMARD
NCPR_ASPNG            LGDNLKIITAFSR-----EGPQKVYVQHRLREHSELVSDLL-KQKATFYVCGDAANMARE
NCPR_ASPNC            LGDNLKIITAFSR-----EGPQKVYVQHRLREHSELVSDLL-KQKATFYVCGDAANMARE
NCPR_ASPOR            LGDSLKIITAFSR-----ETSQKVYVQHRLREQAELVSDLL-KQKATFYVCGDAANMARE
NCPR_EMENI            LGDSLKIITAFSR-----ESEKKVYVQHRLKEHAELVSDLL-KQKATFYVCGDAANMARE
NCPR_ASPTN            LGDKLQIITAFSR-----ETSQKVYVQHRLREHSDLVSSLL-KQKANFYVCGDAANMARE
NCPR_ASPFU            LGDKLKIITAFSR-----ETAKKVYVQHRLQEHADLVSDLL-KQKATFYVCGDAANMARE
NCPR_SCHPO            LKDSFELITAFSR-----EQDHKIYVQHRLLEHSDTIAKLV-EEGAAFYICGDADHMAKD
NCPR_BOVIN            -GALTQLNVAFSR-----EQPQKVYVQHLLKKDKEHLWKLIHEGGAHIYVCGDARNMARD
NCPR_PIG              -GALTRLSVAFSR-----EQPQKVYVQHLLKRDKEHLWKLIHDGGAHIYICGDARNMARD
NCPR_HUMAN            -GALTQLNVAFSR-----EQSHKVYVQHLLKQDREHLWKLI-EGGAHIYVCGDARNMARD
NCPR_RABIT            -GTLSQLNVAFSR-----EQAQKVYVQHLLRRDKEHLWRLIHEGGAHIYVCGDARNMARD
NCPR_RAT              -GALTQLNVAFSR-----EQAHKVYVQHLLKRDREHLWKLIHEGGAHIYVCGDARNMAKD
NCPR_MOUSE            -GALTQLNVAFSR-----EQAHKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMAKD
NCPR_CAVPO            -GTLTQLNVAFSR-----EQAQKVYVQHLLKRDQEHLWKLIHEDGAHIYVCGDARNMARD
NCPR_DROME            -GTLN-LKAAFSR-----DQGKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVD
NCPR_MUSDO            -GTLT-LKTAFSR-----DQQEKIYVTHLIEQDADLIWKVIGEQKGHFYICGDAKNMAVD
Q09590_CAEEL          -EVLTHLVCAFSR-----AQEHKIYVQDRLWETRDRIWDAI-NVGAHVYICGDARNMARD
NCPR_CATRO            -GALSELLVAFSR-----EGPTKQYVQHKMAEKASDIWRMI-SDGAYVYVCGDAKGMARD
NCPR2_ARATH           -GALAELSVAFSR-----EGPTKEYVQHKMMDKASDIWNMI-SQGAYLYVCGDAKGMARD
NCPR_VIGRR            -GSLSELIVAFSR-----EGAEKEYVQHKMMDKAAHLWSLI-SQGGYLYVCGDAKGMARD
NCPR1_ARATH           -GVISELIMAFSR-----EGAQKEYVQHKMMEKAAQVWDLI-KEEGYLYVCGDAKGMARD
NCPR_DICDI            -SVLGDLVVAFSR-----KTSQKVYVQNKLLEHKEKVWELL-NKGAYFYVCGDGRNMSKA
NCPR_PHACH            LHGKFIMRCAFSREPPYKPDGSKIYVQDLIWEDAEQIADAILNGKGYVYICGDAKSMSKS
Q5KIY3_CRYNJ          LKGVFRMKVAFSREMK-KPDGGKVYVQDLIHDLASELAPLILEKRAYIYICGDAKTMSKA
