CLUSTAL format seed alignment for MF_03224

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CHT_ASPNG         MAPVLKKYKAAAVNAEPGWFNLEESVRRTIHWIDEAGKAGCKFIAFPEL--WIPGYPYWM
CHT_PENRW         MVPVLKKYKAAAVNAEPGWFDLQESVRRTIHWIDEAGKAGCKLIAFPEL--WIPGYPYWA
CHT_EMENI         MSPVLKKYKAAAVNAEPGWFDLEESVRRTIHWINEAGRNRCKLIAFPEL--WIPGYPYWM
M2YNL0_PSEFD      MVASIRKYKAAAVNAEPGWLNLELSVQKTIHWINEAGKAGCKLIAFPEL--WIPGYPYWM
G4NIA2_MAGO7      --MSITKYKAAAVTSEPGWFDLEAGVQKTINFINEAGQAGAKLVAFPEV--WIPGYPYWM
CHT_MICSH         --MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEV--WIPGYPYWM
CHT_ALTBR         --MPLTKYKAACVTSEPCWFDLEAGVQKTINFINEAGAAGCKLIAFPEV--WIPGYPYWM
CHT_PYRTT         --MPLTKYKAAAVTSEPCWFDLTAGVQKTIDFINEAGAAGCKLVAFPEV--WIPGYPYWM
CHT_NEUCR         --MVLTKYKAAAVTSEPCWFDLEGGVRKTIDFINEAGQAGCKLVAFPEV--WIPGYPYWM
CHT_LEPMC         --MPLTKYKAAAVTSEPAWFNLEAGVQKTIDFINEAGQAGCKLIAFPEV--WIPGYPYWM
CHT_GIBBA         --MAITKYKAAAVTSEPGWFDLEGGVRKTIDFINEAGEAGCKFVAFPEV--WIPGYPYWM
CHT_GIBZE         --MAITKYKAAAVTSEPGWFDLEGGVRKTIDFINEAGQAGCKFVAFPEV--WIPGYPYWM
CHT_FUSSL         --MPITKYKAAAVTSEPGWFDLEAGVVKTIDFINEAGQAECKLVAFPEV--WIPGYPYWM
CHT_BOTF4         MPAQIKKYKAAAVQAEPGWFDLELSVKKTIHWINEAGKAGCKLVAFPEV--WIPGYPYWA
E9EE15_METAQ      MVATIRQYKAACVQAEPGWLNLEKAVKKTVDLILEAGEKDCKLIAFPEV--WIPGFPYWL
G0RNY5_HYPJQ      MVATIRQYKAACVQAEPGWFDLEKSVQKTINLITEAGEKGCKLIAFPELSDCDDRYTYWG
                      : :**** * :** * :*  .* :*:. * ***   .*::****:      :.** 

CHT_ASPNG         WKVNYQESLPLLKKYRENSLPSDSDEMRRIRNAARANKIYVSLGYSEVDLASLYTTQVMI
CHT_PENRW         WKVNYQESLPLLKKYRENSLPSDSDEMRRIREAAKANKIWVSLGYSELDLASLYTTQIMI
CHT_EMENI         WKVNYQESLPLLKKYRENSLLSDSEEMRRIREAARANKIYVSLGYSEVDLASLYTTQVLI
M2YNL0_PSEFD      WRVSYQESLPLLKKYRENSLESGSPEMQRIREAAKKNSVFVSLGYSELDLNSLYISQVMI
G4NIA2_MAGO7      WKVNYLQSLPMLKAYRENSLKVDSDEMRRIRRAARNNNIYVSLGFSEIDHATLYLAQVLI
CHT_MICSH         WKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLI
CHT_ALTBR         WKINYQQSLPMLKSYRENSLPMDSEEFRRIRRAARDNQIYVSLGFSEIDHATLYLAQALI
CHT_PYRTT         WKVNYQQSLPLLKKYRENSLPIDSEEFRKIRRAARDNQIHVSLGFSEIDHATCYLTQTLI
CHT_NEUCR         WKVTYQQSLPMLKKYRENAMAVDSDEFRRIRRAARDNQIYVSLGFAEIDHATLYLAQALI
CHT_LEPMC         WKINYQQSLPMLKKYRENSMAVDSDEFRRIRRAARDNQIHVSLGFSEIDHATLYLAQALI
CHT_GIBBA         WKVTYLQSLPMLKRYRENSMAVDSEEMRRIRRAARDNQIFVSLGFSEIDHATLYLSQVLI
CHT_GIBZE         WKVTYLQSLPMLKRYRENSMAVDSEEMRRIRRAARDNQIFVSLGFSEIDHATLYLSQVLI
CHT_FUSSL         WKVTYLQSLPMLKKYRENSLTVDSEEMRRIRRAARDNQIYVSLGFSEIDHATLYLAQVLI
CHT_BOTF4         WKVNYQQSLPMLKAYRENSLASDSDEMRRIREAARENAIYVSLGYSEIDFATLYISQVLI
E9EE15_METAQ      WRVNYQDSLPLLKKFHQNSMRPDSDEMRRVREAAKAAKIYVSLGYSELDGHTMYMAQVII
G0RNY5_HYPJQ      WRVNYQDSLPLLKEYHKNSLRPDSDEMRRIRSAARKAQIYVSLGYSEIEGNSMYIAQIII
                  *::.* :***:** :::*::  .* *::::* **:   : **:* :*::  : * :* :*

