CLUSTAL format seed alignment for MF_03216

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A098DEY5_GIBZE      -----------------------------MPRASLAVIMGIMALGPQDFLDYVNYDKQ--
C7YM51_NECH7          -----------------------------------------MASFVNELVEYVDLSKQ--
G2X5U8_VERDV          --------------------------------------MAPVENVSPAL---VDFNQK--
PLMT_NEUCR            --------------------------------------MPLVALGVADLFNFVDYSKT--
D5GA05_TUBMM          --------------------------------------MPTKLFANSTVMDLVDFDQK--
M2UDH5_COCH5          ------------------------------------------------MSEYIDFSKP--
A0A0D1CJ51_USTMA      ------------------------------------MSALFHKSSAYVVSNVVDLTQP--
I1BQV4_RHIO9          -----------------------------------------------MYTELIDFSQP--
A8NIW8_COPC7          -------------------------------------------MTSLDFNGLIDLDKA--
PLMT_SCHPO            -------------------------------MSLILYPKPTSYLYQPFIKAYFSLNMAIF
C4R5S7_KOMPG          -------------------------------------MADRLVSNFKQLASEVNLQDR--
Q752Z0_ASHGO          ----------------------------------MGIKDLKLNDMLLDAVADINGDDR--
PLMT_YEAST            -------------------------------------MKESVQEIIQQLIHSVDLQSS--
A0A1D8PKM5_CANAL      ------------------MSSIAQELSTLPSDLIYLAQNFPQYIDLKGKLFGNDIIQN--
Q6C649_YARLI          -------------------------------------MSFPDKIVAD---FNVDYDQK--
C0NQR3_AJECG          ---------------------------------------MASIT------DYIDFSQT--
J3K9R7_COCIM          ---------------------------------------MPSLT------DFVDFNQP--
Q4WTJ8_ASPFU          ---------------------------------------MCSL----------HLVQS--
PLMT_EMENI            ---------------------------------------MTTLS------DYVDFSQD--
E3K9Q4_PUCGT          ----MCSDIQTIPKTPRSQINTYYSVDRPGHQHFIKTRKMSPIELGWYEGGLIDLRRH--
PEMT1_DICDI           -----------------------------------MIVEH-AIDYIDYLMNYVDFTEK--
F0Z9J5_DICPU          -----------------------------------MFEEYLNQEYFEYLAAHIDFTET--
D3BN57_POLPP          -------------------------------------MDQLSMQTLLELPHYIDFQEK--
PEMT_MOUSE            ---------------------------------------------MSWLLGYMDPTEP--
PEMT_RAT              ---------------------------------------------MSWLLGYVDPTEP--
H2NSW7_PONAB          --------MKRSGNPGAEATSSSVAGPDCCGGLGNIDFRQADFCVMTRLLGYVDPLDP--
G1RTA1_NOMLE          --------MKRSGNPGAEATSSSVAGPDCCGGLGNIDFRQADFCVMTWLLGYVDPLDP--
H2QCD5_PANTR          --------MKRSGNPGAEATNSSVAGPDCCGGLGNIDFRQADFCVMTRLLGYVDPLDP--
PEMT_HUMAN            ---------------------------------------------MTRLLGYVDPLDP--
A0A0D9R7U9_CHLSB      ----------------------MFPGLPACS-------QRADLCVMTWLLGYVDPLDP--
F7HWC1_CALJA          ---------------------------------------------MTWFLGYVDPLDP--
M3XLS2_MUSPF          -------------------MSSSVAGPDCCGGLGNVDFRQADLYVMTWLLGYVDPSDP--
J9P3L9_CANLF          -------------------MSSSVAGPDCCGGLGNVDFRQADLCVMTWLLGYVDPSDP--
M3W4J4_FELCA          ---------------------------------------------MTRLLGYVDPSDP--
F6W7L8_HORSE          ---------------------------------------QADLYVMTRLLGYVDISDP--
PEMT_BOVIN            ---------------------------------------------MTRLLGYVDLSEP--
F6WK67_MONDO          -------------------MRGRVAGYDCCGGLGNVDIYKAELSVMTRLLGYVDVTDF--
G3X0I9_SARHA          ---------------------------------------------MTRLFGYVDVTDF--
F1NF85_CHICK          MAGRPRPGGERGQAGGRRGAGFWWWPRDCCSGLGGLDYSEVDVTAMARVFSYVDVTDS--
H3A5P0_LATCH          -----------------MQNPQGTVQLECCGGLNNLDYSKIDATIMAEVLKYINLKDF--
Q6DF13_XENTR          ---------------------------------------------MAELLEYVVLTDT--
G3NPV5_GASAC          -MSD---AAALRYQNPDKEK--RAVPLDCCGGLNNVDFSKMDLTLIEGLLKLTNFQDS--
H2V443_TAKRU          -MHR---VGE--NQSPIPNE--PAAPVDCCGGLNNVDYSKMDFTLMEEFLRHINFYDT--
A0A087YIS2_POEFO      -MSDSDGAAAERETRPAAEQNNQPVPLDCCGGLNNVDYSKMDLVPIEEFIRHINFHDP--
H3CPN0_TETNG          ---------------------------------------------MESLLKLINFYDT--
