CLUSTAL format seed alignment for MF_03226

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G7PYL7_MACFA          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
H9FWZ2_MACMU          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
YJU2_HUMAN            --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
M3WK58_FELCA          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
E2R1C2_CANLF          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
G1Q647_MYOLU          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
Q17QL3_BOVIN          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
W5PKW6_SHEEP          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
F1S7N8_PIG            --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
YJU2_MOUSE            --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
A2VD11_RAT            --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
A0A1D5NVE0_CHICK      --MSERKVLNKYYPPDFDP---AKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
A0A1L8G899_XENLA      --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
A0A1S3MW09_SALSA      --MSERKVLNKYYPPDFDP---AKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
H2MH03_ORYLA          --MSERKVLNKYYPPDFDP---AKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
YJU2_DANRE            --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCKTCGEYI
A7RF79_NEMVE          --MSERKVLNKYYPPDFDP---SKIPKLKLPKD-----RQYVVRLMAPFNMRCTTCGEYI
Q7Q081_ANOGA          --MSERKVLNKYYPPDFDP---SKIPRVKLPKN-----RQYTVRLMAPFNMRCVTCGEYI
W5J0T5_ANODA          --MSERKVLNKYYPPDFDP---SKIPRVKLPKN-----RQYTVRLMAPFNMRCVTCGEYI
B0XG44_CULQU          --MSERKVLNKYYPPDFDP---SKIPRVKLPKN-----RQYTVRLMAPFNMRCVTCGEYI
Q170L2_AEDAE          --MSERKVLNKYYPPDFDP---SKIPRVKLPKN-----RQYTVRLMAPFNMRCVTCGEYI
Q7JVH0_DROME          --MSERKVLNKYYPPDFDP---SKIPRMKLAKN-----RQYTVRLMAPFNMRCKTCGEYI
A0A087ZNQ1_APIME      --MSERKVLNKYYPPDFDP---SKIPRMKLARN-----RQYTVRLMAPFNMRCKTCGEYI
A8XPL2_CAEBR          MTGTERKVFQKYYPPDFDP---SKIPRAKGQRN-----RQFVQRVMTPFNMQCNTCHEYI
Q20124_CAEEL          MTGTERKVFQKYYPPDFDP---SKIPRAKGQKN-----RQFVQRVMTPFNMQCNTCHEYI
G7LCI0_MEDTR          --MGERKVLNKYYPPDFDP---AKLPRVRRPEN-----LQINVRMMLPMSIRCNTCGNYI
I1MJ16_SOYBN          --MGERKVLNKYYPPDFDP---SKLPRARRPKN-----QQIKVRMMLPMSIRCNTCGNYI
Q9SHH1_ARATH          --MGERKVLNKYYPPDFDP---AKLQRLRRPKN-----QQIKVRMMLPMSVRCGTCGNYI
Q0JLM7_ORYSJ          --MGERKVLNKYYPPDFDP---SKIPRRRQPKN-----QQIKVRMMLPMSIRCGTCGTYI
C5XPH3_SORBI          --MGERKVLNKYYPPDFDP---SKIPRRRQPKN-----QQIKVRMMLPMSIQCATCGTYI
YJU2_DICDI            --MGERKVISKYYPPDFDP---SKVAKIKVKRP-----TFTKVTTMLPMSIRCNTCGEYI
Q5KJN1_CRYNJ          --MSERKVLNKYFPPDFDP---SKIKRRKMPKD-----PQQVIRLMAPFSMRCNRCGEYI
A0A0D1DX63_USTMA      --MADRKALNHYYPPDFDP---SKIPRRKAPKD-----AQQTVRLMAPFSMRCNTCGEYI
Q2UAI3_ASPOR          --MSERKVLSKYYPPDFDP---SAITRTKNKQ---TGPKVITVRLMAPFSMKCTQCGEFI
Q5AUM9_EMENI          --MSERKVLTKYYPPDFDP---SAITRTPKHLR-SSGPKVITVRLMAPFSMKCTQCGEYI
Q0CAQ9_ASPTN          --MSERKVLTKYYPPDFDP---SAITRQKKPK--DAAPRLQTVRLMAPYSMKCTHCGEYI
A5AAC5_ASPNC          --MSERKVLTKYYPPDFDP---SAITRTPKHLR-QQGPKVITVRLMAPFSMKCTKCGEFI
C5GID0_AJEDR          --MSERKVLTKYYPPDFDP---SVITRTPKHLR-ATGPKLLTVRLMAPFSLKCTNCGEYI
C0NTC1_AJECG          --MSERKVLTKYYPPDFDP---SVITRTPKHLR-ATGPKLLTVRLMAPFSLKCTNCGEYI
J3K869_COCIM          --MSERKVLTKYYPPDFDP---SAITRTPKHLR-ATGPKLLTVRLMAPFSLKCTNCGEYI