CHT_ASPNG         SPSGDILNHRRKIRATHVERLVFGDGTGDTTESVIQTDIGRVGHLNCWENMNPFMKAYAA
CHT_PENRW         SPAGDVINHRRKIKATHVERLVFGDGTGDTTESVMDTEIGRIGHLNCWENMNPFLKAYAA
CHT_EMENI         SPAGNILNHRRKIRATHVERLVFGDGTGDTTESVVQTEIGRVGHLNCWENMNPFMKSYAA
M2YNL0_PSEFD      DPTGNVINHRRKIRATHVERLVFGDGTGDTTSMVVDTSIGRIGHLNCWENMNPFLKAYAV
G4NIA2_MAGO7      GPDGEVLNHRRKIKPTHVEKLVYGDGSGDSFIPVTQTTLGRVGQLNCWENMNPFLKSLSV
CHT_MICSH         SPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAV
CHT_ALTBR         GPTGEVINHRRKIKPTHVEKLVYGDGAGDTFKSVTQTELGRLGQLNCWENMNPFLKALNV
CHT_PYRTT         DPTGEVINHRRKIKPTHVEKLVYGDGAGDTFKSVTQTELGRLGQLNCWENMNPFLKALNV
CHT_NEUCR         DPTGEVINHRRKIKPTHVEKLVYGDGAGDTFMSVTPTELGRLGQLNCWENMNPFLKSLNV
CHT_LEPMC         SPTGEVLNHRRKIKPTHVEKLVYGDGAGDTFTSVVPTELGRLGQLNCWENMNPFLKALNV
CHT_GIBBA         GPDGAVINHRRKIKPTHVEKLVYGDGSGDTFMSVSETEIGRVGQLNCWENMNPFLKSLNV
CHT_GIBZE         GPDGAVINHRRKIKPTHVEKLVYGDGAGDTFMSVSETEIGRVGQLNCWENMNPFLKSLNV
CHT_FUSSL         GPDGSVVNHRRKIKPTHVEKLVYGDGPGDTFMSVSETDIGRVGQLNCWENMNPFLKALNV
CHT_BOTF4         SPTGEVLNHRRKIKPTHVEKLVYGDGAGDTFKSVVQTDIGRVGQLNCWENMNPFLKAMNV
E9EE15_METAQ      DPTGTVINHRRKIKPTHVEKLVFGEGSGDSLHAVVETEIGNLGHLNCWENMNPFLKALNA
G0RNY5_HYPJQ      DPNGDVINHRRKIKPTHVEKLVFGEGTGDSLVSVVETEIGNLGHLNCWENMNPFLKANAC
                  .* * ::******:.****:**:*:*.**:   *  * :*.:*:**********:*:   