A0A0R4ICV3_DANRE      -MSG----ESLLDRKP---------APDCCGGFNNLEFSQMDVECIWNNWSMPDINEP--
B3RI13_TRIAD          ---------------------------------------------MENLNGYMDVNDW--
C3Z402_BRAFL          ---------------------------------------------MSFITDYLRLNDP--
C3YCR1_BRAFL          ---------------------------------------------MAALDEYVRLEDP--
W4YKN1_STRPU          ------------------------------------------------------------
Q4Q632_LEIMA          ------------------------------------------MTQLPTTPAASRIHYR--
A4I735_LEIIN          ------------------------------------------------MPAASRIHYR--
A4HJL2_LEIBR          ------------------------------------------MPYSATIPVAGSIHYR--
V7AT94_PHAVU          ------------------------------------------------------------
C3VD33_SOYBN          ------------------------------------------------------------
M1CRT3_SOLTU          -------MVSTDRPKLIKICCSCGQHRHVSVVVERDFQPLEVKDTNKGILRQKAEQRE--
K4C822_SOLLC          ------------------------------------------------------------
PLMT_ARATH            ------------------------------------------------------------
B6TCL8_MAIZE          ------------------------------------------------------MVSM--
C5XXB9_SORBI          ------------------------------------------------------MVSM--
K3YW84_SETIT          ------------------------------------------------------MVSM--
A3A901_ORYSJ          -------------------------------------------------------MEM--
I1IBI0_BRADI          ------------------------------------------------------MVGV--
M0SVN2_MUSAM          ----------------------------------------------------MGAATA--
D5ACP7_PICSI          -------------------------------------------------------MGV--
A9SGX7_PHYPA          -----------------------------------------MLDLWPINPHLPLPGII--
A9V3D6_MONBE          --------------------MGFFRVSIDKTRAVLYTLGFLASLYAVELASSASVFDAVV
                                                                                  

A0A098DEY5_GIBZE      ----SLYISAASIAFNPLFWNIV-----ARQEYHNKLLTKLFGGN---SQVACYALAFTI
C7YM51_NECH7          ----SLLVSASSIAFNPLFWNIV-----ARQEYHNKLLTKLFGGN---SKVGCYALAATI
G2X5U8_VERDV          ----SLFASACAIMFNPLFWKSVFTSLRDKVQYNNKLLTKLFGGR---SQTACYALAATI
PLMT_NEUCR            ----SLAISAAAIAFNPTFWNIV-----ARREYRTKFLTRAFGGN---AQVACYFLAVTI
D5GA05_TUBMM          ----SLLVAAGSIAFNPIFWNVV-----ARQEYHNKVLTKLFGGN---SRYGCYFLAAVI
M2UDH5_COCH5          ----SFWISAASIAFNPTFWNIA-----AQQEYHNKAITKLFGGN---SRLGCYGLAVTI
A0A0D1CJ51_USTMA      ----SLWIAVGSICFNPLYWNIV-----AQNEYHNKTITKLLGGR---RYLGCYLLAVSI
I1BQV4_RHIO9          ----SFYLALAHILFNPIFWNTA-----ARLEYKNKVLTKLAGGN---PYRGCYGLAVTI
A8NIW8_COPC7          ----SLTLSLLSITFNPTAWNIV-----ARNEYHNKTITRLFGGN---RKAGCYFLAVMI
PLMT_SCHPO            EINNSFLICAVSIALNPLLWNIA-----ARSEYNHKTLTKLANGD---SKKACYMLAACI
C4R5S7_KOMPG          ----DFQIAIASILFNPTFWNIA-----ARTEYKTHLLTKLAFNK---PKFGCYLLALTI
Q752Z0_ASHGO          ----DFRMAVFFIVFNPLFWNIV-----AQVEYKTHFLTRLAGG----ARRGCYALAFVI
PLMT_YEAST            ----KFQLAIVCTMFNPIFWNIV-----ARMEYHKHSLTKMCGG----ARKGCYMLAATI
A0A1D8PKM5_CANAL      ----QLIYSIICISFNPIFWNIV-----ARLEYKTHFLTKICFNS---AKLGCYVLAITI
Q6C649_YARLI          ----SLWIVLGSIAFNPIFWNIV-----ARAEYNTHFLTKLA-GG---AKTGCYLLAITI
C0NQR3_AJECG          ----SLHLAAAAIAFNPIFWNIVA-----RQEYRNHFLTRIF-GS---PYNGCYVLAVAI
J3K9R7_COCIM          ----SFKVAAAAIAFNPIFWNVVA-----RQEYRNHFLTRIF-GS---PYYGCYFLAVVI
Q4WTJ8_ASPFU          ----TVLEDYLLIVANPIPFLLV--------EYRKHYLTRIF-GS---PYYGCYFLGFII
PLMT_EMENI            ----SFKYAALSIAFNPIFWNVVA-----RAEYRSHFLTRIF-GS---PYRGCYFLAITI
E3K9Q4_PUCGT          ----SFWLSLAWILFNPIFWNFIA-----RQEHSTRFLTRLL-GS---PHRGCYFLGGVI
PEMT1_DICDI           ----YFLLTIACVVFNPTWWNIT-----ARMEYKTKFMTKICGS----KENGCYLLAFLI
F0Z9J5_DICPU          ----YFLAAVACIIFNPLWWNIT-----ARLEYRTQFMTKMCGG----PYKGCYLLAFLI