A7E9N8_SCLS1          --MSERKVLTKYYPPDFDP---SKIVRSR-APK-QAGPKVQTVRLMAPFPMKCTACGEYI
G4MZ75_MAGO7          --MSERKVLTKYYPADFDP---SALTRRRRGPK-QEGPKVQTVRLMAPFSMKCTTCGEYI
Q0UBH1_PHANO          --MSERKVLSKYYPPDFDP---SKITRTR-GPK-NAGPKVQTVRLMAPFSMKCTHCGEFI
V5IN45_NEUCR          --MSERKVLTKYYPPDFDP---SLVGRSRQPK--QTGPKVQTVRLMAPFSLRCSTCGEYM
B2B6W9_PODAN          --MSERKVLSKYYPPDFDP---SLVGRTRKPKSAANTPKVQVVRLMAPFSMRCTACGEYM
A0A098DXM6_GIBZE      --MSERKVLQKYYPPDFDP---SALTRRRGNK--DAGPKTQKVRIMAPFSLRCSMCGTFI
YJU2_SCHPO            --MSERKVLNKYIPPDYDP---SIRPPKKKKKFQGPNGGKLTVRLMTPFSMRCHTCGEYI
YJU2_YEAST            --MSERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRCLECNEYI
Q6FTZ8_CANGA          --MSERKAINKYYPPDYDPVEAERIARSMSKKLKNANKSESTIRLMTPFSMRCTKCDEYI
Q75DJ8_ASHGO          --MSERKAINKYYPPDYDPEQAERQVRQLSKKLKTMHRDTVGIRLMTPFSMRCLKCSEYI
Q6BJB5_DEBHA          --MSERKGINKYYPPDWDP--------SKVPKKKKPANQVTKVRLMAPYSMRCTKCNEYI
Q5A7K1_CANAL          --MSERKAINKWYPPDYDP--------SKIPRPKKNANQPIKIRMMAPYSMRCLKCDEYI
Q6CE77_YARLI          --MSDRKGINKYYPPDFDP---SKLERRAKKVSDSKSATMPTVRLMVPFSMRCTACGEYI
                          :** : :: *.*::*                          * *  ::*  *  ::

G7PYL7_MACFA          YKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
H9FWZ2_MACMU          YKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
YJU2_HUMAN            YKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
M3WK58_FELCA          YKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYSMEHGATRNFQA
E2R1C2_CANLF          YKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
G1Q647_MYOLU          YKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
Q17QL3_BOVIN          YKGKKFNARKETVQNESYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
W5PKW6_SHEEP          YKGKKFNARKETVQNESYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
F1S7N8_PIG            YKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
YJU2_MOUSE            YKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
A2VD11_RAT            YKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
A0A1D5NVE0_CHICK      YKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
A0A1L8G899_XENLA      YKGKKFNARKETVQNELYLGLPIFRFYIKCTRCLAEITFKTDPENTDYAMEHGATRNFQA
A0A1S3MW09_SALSA      YKGKKFNARKETVMNELYMGLPIFRFYIKCTRCLAEITFKTDPENTDYAMEHGATRNFQA
H2MH03_ORYLA          YKGKKFNARKETVQNELYMGLPIFRFYIKCTRCLAEITFKTDPENTDYAMEHGATRNFQA
YJU2_DANRE            YKGKKFNARKETVQNELYLGLPIFRFYIKCTRCLAEITFKTDPENTDYAMEHGATRNFQA
A7RF79_NEMVE          YKGKKFNARKETVQGETYLGLYIFRFYIRCPRCISEITFKTDPENTDYVCENGATRNFQA
Q7Q081_ANOGA          YKGKKFNARKEDVENEDYLGIRIYRFYIKCTRCLQEISFKTDPRNTDYEIEAGATRNFMA
W5J0T5_ANODA          YKGKKFNARKEDVENEDYLGIRIYRFYIKCTRCLQEISFKTDPRNTDYEIEAGATRNFMA
B0XG44_CULQU          YKGKKFNARKEDVENEDYLGIRIYRFYIKCTRCLQEISFKTDPRNTDYEIEAGATRNFMA
Q170L2_AEDAE          YKGKKFNARKEDVENEDYLGIRIYRFYIKCTRCLQEISFKTDPRNTDYEIEAGATRNFMA
Q7JVH0_DROME          YKGKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMA
A0A087ZNQ1_APIME      YKGKKFNARKEDVEGDDYLGIRIYRFYIKCTRCLQEISFKTDPKNTDYEIEAGATRNFMA
A8XPL2_CAEBR          YKGKKFNMKRETAEGESYLGLKIFRFYFRCPNCLAEITFKTDLENCDYQNEHGATRLFEA
Q20124_CAEEL          YKGKKFNMKRETAEGETYLGLKLFRFYFRCPNCLAEITFKTDLENCDYQNEHGATRLFEA
G7LCI0_MEDTR          YKGTKFNSRKEDVIGETYLGIQIFRFYFKCTRCSAELTMKTDPQNSDYVVESGATRNFEP
I1MJ16_SOYBN          YKGTKFNSRKEDVIGETYLGIQIFRFYFKCTKCSAEVTMKTDPQNSDYIVESGATRNFEP
Q9SHH1_ARATH          YKGTKFNSRKEDVIGETYLGIQIFRFYFKCTKCSAELTMKTDPQNSDYIVESGASRNYEP