CHT_ASPNG         SLGEQVHVAAWPLYPGKETLKYPDPFTNVAEANAD--------LVTPAYAIETGTYTLAP
CHT_PENRW         SLGEQVHIAAWPLYPGKETLKYPDPYTNVAEANAD--------LVTPAYAIETGSFTLAP
CHT_EMENI         SLGEQVHVAAWPLYPGKETLKYPDPYTNVAEANCDALANELPQLVTPAYAIETGTYTLAP
M2YNL0_PSEFD      SLGEQVHVAAWPLYPHATTLKHPDPYTNISDANSD--------IVTPAYAIETGSFTLAP
G4NIA2_MAGO7      ASGVQVHVAAWPVYPGVEQQVAPDPATNYADTASD--------LVTPAFAIETGSWVLAP
CHT_MICSH         ARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASD--------LVTPAYAIETGTWVLAP
CHT_ALTBR         SEGEQIHIAAWPVYPGKETLKYPDPATNVADPASD--------LVTPAYAIETGTWTLAP
CHT_PYRTT         SEGEQIHIAAWPVYPGKETLNYPDPATNVAEPASD--------LVTPAYAIETGTWTLAP
CHT_NEUCR         SMGEQIHIAAWPIYPGKETLKYPDPATNVADPASD--------LVTPAYAIETGTWTLAP
CHT_LEPMC         SAGEQIHIAAWPVYPGKETLKYPDPATNVADPASD--------LVTPAYAIETGTWTLAP
CHT_GIBBA         SAGEQVHVAAWPVYPGKERQVHPDPATNYADPASD--------LVTPEYAIETGTWTLAP
CHT_GIBZE         SAGEQVHVAAWPVYPGKERQVYPDPATNYADPASD--------LVTPEYAIETGTWTLAP
CHT_FUSSL         SCGEQVHIAAWPVYPGRERQVAPDPATNYADPASD--------LVTPEYAIETGAWTLAP
CHT_BOTF4         SEGEQVHIAGWPIYPHEETRTPLDPWTNTSNPNSD--------IVSPAYAIETATYVLAP
E9EE15_METAQ      SKHEEIHVAAWPVYGPGSAIKYPDPYTNASEIQSD--------HVTPAYAYETGAWTLAP
G0RNY5_HYPJQ      AQYEQVHVAAWPVYPPASTLQYPDPYTNISEVQSE--------LVTPAYAYETGTWTLAP
                  :   ::*:*.**:*         ** ** ::  .:         *:* :* **.::.***

CHT_ASPNG         WQTITAEGIKLNTPPGKDLE-------DPHIYNGHGRIFGPDGQNLVPHPDKDFEGLLFV
CHT_PENRW         WQTITAEGIKLNTPPGKELE-------DPNIYNGNGRIFGPDGQNLVPHPDKDFQGLLFV
CHT_EMENI         WQTITEEGIKLNTPPGKPLE-------DPNIYNGHGRIFAPDGRNLVPHPAKDFQGLLYV
M2YNL0_PSEFD      FQMISAEGVKLQNPAGKTPE-------DNHIYNGNTRIYGPDGQSLIERPTEDFEGLVVV
G4NIA2_MAGO7      FQRLSVEGLKKTTPAGVEPET------DPTPYKGHARIYRPDGSLAVPKPDKDFDGLMFV
CHT_MICSH         FQRISVEGLKRHTPPGVEPET------DATPYNGHARIFRPDGSLYA-KPAVDFDGLMYV
CHT_ALTBR         FQRLSVEGLKKTTPEGVEPET------DPSTYNGHARIYKPDGTLVC-KPDKDFDGLLFV
CHT_PYRTT         FQRLSKEGLKINTPEGIEPET------DPSTYNGHARIYRPDGSLYA-KPDKDFDGLMFV
CHT_NEUCR         FQRLSVEGLKKNTPEGVEPET------DPSTYNGHARIYRPDGSLVV-RPDKDFDGLLFV
CHT_LEPMC         FQRLSAEGLKMNTPEGVEPET------DPTTYNGHARIYRPDGSLVV-KPDKDFDGLLFV
CHT_GIBBA         FQRLSVEGLKINTPEGVEPET------DPSVYNGHARIYRPDGSLVV-KPEKDFDGLLFV
CHT_GIBZE         FQRLSVEGLKINTPEGVEPET------DPSVYNGHARIYRPDGSLVV-KPEKDFDGLLFV
CHT_FUSSL         FQRLSVEGLKKNTPEGVEPET------DPSVYNGHARIYRPDGSLVV-KPDKDFDGLLFV
CHT_BOTF4         FQRISKEGVDKCTPPGVERE-------DHNLYNGNSRIFGPDGQCLA-KADEEFEGLMFV
E9EE15_METAQ      SQVVTREGARLGLPVRLQNDEAALDGEADIIGNGYSRVYRPDGFRAVDDPAKTFDGLLIV
G0RNY5_HYPJQ      SQVVTREGARANLPPRLRNDEAAVDAEAAVIGNGFARIYRPDGFRAVQDPPKDFEGIFIV
                   * :: **     *     :            :*  *:: ***      .   *:*:. *