D3BN57_POLPP          ----YLWYTILVITSTPTWWNIV-----ARREYKTHFLTKLCGG----AYKGCYFLAFLI
PEMT_MOUSE            ----SFVAAVITIVFNPLFWNVVA-----RWEQRTRKLSRAFGS----PHLACYSLGICI
PEMT_RAT              ----SFVAAVLTIVFNPLFWNVVA-----RWEQRTRKLSRAFGS----PYLACYSLGSII
H2NSW7_PONAB          ----SFVAAVVTIAFNPLYWNVVA-----RWEHKTRKLSRAFGS----PYLACYSLSVTI
G1RTA1_NOMLE          ----SFVAAVVTIAFNPLYWNVVA-----RWEHKTRKLSRAFGS----PYLACYTLSVTI
H2QCD5_PANTR          ----SFVAAVVTITFNPLYWNVVA-----RWEHKTRKLSRAFGS----PYLACYSLSVTI
PEMT_HUMAN            ----SFVAAVITITFNPLYWNVVA-----RWEHKTRKLSRAFGS----PYLACYSLSVTI
A0A0D9R7U9_CHLSB      ----SFVAAVLTIAFNPLYWNVVA-----RWEHKTRKLSRAFGS----PYLACYSLSVTI
F7HWC1_CALJA          ----GFVAALLTIAFNPLYWNVVA-----RWEHKTRKLSRAFGS----PYLACYSLSITI
M3XLS2_MUSPF          ----CFVAAILTITFNPLFWNVVA-----RWEQKTRQLSRAFRS----PYLACYSLGAAI
J9P3L9_CANLF          ----CFVAAILTIAFNPLFWNVVA-----RWEQKTRKLSKAFRS----PYLACYSLGAAI
M3W4J4_FELCA          ----CFVAAILTITFNPLFWNVVA-----RWEQRTRKLSKVFRS----PYLACYSLGAAI
F6W7L8_HORSE          ----RFVAAVLAITFNPLFWNVVA-----RWEQKTRKLSRAFRS----PYLACYSLGCAI
PEMT_BOVIN            ----HFVAAVLAIVFNPLFWNVVA-----RWEHKTRKLSKAFGS----PRLACYTLGGAI
F6WK67_MONDO          ----SFVAAVLCIIFNPLFWNLVA-----RWEHKTRKLSRAFGS----PYRACYCLGTTV
G3X0I9_SARHA          ----SFLAAVLCIIFNPLFWNVVA-----RWEHKTRKLSRAFGS----PYVACYCLGTTV
F1NF85_CHICK          ----GFIAAVLSIAFNPFFWNVVA-----RWEHKTRALSRGFGS----PHTACYCLGAVI
H3A5P0_LATCH          ----SFFVAVLAIIFSPLFWNVVA-----RWEHQTRSLSKFFGS----PHIGCYCLGTII
Q6DF13_XENTR          ----RFLIALLCIVFNPLFWNLVA-----RWEYRTHTITRLFGS----PYIGCYSLGVVI
G3NPV5_GASAC          ----SFCVAVAAIIFNPFFWNVVA-----RWEHRTHSLSKLFGS----PYLACYCLGFVI
H2V443_TAKRU          ----SFCVALIAIIFNPFFWNLVA-----RWEHRTRRLSGLFGS----PFLACYCLGFII
A0A087YIS2_POEFO      ----NLSIAVIAIIFNPLFWNVVA-----RWEHRTRCLSRLFGG----PYVACCGLGLVI
H3CPN0_TETNG          ----SFFIAVMAIIFNPLFWNLQSC----GWKKNKRKYSRCFGSDQ-SSNKSFSDCSKLW
A0A0R4ICV3_DANRE      ----DFCNIIILICFHIFFWSKVA-----RWEHRTRGLTRLFGG----PYVACYSLAVLI
B3RI13_TRIAD          ----RLLYAMGTIILSPLYWNVIG-----RLEMKTKFFTSIFGS----NYIGCYFIGLTI
C3Z402_BRAFL          ----NFLITVVLIMFSPTYWNLVA-----RSEYRSHWVTHLFRS----ARVGCSVLAVSI
C3YCR1_BRAFL          ----NMLIAALGIILKPGIWTVMC-----RSEYRTRWMTNLFRS----KYTACSVMAVTI
W4YKN1_STRPU          ------MGNVWLYQAEGCSTKWIA----SRYEYRTSFLTRLFGSK----KIACAVFCCII
Q4Q632_LEIMA          ----SIGAAAVAIAGLPTVWNIVA-----RNEYRRHTIERAVGGK----KVGAYVLAAAI
A4I735_LEIIN          ----SIGTAAVAIAGLPTVWNMVA-----RNEYRRHTIEKAAGGK----RLGAYALAAAI
A4HJL2_LEIBR          ----SIGMAAVAIAGLPTVWNVVA-----RNEYRRHTIEKAVGSK----KAGAYLLAAGI
V7AT94_PHAVU          ---MGIAAAVGMLSPFPFYYCLWN--------WPQSWVELCGRGR---DPSTVMAHVAHF
C3VD33_SOYBN          ---MGIAAAIGLLSPFPFYYCLWI--------WPQWWVDLCGRGREARDPSKVMAYVSYF
M1CRT3_SOLTU          ---MGLWACLAVISPFPFYYYLWT--------HPQKWVDLCGSGR---DPCKVMAIVSHF
K4C822_SOLLC          ---MGLWACLAVISPFPFYYYLWT--------HPQKWVHLCGSGR---DPCKVMAIVSHF
PLMT_ARATH            ---MGLLAAIGVLLPFPFYWWLWT--------NAQSWVNLCGRER---DPSTVMARVSHV
B6TCL8_MAIZE          ---AAAAAAVGVLLPFPFYYVLWT--------HPQRWVDLCGRS---ADPCRRMAQVSHA
C5XXB9_SORBI          ---AAAAAAVGVLLPFPFYYALWT--------HPQRWVDLCGRG---ADPCRRMAQVSHA
K3YW84_SETIT          ---AAA---VGVLLPFPFYYALWT--------HPQRWVDLCGRG---ADSCRRMAQVSHV
A3A901_ORYSJ          ---AAAA--VGVLLPFPFYWALWN--------HPQRWVDLCGGGGGGVDPCRRMAQVSHV
I1IBI0_BRADI          ---AALAAGVGVLLPFPFYWALWS--------YPQRWVDLCGRG---ANPCRRMAQVSHI
M0SVN2_MUSAM          ---VAVAVSVGVVLPFPFYYLLWN--------HPQAWVDLCGKG---VDPSHRMAQISHA
D5ACP7_PICSI          ---HCLLVCVAVILPFPFYYFLWT--------YPGRWVQWCGEGV---NPSHRMALISHI
A9SGX7_PHYPA          ---HGLLVSVFVLSPFPFYWYLWT--------YPKKWIKICEGV----DPSHRMAQIAHI
A9V3D6_MONBE          G-DYSALRSCFATIMAPILWNLLP-------QIFGPALINWIGR-----RQAMLVFSLYV
                                                                                  