Q0JLM7_ORYSJ          YKGTKFNSRKEDVEGEKYLGIQIFRFYFKCTKCSAEITFKTDPQNSDYTVESGASRNFEP
C5XPH3_SORBI          YKGTKFNSRKEDVIGETYLGIQIFRFYFKCTKCSAEITFKTDPQNSDYTVESGASRNFEP
YJU2_DICDI            GRGTKFNAKKETVQNEDYLGIKIYRFFLRCKKCAAELTIKTDPKNSEYVCESGATRNYEP
Q5KJN1_CRYNJ          YKGKKFNARKETAVGEEYYGIKVFRFYIKCPMCSSEITFKTDPKNADYTCEQGATRNFEN
A0A0D1DX63_USTMA      YKGRKFNARKELVVGEDYYGIKIFRFYIKCTRCSAEITFKTDPKNTDYAAEHGASRNFVP
Q2UAI3_ASPOR          YKGRKFNARKETT-EEKYFSIPIYRFYIRCTRCSGEITFKTDPKNMDYTAEKGAKRNFEP
Q5AUM9_EMENI          YKGRKFNARKETT-EEKYFSIPIYRFYIRCTRCSGEITFLTDPKNMDYRAEKGAKRNFEP
Q0CAQ9_ASPTN          YKGRKFNARKETT-EEKYFSIPIYRFYIRCTRCSGEITFKTDPKNMDYRAEKGAKRNFEP
A5AAC5_ASPNC          YKGRKFNARKETT-SEKYFSIPIYRFYIRCTRCSGEITFLTDPKNMDYRAERGAKRNFEP
C5GID0_AJEDR          YKGRKFNARKETT-EEKYLNIPIYRFYIRCTRCSSEITFKTDPKNMDYTCERGAKRNFEP
C0NTC1_AJECG          YKGRKFNARKETT-EEKYLNIPIYRFYIRCTRCSSEITFKTDPKNMDYTCERGAKRNFEP
J3K869_COCIM          YKGRKFNARKETT-DERYLNIPIYRFYIRCTRCSSEITFKTDPKNMDYTCERGAKRNFEP
A7E9N8_SCLS1          YKGRKFNARKETT-EEKYLAISIYRFYIKCTRCSGEITFKTDPKNMDYQCERGAKRNTEP
G4MZ75_MAGO7          YRGRKFNARKETP-EEKYLGIQIYRFYIKCTRCSGEIRFRTDPANQDYVCETGAHRNTDP
Q0UBH1_PHANO          YKGRKFNARKETT-EEKYYNIAIFRFYIRCTRCSGEITFKTDPKNMDYECERGAKRNFEP
V5IN45_NEUCR          YKGRKFNARKETPVDERYLGIQIYRFYIRCTRCSAEIVFRTDPKNQDYAVEKGAKRNTEP
B2B6W9_PODAN          YRGRKFNARKETRPDEKYLSIQIYRFYIRCTRCSAEIVFKTDPKNQDYTVEQGAKRNTDP
A0A098DXM6_GIBZE      YKGRKFNSTKEIRPEEKYLNVQIIRLIFRCTACPNPIVLKTDPKNNDYAVVSGAVRNNEP
YJU2_SCHPO            YKGKKFNARKEKT-GEKYFSIDILRFYIRCTRCAAEITFITDPKHADYAAESGASRNYEP
YJU2_YEAST            PKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDPGNSDYVMEVGGVRNYVP
Q6FTZ8_CANGA          SKSRKFNGKKKTLDEKYLDSIKIYRFTIRCPQCANPISFRTDPKSADYVMESGGVRNYVK
Q75DJ8_ASHGO          PKFRKFNGKKELLPERYLDTIKIYRLSIRCPRCNSTISFRTDPNRGDYTMEAGGERNYVR
Q6BJB5_DEBHA          SERRKFNAKKEVTNEKYM-SFKIIRFHITCPKCNNNITYKTSPQTAGYVPDTGAVRNYEP
Q5A7K1_CANAL          GARRSFNARKEITNEKYL-NIKIIRFYITCPGCNNTITFKTDPKNAGYTPEEGAVRNYE-
Q6CE77_YARLI          YKSKKFNARKQVTDEVYL-DVKIIRFFIRCPRCSGEIRFKTDPKNSDYQTEYGAVRNYEP
                          .**  ::         . : *: : *  *   :   *.     *    *. *    

G7PYL7_MACFA          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
H9FWZ2_MACMU          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
YJU2_HUMAN            EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
M3WK58_FELCA          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
E2R1C2_CANLF          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
G1Q647_MYOLU          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
Q17QL3_BOVIN          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
W5PKW6_SHEEP          EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
F1S7N8_PIG            EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
YJU2_MOUSE            EKLLEEE--------------EKRVQKEREDEELN-------NPMKVLENRTKDSKLEME
A2VD11_RAT            EKLLEEE--------------EKRMQKEREDEELN-------NPMKVLENRTKDSKLEME
A0A1D5NVE0_CHICK      EKLLEEE--------------EKRMQKEREEEELN-------NPMKVLENRTKDSKLEME
A0A1L8G899_XENLA      EKLIEEE--------------EKRFQKEREEEELN-------NPMKVLENRTKDSKMEME
A0A1S3MW09_SALSA      EKLLEEE--------------EKKITKDREEEELN-------NPMKVLENRTRDSKMEME
H2MH03_ORYLA          EKLIEEE--------------EKRIQQERDDEELN-------NPMKVLENRTKDSKMEME
YJU2_DANRE            EKLIEEE--------------EKKIQQEREDEELN-------NPMKVLENRTRDSKLEME