CHT_ASPNG         DIDLDECHLSKSLADFGGHYMRPDLIRLLVDTNRKDLVVREDR-VNGGVEYTRTVDRVGL
CHT_PENRW         DIDLDEIHLTKSLADFGGHYMRPDLIRLLVDTNRKDLVVHEDR-VNGGVAYTRTIDRVGL
CHT_EMENI         DIDLDEIHLTKSLADFGGHYMRPDLIRLLVDGNRKDLVVSEDR-INGGIKYTSTMDRVGL
M2YNL0_PSEFD      DIDLDETHLSKALNDFGGHYMRPDLIRLVVDTDRKNSVSRVN--GSGTHEIISTMERVGL
G4NIA2_MAGO7      DIDLNETHLTKVIADFAGHYMRSDLIRLLVDTRRKELITEAD--PQGGIKSYSTRTRLGL
CHT_MICSH         DIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGL
CHT_ALTBR         DIDLNECHLAKALADFSGHYMRPDLIRLLVDTRRKELITEAD--TNGGIATYTTRERLGL
CHT_PYRTT         DIDLNECQLTKALADFSGHYMRPDLIRLLVDTRRKELVTEAD--PHGGITSYSTRQRLGL
CHT_NEUCR         DIDLNECHLTKALADFAGHYMRPDLIRLLVDTSRKELVTEVD--RNGGIVQYSTRERLGL
CHT_LEPMC         DIDLNECHLTKALADFSGHYMRPDLIRLLVDTRRKELVTEAE--GNDGVKAYSTRERLGL
CHT_GIBBA         DIDLNECHLTKVLADFAGHYMRPDLIRLLVDTRRKKLITEAD--PNGSIATYSTRQRLGL
CHT_GIBZE         DIDLNECHLTKVLADFAGHYMRPDLIRLLVDTRRKELITEAD--PNGSIATYSTRQRLGL
CHT_FUSSL         DIDLNETHLTKVLADFAGHYMRPDLIRLLVDTRRKELITEAD--PVGTIATYTTRHRLGL
CHT_BOTF4         EIDLDQSHLPKALGDFGGHYMRPDLIRLLVDTRRKELITEAD--QDGGIGTYNTQDRVGL
E9EE15_METAQ      DIDLDENLLTKKIADFGGHYMRPDLIRLLVDETPKTNIVDAN--STDPKTFPSTLERLGL
G0RNY5_HYPJQ      DIDLDENLLTKRLADFGGHYMRPDLIRLLVDKTPKTFLVDAD--NVDPKNFPSSLQRLGL
                  :***::  *.* : **.*****.*****:**   *  :        .      :  *:**

CHT_ASPNG         STPLDIANTVD-SEN----------------
CHT_PENRW         SAPLDASATEAQSESV---------------
CHT_EMENI         TKPLEAPKPTDQKE-----------------
M2YNL0_PSEFD      NKPLESLDTEKEDNGVLV-------------
G4NIA2_MAGO7      GKALDDD------VEEDTERTV---------
CHT_MICSH         DRPLEEEDYRQGTDAGETEKASSNGHA----
CHT_ALTBR         NIPLDAQAPKQK-ATAADVPSSSVM------
CHT_PYRTT         DVLLDSDVQKQKKSGASDLGATNALAY----
CHT_NEUCR         NTPLENDKEGKK-------------------
CHT_LEPMC         NLPLDGSKEDEKVPVAL--------------
CHT_GIBBA         DKPLS--KKEGDET------TDVL-------
CHT_GIBZE         DKPLE--KKEGEDT------PDVL-------
CHT_FUSSL         DKPLDGEKKEKEATKGRDSEAEEL-------
CHT_BOTF4         NRPLDAPKVDGPSGVSKQVLLSNAKKAAHKG
E9EE15_METAQ      AKPLPSAEN----------------------
G0RNY5_HYPJQ      DKPLPAPEE----------------------
                     *