A0A098DEY5_GIBZE      FSLGMVRDLVFKNAISEQPT--HPALVNDY------------MRAAAATLFAVGNILVVS
C7YM51_NECH7          FSLGMVRDYIYKSAIAEQPS--HPLLDSVY------------VQAAALTLFAVGNVLVVT
G2X5U8_VERDV          FLLGLFRDGLYERALRHQPT--HPALDTDL------------ANYAGYALLAAGNVLVIT
PLMT_NEUCR            FGLGLVRDFLYERALRDQPS--HPLLEGTY------------VKYAAYALLALGNLLVIT
D5GA05_TUBMM          FGIGIFRDFLYEQALRQQPS--LDVLQTDA------------VKLAALALFFCGNVLVLT
M2UDH5_COCH5          FSLGIFRDYLYNEALADQPT--HPALLSPA------------IKYSAIPLFLTGNVLVVT
A0A0D1CJ51_USTMA      FSLGILRDHLYNLALKDQPT--HALLQQAW------------VKPVAALLFASGNIFVLS
I1BQV4_RHIO9          FTLGITRDYLYHEALSFQPT--HPFFDQQI------------VQISAFLLFITGNVLVLS
A8NIW8_COPC7          FSFGILRDYLYHEALKEQPK--VALIPYEY------------ASKIAVVLFGLGQLFVIT
PLMT_SCHPO            FVAGIVRDLIYQNALKQQPT--LGIFMNPL------------VQGIAKLIFCFGSVLVLS
C4R5S7_KOMPG          FSLGLFRDYLYEKALKNQAS--SVLLADPV------------FRYLGIASFLFGNVLVLS
Q752Z0_ASHGO          FSLGLVRDYYFSRALKNQVT--TAWLDQDA------------VRYAGAGLFVFGQVLVLS
PLMT_YEAST            FSLGIVRDMVYESALREQPT--CSLITGEN------------WTKLGVALFGLGQVLVLS
A0A1D8PKM5_CANAL      FSLGIYRDHVYYQALETQPT--YQPLIDSI-----------IIKSLAIALFAFGNVLVIS
Q6C649_YARLI          FSLGIFRDYLYHQALEQQPT--SILLSVTYVD---------IVKPLAIVLFAVGNVLVLT
C0NQR3_AJECG          FSLGILRDHLYNRALADQPF--YQPVSQPYL---------------AYGLFATGNTLVLS
J3K9R7_COCIM          FSLGIFRDNLYNEALKDQPY--FAPVHQPYV---------------AYGLFAVGNTLVVS
Q4WTJ8_ASPFU          FTLGLARDHVYQLALQDQPY--YAPVHQPIL---------------GSVLFGIGSILVLS
PLMT_EMENI            FSLGILRDHIYQQALEDQPY--YAPVHQPVL---------------GGALFAVGSVLVLS
E3K9Q4_PUCGT          FIIGLLRDHYFKQALEHQPT--HPLLSQPIIQ------------LISKAVFTSGAILVAS
PEMT1_DICDI           FSLGILRDWLFSEALIRQPI--FQEFDRF------------EVEVLSYILYGFGGILVLA
F0Z9J5_DICPU          FALGILRDYLFSEALNRQAV--FAGFDNF------------ECEVISYILYGVGGILVLG
D3BN57_POLPP          FTCGALRDYLFAESMKRQPI--HPLLEQFSQ----------ELQTVSYALYAIGGILVGA
PEMT_MOUSE            LLLNILRSHCFTQAMMSQPK--MEGLDNHT------------TYFLGLAFLGWGFVFVLS
PEMT_RAT              LLLNILRSHCFTQAMMSQPK--MEGLDSHT------------IYFLGLALLGWGLVFVLS
H2NSW7_PONAB          LLLNFLRSHCFTQAMLSQPR--MESLDTPA------------AYSLGLALLGLGVVLVLS
G1RTA1_NOMLE          LLLNFLRSHCFTQAMLSQPR--MESLDTPS------------AYSLGLALLGLGVMLVLS
H2QCD5_PANTR          LLLNFLRSHCFMQAMLSQPR--MESLDTPA------------AYSLGLTLLGLGVVLVLS
PEMT_HUMAN            LLLNFLRSHCFTQAMLSQPR--MESLDTPA------------AYSLGLALLGLGVVLVLS
A0A0D9R7U9_CHLSB      LLLNFLRSHCFTQAMLSQPK--MESLDTPA------------AYSLGLALLGLGVVLVLS
F7HWC1_CALJA          LLLNFLRSHCFTQAMLNQPR--MESLDTPV------------AHCLGLMLLGVGVVLVLS
M3XLS2_MUSPF          LLLNVLRSHCFTQAMLSQPK--MESLDNPT------------AYRMGLALLGVGSTFVLS
J9P3L9_CANLF          LLLNILRSHCFTQAMLSQPK--MESLDNPM------------AYRVGLALLGVGSTFVLS
M3W4J4_FELCA          LLLNVLRSHCFTQAMLSQPK--MESLDNPT------------AYRVGLALLGIGSTFVLS
F6W7L8_HORSE          LLLNFLRSHCFTQAMLSQPK--MESLDNPV------------AYCVGLALLGVGTVFVLS
PEMT_BOVIN            LLLNVLRSHCFTQAMLSQPR--MQSLDNPA------------VYHVGLALLGVGGVFVLS
F6WK67_MONDO          LLLNFLRSYCFTQAMSSQPK--MEGLDCPG------------AFYVGLAILGVGIVFVFS
G3X0I9_SARHA          LLLNFLRSHCFTQAMLRQPK--MERLDCLE------------AYYVGLVILGIGIIFVLS
F1NF85_CHICK          LLLNCVRSHCFTEAMKSQPK--LEGLDSHW------------AYYSGLAIMAVGTLFVIS
H3A5P0_LATCH          VLLNCFRTHCFTETMNNQPK--LESLQVTT------------AYYLGLFLLVLGTVLVLS
Q6DF13_XENTR          ISLAVLRSHCFTEAMKTQPH--IGALESTG------------VYYLSWMLIGAGGVLVVS
G3NPV5_GASAC          ILLNVYRSHSMTVAMKAQAK--WEVMDRTD------------VFYAGAGLMVLGTVLVVS
H2V443_TAKRU          ILLNVLRSHSMTVAMKAQPR--WEAMDRMD------------VFYVGTALIIVGTVLVVS
A0A087YIS2_POEFO      ILLNVFRSHSMTVVMKTQAR--WELMERTD------------VFYVGISLIVTGTVLVVS
H3CPN0_TETNG          VIVDVLTKHCMTIAMKAQPR--WELMNRAE------------VFYAGTALIVAGTVLVVS
A0A0R4ICV3_DANRE      LLLNVYRSHSVTVAMKGQSR--WDLLENLQ------------VYYAGAALMAVGSLLVIS