A7RF79_NEMVE          HRMAEKQ--------------EEKMQQEREEEEAN-------NPMKALENRTKESKQEMD
Q7Q081_ANOGA          LKLAEEQ--------------ARREEEEAREEEAT-------NPMKLLENRTQQSRNEIE
W5J0T5_ANODA          LKLAEEQ--------------ARREEQEVREEEAN-------NPMKLLENRTQQSRNEIE
B0XG44_CULQU          LKLAEEQ--------------ARREEEEAREEEAT-------NPMKLLENRTQQSRNEIE
Q170L2_AEDAE          LKLAEEQ--------------ARREEEEAREEEAT-------NPMKLLENRTQQSRNEIE
Q7JVH0_DROME          LKLAEEQ--------------ARREEQELRDEEAN-------NPMKLLENRTQQSRNEIE
A0A087ZNQ1_APIME      LKLAEEQ--------------AQREEDEEKEEEAT-------NPMKLLEKRTLQSKQELE
A8XPL2_CAEBR          VKLYQDQ--------------QKQAD-EQEAEDAK-------DPMKMLEKRTMQSRQEME
Q20124_CAEEL          VKLYQDQ--------------QKQVD-EQEAEDAK-------DPMKMLEKRTMQSRQEME
G7LCI0_MEDTR          WRAEDEE--------------TDEMKKKREAEEMG-------DAMKSLENRTLDSKREMD
I1MJ16_SOYBN          WRAEDEE--------------ADKTKEKRDAEEMG-------DAMKSLENRTLDSKREMD
Q9SHH1_ARATH          WRAEDEE--------------VDKDKQKRDAEEMG-------DAMKSLENRTLDSKREMD
Q0JLM7_ORYSJ          WREEDEV--------------ADREKRKRDEEEMG-------DAMRALENRAMDSKQDMD
C5XPH3_SORBI          WRDQDEA--------------ADKEKRKRDAEEMG-------DAMKALENRAMDSKQDMD
YJU2_DICDI            WKETDEE--------------KSN-RMTKEQEEEQ-------DAMIALENRTLESKREME
Q5KJN1_CRYNJ          WIENDPTGKAGAMPDAAADDDYDSEGNLREEAQER-------DAMADLERSQEQSKREME
A0A0D1DX63_USTMA      TNQDELADEEKLLTE-------EEKLERKLEKMEG-------DPMKQLEARTIDSRREME
Q2UAI3_ASPOR          WRD--PKNE---TYNETEEQLLDRLEKEENEEHER----AERDKMAELEEKMLDSKREMA
Q5AUM9_EMENI          WRD--SKAD---NHEETEQEVLDRLEREENEEQEQ----LERDKMAELEEKMLDSKREMA
Q0CAQ9_ASPTN          WRN--PEAE---TYNETEQETLDRLEREENEEQER----LERDKMEELEEKMLDSKREMA
A5AAC5_ASPNC          WRDRSKAEE---TAEETEEQVLDRLEREEGENMEQ----EERDKMAELEEKMLDSKREMA
C5GID0_AJEDR          WRE--AKES---EVNETMDETLDRLEREEGDKEER----EERDKMMELEEKMQDSKREMA
C0NTC1_AJECG          WRE--AKEN---EVNETMDETLDRLEREEGEREER----EERDKMMELEEKMQDSKREMA
J3K869_COCIM          WRD--AAAS---QVNETEEETLDRLEREENEAEER----AQRDKMMELEEKMLDSKREMA
A7E9N8_SCLS1          WRVNGG------GLQESDEERLDRLEREE----------QERDAMQELEDKTAEAKTEMA
G4MZ75_MAGO7          WKRGAGDAV---APEETDEERLDRLEHEE----------EERNAMVELEAKTVDAKREMA
Q0UBH1_PHANO          WREAKL-------AEETEEERLDRLEKEE----------AERDAMKELETKVLDAKTEMA
V5IN45_NEUCR          WRRGLEGE-----LEETDEQRLDRIEREMADENGEIAQAEERNAMAELEQKTADAKREMA
B2B6W9_PODAN          WKRGLDDGDNGDGEDETDEQRLDRLEREMAEAAGE----EEKNAMAELEQKTEDAKREMA
A0A098DXM6_GIBZE      WRNREAEN-------EDDEQRLNRLEREEAEAAGE----EEKNAMEELEAKNMDAQREMA
YJU2_SCHPO            WHE----------------KRLQEYEENELAERND---IPEEDEMEKLEQKTLDTKRQMQ
YJU2_YEAST            QKPNDDLN--AKTAVESIDETLQRLVREKEMEQ---------NEKMGIKEQADDK-----
Q6FTZ8_CANGA          RQEEE-----KKAQDETLEETLKRLAKEKEEEEEL------KQNKGKSEDKSKDK-----
Q75DJ8_ASHGO          DDARSP----HIKPDETTDETLQRLLREEAEAA------------RPADSAGEDR-----
Q6BJB5_DEBHA          ESNTNV----NKTKVETEEEILERLEKEEKENKSF------QLLKEKRKKNPFWQQNESL
Q5A7K1_CANAL          ----------KAKPTETEDDILARLQKEEEEDQKY------HLLQAKRKKNPFWNEQTSG
Q6CE77_YARLI          WRD-------EKKVEETLDERLDRLEKEEKELEEL------KKQGKAMPDPSKLGTAVST
                                                                                  

G7PYL7_MACFA          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRR----QEQEE--DEQETAAL-----
H9FWZ2_MACMU          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRR----QEQEE--DEQETAAL-----