A0A0D1CA24_USTMA      LGGKFIMETSLSREKF-KPDGSKLYVQDLIWERRKQIAEDILERKAYIYICGEAKGMAHD
                            :  : **         * ** . :      :   : .  . .*:**:.  *:  

NCPR_YEAST            VSTALVGILSRGKS-ITTDEATELIKMLKTSGRYQEDVW-
Q75F49_ASHGO          VHRTLIDILRRGKN-ISEEESSEILKQFKTTGKYQEDVW-
NCPR_CANMA            VQSTIAKIVAKHRE-IQEDKAVELVKSWKVQNRYQEDVW-
NCPR_CANTR            VQAAIAKIVAKSRD-IHEDKAAELVKSWKVQNRYQEDVW-
NCPR_ASPNG            VNLVLGQIIAAQRG-LPAEKGEEMVKHMRRRGRYQEDVWS
NCPR_ASPNC            VNLVLGQIIAAQRG-LPAEKGEEMVKHMRSSGSYQEDVWS
NCPR_ASPOR            VNLVLGQIIAQQRG-LPAEKGEEMVKHMRSSGSYQEDVWS
NCPR_EMENI            VNLVLGQIIAAQRG-LPAEKGEEMVKHMRSSGSYQEDVWS
NCPR_ASPTN            VNLVLGQIIAQQRG-LPAERAEEMVKHMRSSGSYQEDVWS
NCPR_ASPFU            VNLVLGQIIAKSRG-LPAEKGEEMVKHMRSSGSYQEDVWS
NCPR_SCHPO            VVNALASILTTV-----DVDGMKAVKALRDDNRFFEDTW-
NCPR_BOVIN            VQNTFYDIVAEQGA-MEHAQAVDYVKKLMTKGRYSLDVWS
NCPR_PIG              VQNTFCDIVAEQGP-MEHAQAVDYVKKLMTKGRYSLDVWS
NCPR_HUMAN            VQNTFYDIVAELGA-MEHAQAVDYIKKLMTKGRYSLDVWS
NCPR_RABIT            VQNTFYDIVAELGA-MEHAQAVDYVKKLMTKGRYSLDVWS
NCPR_RAT              VQNTFYDIVAEFGP-MEHTQAVDYVKKLMTKGRYSLDVWS
NCPR_MOUSE            VQNTFYDIVAEFGP-MEHTQAVDYVKKLMTKGRYSLDVWS
NCPR_CAVPO            VQNTFCNIAAELGG-MEHTQAVDYVKKLMTKGRYSLDVWS
NCPR_DROME            VRNILVKILSTKGN-MSEADAVQYIKKMEAQKRYSADVWS
NCPR_MUSDO            VRNILVKILSTKGN-MNESDAVQYIKKMEAQKRYSADVWS
Q09590_CAEEL          VQATLQKIFREIGG-KSETEAVAYFKDMEKTKRYQADVWS
NCPR_CATRO            VHRTLHTIAQEQGS-MDSTQAEGFVKNLQMTGRYLRDVW-
NCPR2_ARATH           VHRSLHTIAQEQGS-MDSTKAEGFVKNLQTSGRYLRDVW-
NCPR_VIGRR            VHRTLHSIVQEQEN-VDSTKAEAIVKKLQMDGRYLRDVW-
NCPR1_ARATH           VHRTLHTIVQEQEG-VSSSEAEAIVKKLQTEGRYLRDVW-
NCPR_DICDI            VQQALLSIIKEFGS-KDDNSAQQFIDDMSSHGRYLQDVWF
NCPR_PHACH            VEETLCRILGEAKGGSAEVEGAAELKLLKERNRLLLDVWS
Q5KIY3_CRYNJ          VEERLMEMLGAAKGGSAAVEGAKELKMLKERNRLMSDVWS
A0A0D1CA24_USTMA      VEAIFGKILEEAKG--SAEEAKKEIKLLKERSRLLLDVWS
                      *   :  :            .   ..          *.*