B3RI13_TRIAD          LMLGFHRDYRFYDLIEAQPK--SDFLDQES------------FKFIGTALMVVGTILVLT
C3Z402_BRAFL          MLLGLHRDWWFKQTLYSQPK--VSAIQSP---------------VLGYAVIAIGALLVLS
C3YCR1_BRAFL          LLMGAVRDSLYMTALQSQPS--LSAIQLP---------------IVGYAIAGIGSLFVLS
W4YKN1_STRPU          AILALFRFNTFYHAVTPQES--WPLIDHMV------------IRTIGQVLTASGVVMATW
Q4Q632_LEIMA          FVASGVRDYAFHNAMAQNPSSVFPILCTQALGPENAGVVRGVMRSVGAALMAAGTTLVVS
A4I735_LEIIN          VAASGARDYAFRNAMAQNPCPLLPILCTQALGPENAGVVRGVMRGVGAALMATGTTLVVS
A4HJL2_LEIBR          FVASVLRDYLFRNAMVHTPSSVFPILCTHAFGPDSAGFARSVMRGTGTALLLSGTTLVVS
V7AT94_PHAVU          LKLLQFISLFSVSTFHWPPP------------------------FYFWPLLAFGQFLNFR
C3VD33_SOYBN          LKLVQFISLFYVSSFHWPPP------------------------FYFWPLIAFGQFLNFR
M1CRT3_SOLTU          IKLIQFISLLSVSTFSWPPP------------------------LYFWPLFIFGQFLNFR
K4C822_SOLLC          IKLIQIISLLSVSTFSWPPP------------------------LYFWPLFIFGQFLNFR
PLMT_ARATH            LKAAQLLSLFSVASLSWPPP------------------------LYFWPLMAFGQFLNFR
B6TCL8_MAIZE          IKALQLLALASVSSFSWPPP------------------------LYCPILLAVGQYLNFR
C5XXB9_SORBI          IKALQLLALASVASFSWPPP------------------------LYCPVLLAVGQYLNFK
K3YW84_SETIT          LKALQLLALASVASFSWPPP------------------------LYCPVLLAVGQYLNFK
A3A901_ORYSJ          LKALQLLALASVASFSWPPP------------------------LYSVALLAVGQYLNFK
I1IBI0_BRADI          LKALQLLSLASVASFSWPPP------------------------PCALILLACGQYLNFK
M0SVN2_MUSAM          LKAIQFVSLLSVARISRPP-------------------------WYCVVLFLLGQLLNFK
D5ACP7_PICSI          LKLTQILAVLTVAHFVWPP-------------------------WYSLLLIIVGQYLNFK
A9SGX7_PHYPA          LKSLQIISVVSVATFS-PPP------------------------LICVVLFALGQILNYR
A9V3D6_MONBE          FLFTCFRSWAFQMGIADDKTSFDVLLPFFPNA----TVFHNIFFAVGAATVLVGTVLTSA
                                    .                                      *  :   

A0A098DEY5_GIBZE      STWRLGITGTFLGDYFGFLMDEMVTGFPFNVTGSPMYTGSTCSFLATSLWYGKPAGVLLT
C7YM51_NECH7          STWRLGITGTFLGDYFGILMDEMVTGFPFNVTSSPMYTGSTMSFLATALYFGKPAGILLT
G2X5U8_VERDV          STYRLGITGTFLGDYFGILMDDIVTGFPFSLTDAPMYNGSTMSFLGTALLYGKPAGILLT
PLMT_NEUCR            STMRLGITGTFLGDYFGILMDGIVTGFPFNVTSAPMYYGSTMSFLGTALLYGKPAGLLLT
D5GA05_TUBMM          SMWALGFTGTYLGDYFGILMDHRVTSFPFNVTDAPMYYGSTMAFLGSALWFAKPAGILLT
M2UDH5_COCH5          SMWALGVTGTYLGDYFGILMDEPVTTFPFNVSSSPMYHGSTMSFLATAIWYGKPAGILLS
A0A0D1CJ51_USTMA      SMWALGVTGTYLGDYFGILMDSIVTGFPFNVMANPMYWGSSMSFTAVALWFGKPAGLLLS
I1BQV4_RHIO9          SMWALGVTGTYLGDYFGILMKERVTGFPFNVCDNPMYVGSTCTFLATALWYKSPAGVLLT
A8NIW8_COPC7          STWQLGITGTFLGDYFGILMDHRVEGFPFNILNDPMYVGSTMSFIATALWTERPAGLFIS
PLMT_SCHPO            SMYKLGLVGTYLGDYFGFLLPERVSGFPFNVNDNPMYNGSTLCFLSTALRYGKVAGLLLT
C4R5S7_KOMPG          SMWKLGITGTYLGDYFGILMEDRVTSFPFNIDDNPMYNGSTLCFLGTGLYYGKPAGVFAS
Q752Z0_ASHGO          SMWRLGVTGTYLGDYFGILMEDRVTSFPFNVSDNPMYQGSTLTFLGTSLYYGKAAGVFAA
PLMT_YEAST            SMYKLGITGTYLGDYFGILMDERVTGFPFNVSNNPMYQGSTLSFLGIALYKGKPAGLVVS
A0A1D8PKM5_CANAL      SMYALGVTGTYLGDYFGILMDHRVTGFPFNINDNPMYNGSSLCFLATALWYGKPAGIAVA
Q6C649_YARLI          SMYALGVTGTYLGDYFGILMNERVTGFPFNVSNNPMYHGSTLCFLASALWYAKPAGLLIT
C0NQR3_AJECG          SMWALGLTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLSFLAVALYKGKVAGLLLT
J3K9R7_COCIM          SMWALGLTGTYLGDYFGILMDAPVTGFPFNVSGAPMYWGSTMSFLAVALYYGKVAGLVLT
Q4WTJ8_ASPFU          SMYALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYFGRVAGLLLT
PLMT_EMENI            SMYALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYKGKVAGILLT
E3K9Q4_PUCGT          SMWALGFTGTYLGDYFGILMDEIVEGFPFSLTSSPMYDGSTLCFLGTALSYQSPAGLVLT
PEMT1_DICDI           AYLKLGITGTYLGDYFGILMKERVTGFPFNVMNNPMYNGSVMLFIAHALSYKSVAGLVLS
F0Z9J5_DICPU          AYLKLGITGTYLGDYFGILMKERVTGFPFNVMNNPMYNGSCMLFLAHAISGKSLAGVALT
D3BN57_POLPP          TYYRLGITGTYLGDYFGILMKERVYGFPFNVMSNPMYNGSTILFLAHALHGKSVAGIFLS