YJU2_HUMAN            VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRR----QQQEE--DEQETAAL-----
M3WK58_FELCA          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERQK----REREE--DERETAAL-----
E2R1C2_CANLF          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERQK----QEQEE--DERETAAL-----
G1Q647_MYOLU          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERLK----QEQEE--DERETAAL-----
Q17QL3_BOVIN          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERQR----QEQEE--DERETAAL-----
W5PKW6_SHEEP          VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERQR----QEQEE--DERETAAL-----
F1S7N8_PIG            VLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERQK----REQEE--DERETAAL-----
YJU2_MOUSE            VLENLQELKDLNQRQAHVDFEAMLRQHRMSQEQWQQ----QQEEE--DERETAAL-----
A2VD11_RAT            VLENLQELKDLNQRQAHVDFEAMLLQHRLSQEQWQQ----QQEEE--DERETVAL-----
A0A1D5NVE0_CHICK      VLENLQELKELNQRQANVDFEAMLQQYKEYEEERKR----REQEE--DEQEMKAM-----
A0A1L8G899_XENLA      VLENLQELKELNQRQANVDFEGMLEVYKATEEEIRR----RQEEE--DEQELRSM-----
A0A1S3MW09_SALSA      VLENLQELKELNQRQASVDFEGMLGTYKELEQREKE----REKED--DERETQEM-----
H2MH03_ORYLA          VMENLQELKDLNQRQAQVDFEGMIDKYREIEKREKE----RQKEE--DERETKEM-----
YJU2_DANRE            VLENLQELKELNQRQAQVDFEGMLGQYKELEQRQKQ----REQEE--DEQETKEM-----
A7RF79_NEMVE          ILEKLEELKDLNTRHANVDYASMLETYAQEEEKRKQ----REQQE--DDDLVKSV-----
Q7Q081_ANOGA          LLESLEELRDLNRRQQDIDYDSMLQQFDRSESIRER----EERLERQDEEYIKSIKFQNK
W5J0T5_ANODA          LLESLEELKDLNRRQQDIDYDSMLQQYDPTESIRER----EERMEKQDEEFIKSIKFQNK
B0XG44_CULQU          LLESLEELRDLNRRQQDVDYDTMLQQYDPSESIRER----EERLERQDEEYIKTIKFQSR
Q170L2_AEDAE          LLESLEELRDLNRRQQDVDYDRMLQQYDPTESIRER----EERLERLDEEYIKTIKFRSQ
Q7JVH0_DROME          TIESLEELRDLNRRQQTVDYNTLLQQYNTVETERER----QEREEREDEDFIKSVNFKNK
A0A087ZNQ1_APIME      LLESLEELKDLNRRQQTIDYDQMLEQFDTETAKQRT----EKEQEEYDEECVKAI-----
A8XPL2_CAEBR          EMGNLEDLQESSRTKECVDTIGFLSSTDPHLAQAQR----IKMMEDEDDRMARELM----
Q20124_CAEEL          EMGNLEDLQESSRTKECIDTIGFLSSTDPHIAQAQR----IKMMEDEDDRMARELM----
G7LCI0_MEDTR          ILAALDEMKSMKSRHATVSVAEMLVALQRTAADKEK----RIEEE--DEALIKSIFS---
I1MJ16_SOYBN          ILAALDEMKSMKSRHATVTVDEMLEALQRTAADKEK----RLEQE--DEALIKSVVF---
Q9SHH1_ARATH          IIAALDEMKSMKSRHATVSVDAMLEALQRTGAEKVK----RIEEE--DEAVIKSIFG---
Q0JLM7_ORYSJ          ILAALEEMRSMKSRHAGVTVDQMLEILKRSAHDKEEKTVAELDEE--DEKLIKSITF---
C5XPH3_SORBI          ILAALEEMRSMKSRHAGVSVDQMLEILKRSAHGKEEKAIAELDEE--DEELIKSITF---
YJU2_DICDI            MLDALEEIKSLNSRNSEIDTEQLLEYNLQKQELEEK----LQDEE--DDLLVKSIFN---
Q5KJN1_CRYNJ          MMDELADLRQRNARVELNKTDQDPESLL----AALHAEKISAEEE--ARQKAEQE-----
A0A0D1DX63_USTMA      ILDALQDIRTRNARLERVDTDAVLAKLHDRPQPAFDAHTANSNRE--DQQAKAEQ-----
Q2UAI3_ASPOR          IADALDEIRTRNARIERNEAL-GDETALAHVREEVDEDKLKAE-----------------
Q5AUM9_EMENI          IADALDEIRTRNARIERSEAL-GDEAALAHVQEQVDEAALKAQ-----------------
Q0CAQ9_ASPTN          IADALDEIRTRNARIERNEAR-GDEAALAVVRDQVDEARLQQE-----------------
A5AAC5_ASPNC          IADALDEIRTRNARIERGGA--GGEVALGAVREEKDEEAERVE-----------------
C5GID0_AJEDR          VADALDEIRTRNARIERGERGAGEEAALLKAQREADEEKLRAE-----------------
C0NTC1_AJECG          VADALDEIRTRNARIERGEREAGEEAVLLKAQREAEEAKLRAE-----------------
J3K869_COCIM          VADALDEIRTRNARIERGER-GGEEAALLRARREAEDAQAKAD-----------------
A7E9N8_SCLS1          VADALDEIRTRNARNERVGK---DGTEVTVTRENVDLERERQE-----------------
G4MZ75_MAGO7          VADALDEIRTRNARIARADR---DGIEVVVAQA-VDEEREKQE-----------------
Q0UBH1_PHANO          IADALDEIRSRNARLEKADR---DGVEAKIEPDPADDRRKRQE-----------------
V5IN45_NEUCR          VADALDEIRSRNARLERAQREGGVDIESVLGGRGLSEEEERRRRE---------------
B2B6W9_PODAN          VADALDEIRSRNARLEKAKSEG-VDLLEGLVSKETEEEKERRR-Q---------------
A0A098DXM6_GIBZE      AADALDEIRHRNARINRSEKEG-VDFADTIVR---TEDEEREK-Q---------------
YJU2_SCHPO            ISDALDELREKSARRSRVNIDDAIALLKEDAYGSIEEEESKKRKF---------------
YJU2_YEAST            -------MDLLEKRLAKIQQEQEDDEELENLRKKNLEMSQRAEMIN--------------
Q6FTZ8_CANGA          -------MALLEEKLAKLQQQQKDVKDLEQMIQNNKAKYETSNMLG--------------
Q75DJ8_ASHGO          -------MQELEKRLARLQQEQHDAEEIDRLHRESLERGRRAASLAA-------------
Q6BJB5_DEBHA          KDQKGDLMENLEKRLQDQQRQQEMTEHLEYLQAKSSSLQAKGGRDRALN-----------
Q5A7K1_CANAL          -------MENLEQRLKEQHHHQKLDQQLEAIQARAVNKDL--------------------
Q6CE77_YARLI          D---GDVMAEIEARQKANIDEQEGIERLEELKERTARLNKIGRDVDV-------------
                             :   .                                                

G7PYL7_MACFA          ------------LEEARKRRLLE-DSDSEDEA---------APTPLQPALR-----PNPT
H9FWZ2_MACMU          ------------LEEARKRRLLE-DSDSEDEA---------APAPLQPALR-----PNPT
YJU2_HUMAN            ------------LEEARKRRLLE-DSDSEDEA---------APSPLQPALR-----PNPT
M3WK58_FELCA          ------------VEEARKRRLLE-DSDSEEDA---------AAPAPPRLAP----RPNPT
E2R1C2_CANLF          ------------VEEARKRRLLE-DSDSEEDA---------PASAPPRLAL----RPKPT
G1Q647_MYOLU          ------------VEEARKRRLLE-DSDSEEDA---------APAPPQPAVLPNP-SPNPT
Q17QL3_BOVIN          ------------VEESRKRRLLE-DSDSEEDT---------SPTQPQPALR-----PNPT
W5PKW6_SHEEP          ------------VEESRKRRLLE-DSDSEEDT---------TPTQPQPALR-----PNPT
F1S7N8_PIG            ------------VEESRKRRLLE-DSDSEEDA---------APTQPWPALP-----PNPT
YJU2_MOUSE            ------------LEEARHRRLLE-DSESEDEA---------PPSRPRAAAR-----PNPT
A2VD11_RAT            ------------LEEARYRRLLD-DSDSEDEA---------PPSQPQAAAR-----PNPT
A0A1D5NVE0_CHICK      ------------LEQAQNRRLLP-DSDSDEEP---------SKPRSEPAVK-----ARPT
A0A1L8G899_XENLA      ------------MEAANRKRLLE-DSDSDEEG---------SQVKPKHTQK-----TKAT
A0A1S3MW09_SALSA      ------------LERALVKRLRDSDSDSDQESE--------SSSRPKKPST-----DRPT
H2MH03_ORYLA          ------------LERALVKRLRDSDSDSEKEEE--------SRSRLKKSSS-----DKPT
YJU2_DANRE            ------------LERALVKRLRDSDSE-EEAEN--------AKERSKKHIA-----DKPT
A7RF79_NEMVE          ------------FGGNKIQRRLS-DSDSDDENN--------SNDSANMSSSALTGRKRAT
Q7Q081_ANOGA          ----------PTVKRVASEIIVEEVKEEKQDE-------ATTATTSEGSRPSSTSTATSA
W5J0T5_ANODA          ----------PGVKRIATEIIVEDVKEEEPDDQPTASSNASRANASTSSAPSVSSASAAT
B0XG44_CULQU          STTATGGGSGVGLKRVATEEIIEEIKQEEEPS-----SSSMTGDGRPAGALGGNASTAAA
Q170L2_AEDAE          TSSACAG-SSTGLKRVAAEEIIEEIKQEQPDQ--------GPTDDNDTTITIGESTASSM
Q7JVH0_DROME          P---------EGSSRVVAEEIIEEIKDEPLDT-----------PSAPPPAKQAKPSTISL
A0A087ZNQ1_APIME      ----------FGKKIVVEEEIVELDENETNEPPKKIMKKNKNKNENNISTIEQEKTKENQ
A8XPL2_CAEBR          ----------GITSDGRIERRIKDYDDDEDDD---------KDEEKDVPGPS----TWAA
Q20124_CAEEL          ----------GITSEGRIERRIKDDEDNSDGA---------DEDDKDIPGPSASVVPSTS
G7LCI0_MEDTR          -----------NKSEVPISRIRDEDIEDE-----------EELFQFSNGHGE---TSNDN
I1MJ16_SOYBN          -----------HNSDGFVRRIRDEDIETE-----------EQLDQFSNGHGE---TSSSN
Q9SHH1_ARATH          -----------KQKE-VIRRIADEEIDDDYDD--------DDIDDYPSLQKEKKGSSSDL
Q0JLM7_ORYSJ          -----------RNSQDYVKRIEDDDDD-------------DED---LVIPGQ-----SSS