PEMT_MOUSE            SFYALGFTGTFLGDYFGILKESRVTTFPFSVLDNPMYWGSTANYLGWALMHASPTGLLLT
PEMT_RAT              SFYALGFTGTFLGDYFGILKESRVTTFPFSVLDNPMYWGSTANYLGWALMHASPTGLLLT
H2NSW7_PONAB          SFFALGFTGTFLGDYFGILKEARVTMFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLT
G1RTA1_NOMLE          SFFALGFTGTFLGDYFGILKEARVTMFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLT
H2QCD5_PANTR          SFFALGFTGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLT
PEMT_HUMAN            SFFALGFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLT
A0A0D9R7U9_CHLSB      SFFALGFTGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLT
F7HWC1_CALJA          SFFALGFTGTFLGDYFGILKEARVIVFPFSVLDNPMYWGSTANYLGWAILHASPTGLLLT
M3XLS2_MUSPF          SFFALGFTGTFLGDYFGILKEARVTTFPFNILDNPMYWGSTANYLGWAVMHASPTGLLLT
J9P3L9_CANLF          SFFALGFTGTFLGDYFGILKEARVTTFPFNILDNPMYWGSTANYLGWAVMHASPTGLLLT
M3W4J4_FELCA          SFFALGFTGTFLGDYFGILMEARVTTFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLT
F6W7L8_HORSE          SFFALGFTGTFLGDYFGILKEARVTTFPFNLLDNPMYWGSTANYLGWAIMHASPAGLLLT
PEMT_BOVIN            SFLALGFTGTFLGDYFGILKEARVTMFPFSVLDNPMYWGSTAIYLGWAIVHASPTGLLLT
F6WK67_MONDO          SFLALGFIGTYLGDYFGILKEARLTTFPFSVLDNPMYWGSTANYLGLSIMNASPTGLLLT
G3X0I9_SARHA          SFHALGFIGTYLGDYFGILKEARVTKFPFNVLDNPMYWGSTANYLGWSIMNASPTGLMLT
F1NF85_CHICK          SFLALGFTGTFLGDYFGILMEAKVTCFPFSILDNPMYWGSTAVYLGWSLMHASPAGLLLT
H3A5P0_LATCH          SFYALGVTGTFLGDYFGILMEEKVTVFPFNIMENPMYWGSTANYLGWAIMNSSPIGLVLT
Q6DF13_XENTR          SFLALGFVGTYLGDYFGILMEKKVTGFPFNVMENPMYWGSTANYLGLALLNASPAGLLLT
G3NPV5_GASAC          SFLALGFTGTFLGDYFGILMDEKVTGFPFNITENPMYWGSTANYLGLALIGASPVGLVLT
H2V443_TAKRU          SFLALGFTGTFLGDYFGILLDEKVTVFPFNIMENPMYWGSTANYLGLALIGASPVGLILT
A0A087YIS2_POEFO      SFLALGFTGTFLGDYFGILMDEKVTGFPFSVVENPMYWGSTANYLGLALIGASPVGLVLT
H3CPN0_TETNG          SFLALGFTGTFLGDYFGILLDEKVTVFPFNVMENPMYWGSTANYLGLALIGASPVGLILT
A0A0R4ICV3_DANRE      SFLALGVTGTFLGDYFGILMDQKVTGFPFNVMDNPMYWGSTANYLGLALMNASPIGIVLT
B3RI13_TRIAD          SYWRLGFTGTFLGDYFGILLEERVTTFPFNIFDNPMYIGSTSNFLGLALRSASPCGIIMS
C3Z402_BRAFL          SFWALGWYGTFLGDYFGMLMDEPVTSFPFNLVSDPMYVGTTMNFAGVALLEGSLAGLVLA
C3YCR1_BRAFL          SFWRLGWYCTFMGDYFGIHLDERIDSFPFSVLDNPMYWGTTLNFVGVAFMMGSPAGLLLC
W4YKN1_STRPU          AIVALNFYGYGFADSFDILMEERVTSFPFNVFNNPMYLGSTLEYVGASLVAASPTGMVLS
Q4Q632_LEIMA          SFLRLGITGTYLGDYFGILMDERVTAFPFSHFDNPMYIGATLNFLAASIAQNNAVGTLLT
A4I735_LEIIN          SFLRLGITGTYLGDYFGILMDERVTAFPFSHFDNPMYLGATLNFLAASIAQNNAVGTLLT
A4HJL2_LEIBR          SFLRLGVTGTYLGDYFDILMDERVTAFPFSHFDNPMYLGATLNFLAASIIQNNAVGVLLT
V7AT94_PHAVU          VYQLLGEAGTYYGVRFGKNI-PWVTEFPFGFIKDPQYVGSIMSLLACLWF--APFQYILL
C3VD33_SOYBN          VYQLLGETGTYYGVRFGKTI-PWVTEFPFGVIKDPQYVGSIMSILACFSW--VPFQYILL
M1CRT3_SOLTU          VYQLLGEAGTYYGVRFGKNI-PWATEFPFGVIRDPQYVGSILSLLACLSW--VPFLYIFL
K4C822_SOLLC          VYQLLGEDGTYYGVRFGKNI-PWVTEFPFGVIRDPQYVGSILSLLACLSW--VPFLYIFL
PLMT_ARATH            VYQLLGEAGTYYGVRFGKNI-PWVTEFPFGVIRDPQYVGSIMSLLACLSW--VPFQYILL
B6TCL8_MAIZE          VYQLLGEPGTYYGVRFGKTI-PWVTEFPFGYIKDPQYVGSMLSLVALLCW--VPLQYVLL
C5XXB9_SORBI          VYQLLGESGTYYGVRFGKMI-PWVTEFPFGYIKDPQYVGSMLSLVALLCW--VPLQYVLL
K3YW84_SETIT          VYQLLGESGTYYGVRFGKKI-PWVTEFPFGYIKDPQYVGSMLSLAALLCW--VPLPYVLL
A3A901_ORYSJ          VYQLLGEPGTYYGVRFGKKI-PWVTEFPFGYIKDPQYVGSMLSLVALLCW--VPFQYVLL
I1IBI0_BRADI          VYQLLGESGTYYGVRFGKKI-PWVTEFPFGYIKDPQYVGSILSLVALLCW--VPYQYVLL
M0SVN2_MUSAM          VYQLLGEAGTYYGVRFGKNI-PWVTEFPFGYIKDPQYVGSILSLLACLCW--VPFQYIFL
D5ACP7_PICSI          VYELLGETGTYYGVRFGNKV-PWVTDFPFGYIRDPQYTGSILSLLGCLCW--VPWQYVSL
A9SGX7_PHYPA          VYDLLGEEGVYYGGCFGKDL-PWVEKFPFGYFRDPQYVGSIMSLLGVSCW--VPFPFIAL
A9V3D6_MONBE          SFIRLGIFGTYMGEFFGVMLSEKITTFPFDVVDNPMYFGSSLMHIGLAIMEQSPVGVVLG
                          *.      .  *.         ***.    * * *:     .              