C5XPH3_SORBI          -----------RNSGFYVKRIEDDDDD-------------DDDDDDDLVPGQ-----SSR
YJU2_DICDI            -----------NKNKLELNQINDNNSIN------------NNIDSNKIKRIE-----NDD
Q5KJN1_CRYNJ          ------------EDDALVRQYFA----------------------------------KVA
A0A0D1DX63_USTMA      ------------EDEALVQKYFG----------------------------------KAL
Q2UAI3_ASPOR          ------------------------------------------------------------
Q5AUM9_EMENI          ------------------------------------------------------------
Q0CAQ9_ASPTN          ------------------------------------------------------------
A5AAC5_ASPNC          ------------------------------------------------------------
C5GID0_AJEDR          ------------------------------------------------------------
C0NTC1_AJECG          ------------------------------------------------------------
J3K869_COCIM          ------------------------------------------------------------
A7E9N8_SCLS1          ------------------------------------------------------------
G4MZ75_MAGO7          ------------------------------------------------------------
Q0UBH1_PHANO          ------------------------------------------------------------
V5IN45_NEUCR          ------------------------------------------------------------
B2B6W9_PODAN          ------------------------------------------------------------
A0A098DXM6_GIBZE      ------------------------------------------------------------
YJU2_SCHPO            ------------------------------------------------------------
YJU2_YEAST            ------------------------------------------------------------
Q6FTZ8_CANGA          ------------------------------------------------------------
Q75DJ8_ASHGO          ------------------------------------------------------------
Q6BJB5_DEBHA          ------------------------------------------------------------
Q5A7K1_CANAL          ------------------------------------------------------------
Q6CE77_YARLI          ------------------------------------------------------------
                                                                                  

G7PYL7_MACFA          AILDEAPK-----------PKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADLDCGNG--
H9FWZ2_MACMU          AILDEAPK-----------PKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADLDCGNG--
YJU2_HUMAN            AILDEAPK-----------PKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADPDCSNG--
M3WK58_FELCA          AILEEAPK-----------AKRKAESWERSVGTLGNRPPLSGLVVVKKTDPGRSTRQG--
E2R1C2_CANLF          AILDEAPK-----------AKKKAESWERSVGTLGSRPQLSGLVVVKKADLGRSTQQG--
G1Q647_MYOLU          AILDEGPK-----------AKRKMESWERSVGTLGSKPQLSGLVVVKKTGLDRSTPQG--
Q17QL3_BOVIN          AILDETPK-----------AKRKAESWERSVGTLGSRPQLSGLVV-KKTGLDTSIRRG--
W5PKW6_SHEEP          AILDETPK-----------AKRKAESWERSVG-LGARPQLSGLVV-KKTGLDSIISRR--
F1S7N8_PIG            AILDEAPK-----------AKRKVESWERSVGTLGSRPQLSRLVVVKKTDLDRSIQRG--
YJU2_MOUSE            AILNEVPQ-----------TKRKAEA-------LCSKAQLAGLVVPKKVKTEANGASE--
A2VD11_RAT            AILDEVPK-----------TKRKAEG-------LCRKAQLAGLVIPKKAKTEANRVSE--
A0A1D5NVE0_CHICK      DILQEDPQPQS--------KKLKTESWERSVGKWNSKSQLAALVTARK------------
A0A1L8G899_XENLA      DILVKNDNFQN--------KKQRGEELESSSVKVNSRQLLSGLVVRKKEVAQQDQAKQHN
A0A1S3MW09_SALSA      DILTTDRLADTQGLSVRGVKKAKVESWERSVGGLGGGGALGTLVVRKKPATSVPIPDT--
H2MH03_ORYLA          DILTSDKQPETEGSSASGVKKVKVESWEMSVGTLGGKGSLSSLVVRKKPADSIKKAAT--
YJU2_DANRE            DILTTDTSTSSQGLSSAVAKK---QSWDRSVGGLSVKGALGSLVVRKKPADSASKPSH--