A0A098DEY5_GIBZE      IWVDIVYKLALR-YEDPFTSEIYAKRE----------------------RERAAGKKSN-
C7YM51_NECH7          VWVYIVYKIALL-YEDPFTSGIYAKREPTPF-----------------NRPGASQQAKGS
G2X5U8_VERDV          LWVLTVYTVALR-YENPFTAGIYAKRD----------------------RERAAAGPGKE
PLMT_NEUCR            AWVLFVYIIAIQ-FENPFTAEIYAKRD----------------------RERAKAA-GTS
D5GA05_TUBMM          IEVFIVYKMALM-FEDPFTGAIYAKRE----------------------RERAKKST---
M2UDH5_COCH5          GLVAVAYSIACK-WEDPFTAMIYRKREEER--------------------SRGKKGQ---
A0A0D1CJ51_USTMA      VLVVIVYALALR-FEEPFTANIYKQAEKKRRAEAEKQALIESQGPASGTRNRSKRTPSKP
I1BQV4_RHIO9          GVVYIVYKIALS-FEEPFTAMIYSNKDSKNE-----------------------------
A8NIW8_COPC7          AYVYIVYRIALL-FEGPFTDMIYSNRAAEQK------------------KAEGKSS----
PLMT_SCHPO            LEVFFVYRIALK-FEEPFTAKIYAARD----------------------SKQAKKSE---
C4R5S7_KOMPG          LVVYLMYQIALK-FEEPFTAKIYAKREA----------------------EREQKKKKSL
Q752Z0_ASHGO          LLVNLMYTMALK-LEEPFTAMIYAKRDE----------------------ERAQKAK---
PLMT_YEAST            AVVYFMYKIALR-WEEPFTAMIYANRD------------------------KAKKNM---
A0A1D8PKM5_CANAL      IYVFVMYKIALL-FEEPFTAKIYANRID----------------------KLD-------
Q6C649_YARLI          AFVSLMYSIALK-FEEPFTGEIYAKRDR----------------------ELAAKQK---
C0NQR3_AJECG          LEVFVCYWLALK-WEDPFTAEIYAKRER----------------------DRAKSKKGGK
J3K9R7_COCIM          AEVFIVYWLALK-WEDPFTAEIYAKRDR----------------------DRAKSGKNSK
Q4WTJ8_ASPFU          AEVFVVYWIALQ-WEDPFTAEIYAKRER----------------------ERAKSKKGGK
PLMT_EMENI            ALVFVLYWFALK-WEDPFTAEIYAKRER----------------------ERAKSKRGGK
E3K9Q4_PUCGT          GIVYLVYQLALR-FEDPFTANIYRQRDL----------------------KSNKSK----
PEMT1_DICDI           FVVYVVYKFALI-FEESFTNYIYSTAAA----------------------NAAKKNKSKS
F0Z9J5_DICPU          IVVYIVYKFALV-FEESFTNYIYSNAAK----------------------KSSKKSN---
D3BN57_POLPP          LIVFITYRIALT-FEEPFTAHIYSKRTS----------------------TGGQEQKRSA
PEMT_MOUSE            VLVAIVYVVALL-YEEPFTAEIYRQKAT-----------------------RLHKRS---
PEMT_RAT              VLVALVYVVALL-FEEPFTAEIYRRKAT-----------------------RLHKRS---
H2NSW7_PONAB          VLVALTYMVALL-YEEPFTAEIYRQKAS-----------------------GSHKRS---
G1RTA1_NOMLE          VLVALTYMVALL-YEEPFTAEIYRQKAS-----------------------GSHKRS---
H2QCD5_PANTR          VLVALTYIVALL-YEEPFTAEIYRQKAS-----------------------GSHKRS---
PEMT_HUMAN            VLVALTYIVALL-YEEPFTAEIYRQKAS-----------------------GSHKRS---
A0A0D9R7U9_CHLSB      VLVALTYMVALL-YEEPFTAEIYRQKAS-----------------------GPHKRS---
F7HWC1_CALJA          VLVALTYMVALL-YEEPFTAEIYRQKAS-----------------------GALKRS---
M3XLS2_MUSPF          AVVALVYMVAIL-YEEPFTAQIYQQKAS-----------------------LSHKRS---
J9P3L9_CANLF          VVVALIYRVAIL-YEEPFTAQIYQQKAS-----------------------SSHKRS---
M3W4J4_FELCA          VVVALIYMVAIQ-YEEPFTAQIYQQKAS-----------------------SSRKRS---
F6W7L8_HORSE          VVVALIYVVAVL-YEEPFTAEIYRQKAS-----------------------QSHKRS---
PEMT_BOVIN            ALVALIYMVAIV-YEEPFTAEIYQQKAS-----------------------QAYKRS---
F6WK67_MONDO          VVVGLTYTVAIL-YEEPFTEEIYRQKAQ-----------------------QLKKKK---
G3X0I9_SARHA          IIVALTYTVAIV-FEEPFTEEIYRQKAL-----------------------KSKKNK---
F1NF85_CHICK          AVVAISYTIAVL-YEGPFTEEIYRQKQK-----------------------GAKSN----
H3A5P0_LATCH          AVVALVYKVAIA-FEGPFTEEIYQQKQK-----------------------STKNK----
Q6DF13_XENTR          ALVALCYKVAIL-YEGPFTEEIYRKKET-----------------------AKKRK----
G3NPV5_GASAC          AIVAVVYKMAIR-FEGPFTELIYQERSQ-----------------------RRKRE----
H2V443_TAKRU          ATVAAAYKVAIQ-FEGPFTAQIYRERSQ-----------------------RRK------
A0A087YIS2_POEFO      AIVVLAYKVAIR-FEGPFTEQIYLQRNQ-----------------------RRKQE----
H3CPN0_TETNG          ATVAAVYKVAIQ-FEGPFTAQIYRERSQ-----------------------SRKHE----
A0A0R4ICV3_DANRE      AVVALSYKVAIA-YEGPFTQEIYRQRSQ-----------------------RCKHK----
B3RI13_TRIAD          GFVYLVYWIGLL-LEEPYTEEIYRQKNE-----------------------KLT------
C3Z402_BRAFL          ALVGLCYKVALL-FEGPFTEEIYRKRDA-----------------------DKRKVY---
C3YCR1_BRAFL          GLIVLCYKVLLR-YEEPFTADIYSKRGL-----------------------EQKKV----
W4YKN1_STRPU          ALIGAMYLIALH-FEEPFTAMIYADKAN----------------------QNIRKEN---
Q4Q632_LEIMA          GLVGLVYHVSTKYFESPFTGMIYRKRAEDRAA------------------AGVSASVKKQ
A4I735_LEIIN          GLVGLVYHVSAKYFENPFTEMIYRKRAEERAA------------------AGVSASVRKQ
A4HJL2_LEIBR          GLVALVYHVSTRYFESPFTAMIYSKRGGGPGSR----------------CLGDEDDVGRQ
V7AT94_PHAVU          WVLAYVFIMHVESKEDQSTRAKPLL-----------------------------------
C3VD33_SOYBN          WVLGYVFMMHVESKEDPSTRAKPLH-----------------------------------
M1CRT3_SOLTU          WVLGYAFIIQVESMEDPATRANPLS-----------------------------------
K4C822_SOLLC          WVLGYAFMIQIESKEDPATRAKPLS-----------------------------------
PLMT_ARATH            WSLGYVFMMFLESKEDPNARAKSIS-----------------------------------
B6TCL8_MAIZE          WCLGYVFMMWVEHKEDSASRAKVIS-----------------------------------
C5XXB9_SORBI          WCLGYVFMMWIEHKEDPATRAKVIS-----------------------------------
K3YW84_SETIT          WCLGYVFMMWIEHKEDPATRAKPLS-----------------------------------
A3A901_ORYSJ          WCLGYVFMMWVESKEDPATRAKLLS-----------------------------------
I1IBI0_BRADI          WCLGYVFMILVEDKEDPATRAKLLS-----------------------------------
M0SVN2_MUSAM          WILGYVFMIWVESTEDPTTRAKPLN-----------------------------------
D5ACP7_PICSI          WIIGYFFMMMVESHEDSSTRAKGC------------------------------------
A9SGX7_PHYPA          WTVGYVFMMFLE-QEDPKSRAVHIS-----------------------------------
A9V3D6_MONBE          AVVFWWYYMAAL-YEEPLMVEMYKKDLG---------------------KVRVRHGWDIL
                        :   : .     *                                             

A0A098DEY5_GIBZE      -------
C7YM51_NECH7          FRGF---
G2X5U8_VERDV          AKKVR--
PLMT_NEUCR            KKEL---
D5GA05_TUBMM          -------
M2UDH5_COCH5          -------
A0A0D1CJ51_USTMA      NA-----
I1BQV4_RHIO9          -------
A8NIW8_COPC7          -------
PLMT_SCHPO            -------
C4R5S7_KOMPG          -------
Q752Z0_ASHGO          -------
PLMT_YEAST            -------
A0A1D8PKM5_CANAL      -------
Q6C649_YARLI          -------
C0NQR3_AJECG          RA-----
J3K9R7_COCIM          RA-----
Q4WTJ8_ASPFU          SL-----
PLMT_EMENI            NQ-----
E3K9Q4_PUCGT          -------
PEMT1_DICDI           K------
F0Z9J5_DICPU          -------
D3BN57_POLPP          KKIQ---
PEMT_MOUSE            -------
PEMT_RAT              -------
H2NSW7_PONAB          -------
G1RTA1_NOMLE          -------
H2QCD5_PANTR          -------
PEMT_HUMAN            -------
A0A0D9R7U9_CHLSB      -------
F7HWC1_CALJA          -------
M3XLS2_MUSPF          -------
J9P3L9_CANLF          -------
M3W4J4_FELCA          -------
F6W7L8_HORSE          -------
PEMT_BOVIN            -------
F6WK67_MONDO          -------
G3X0I9_SARHA          -------
F1NF85_CHICK          -------
H3A5P0_LATCH          -------
Q6DF13_XENTR          -------
G3NPV5_GASAC          -------
H2V443_TAKRU          -------
A0A087YIS2_POEFO      -------
H3CPN0_TETNG          -------
A0A0R4ICV3_DANRE      -------
B3RI13_TRIAD          -------
C3Z402_BRAFL          -------
C3YCR1_BRAFL          -------
W4YKN1_STRPU          -------
Q4Q632_LEIMA          -------
A4I735_LEIIN          -------
A4HJL2_LEIBR          KHKNI--
V7AT94_PHAVU          -------
C3VD33_SOYBN          -------
M1CRT3_SOLTU          -------
K4C822_SOLLC          -------
PLMT_ARATH            -------
B6TCL8_MAIZE          -------
C5XXB9_SORBI          -------
K3YW84_SETIT          -------
A3A901_ORYSJ          -------
I1IBI0_BRADI          -------
M0SVN2_MUSAM          -------
D5ACP7_PICSI          -------
A9SGX7_PHYPA          -------
A9V3D6_MONBE          ASFATAA