A7RF79_NEMVE          DILTEGEKEAMS---SEPITKKAKPVWEQSVGNLSNKTSLASLVKVKKASSTPLAKSTAS
Q7Q081_ANOGA          AASTSGPPSFAT-------SKARKLDN---FSIGVKKTTLSNLVVKRK------------
W5J0T5_ANODA          ATLTSSAPSFAT-------SKARKLDS---FSIGVKKSSLSNLIVKKKP-----------
B0XG44_CULQU          AAAPPSTNFAVP-------NKVKKLDSA--FSIGVRKSSLSNLVVKKKP-----------
Q170L2_AEDAE          ATAVSSVPAIGG-------GKMKKLDTTNSYSIGVRKSSLSNLVVKKKQPTTTMTTPAVS
Q7JVH0_DROME          SATSSSKASAAQ-------SMVKRKTPL--------------VLVKPKA-----------
A0A087ZNQ1_APIME      RIKPSEASLWSE-------SISSSSNRKNLLGIVKRKTTTNLVKVNMNS-----------
A8XPL2_CAEBR          SMLKPAIP------------ALGMEEATNSRKRFDQKDRFAGIKLIKKVKPTE-------
Q20124_CAEEL          SMLKPAIP------------KLGMDDSGNSRKRNEQRDRFAGIKLIKKAKPSE-------
G7LCI0_MEDTR          PKRQKISED----------LPRKATDTLTKASLDDSDKQEKLTAGRR------KSNPL--
I1MJ16_SOYBN          TKRQKISED----------CPSKPTDTLTKASLDDSGKQENSRSGG-------KLNSL--
Q9SHH1_ARATH          SKKRKATEV----------SPSNPTDILTSSSAENP-KEPKKQAISK------QPFKS--
Q0JLM7_ORYSJ          TSKMNGSSQ----------SVSNATDVLTKTSGSDNANKEGNKIWPSKMPKFIVKPKS--
C5XPH3_SORBI          TIKTNGSSE----------PVTKPTDVLSKTNGSEGANKEGSKSW---MPKFIVKPKS--
YJU2_DICDI            DDGDKFNSL----------FSNNNKNNKNIINNNNNNNNNINTTSIS------NTIET--
Q5KJN1_CRYNJ          GPAGSGAQK----------SEKTKTPDGEAEGSEEENTALPQLTIKRRPVPGTEKAGE--
A0A0D1DX63_USTMA      D---GGRAI----------AVKRKLDDQDAQAEPDIATLLAMKAA---------------
Q2UAI3_ASPOR          ---------------------REIEEAARRAFTTETGEKVKRLVEEDFS-----------
Q5AUM9_EMENI          ---------------------REDEEAARKAFMTTTGEKVKRLVEDEST-----------
Q0CAQ9_ASPTN          ---------------------KEDEEAARRAFMTESGERVKRLVVEEGS-----------
A5AAC5_ASPNC          ---------------------REIEEVARRAFRTEEGEKVRRLVEDDES-----------
C5GID0_AJEDR          ---------------------REDEEAARRAFMTDGGERVKRLVEDEAS-----------
C0NTC1_AJECG          ---------------------REDEEAARRAFMTDGGERVKRLVDDEAD-----------
J3K869_COCIM          ---------------------AEDAEIARRVFMTKDGERVKRLVEE--------------
A7E9N8_SCLS1          ---------------------REDEEAARRAFL--RRQEAMEEIIEDDT-----------
G4MZ75_MAGO7          ---------------------REDEEAARRAFAFARSQAALEEEIMDED-----------
Q0UBH1_PHANO          ---------------------EEDAEAARQAFANRTMPDLGEEVIEEDM-----------
V5IN45_NEUCR          --------------------EEEDAEAARKAFEFARLQQKLEETPAEEEVLGLPSIPGAA
B2B6W9_PODAN          --------------------EEEDAEAARRAFQFARRQEMLEEIVEEPE-----------
A0A098DXM6_GIBZE      --------------------EKEDEEAAKKAFAAARARMEMEVIVEDDT-----------
YJU2_SCHPO            --------------------EEEEIDREAKSLFSSQDGEIIRRLNAETT-----------
YJU2_YEAST            ---------------------RSKHAQQEKAVTTDDLDNLVDQVFDNHRQRTNKPGNNN-
Q6FTZ8_CANGA          ---------------------KISKPKNNAKLEQQNLDAIAESAFAKFRSHNSISTND--
Q75DJ8_ASHGO          ---------------------SIADRRTRAEADAARAEEAFRAAPAHVRPTTAPDPTPA-
Q6BJB5_DEBHA          -----------------EAKDKLGEEIESMKSLREDLASKEDEELTKDKFKKFRSNDSI-
Q5A7K1_CANAL          ------------------------------------LESKARENLQQ-------------
Q6CE77_YARLI          --------------------------LEELRKRDDKESGVSEQDLRDDEMAKEVFRNAQ-
                                                                                  

G7PYL7_MACFA          ---------------QPQAAPA----PGAPQSRK-------------------EADPAPP
H9FWZ2_MACMU          ---------------QPQAAPA----PGAPQSRK-------------------EADPAPP
YJU2_HUMAN            ---------------QPQAAPT----PGAPQNRK-------------------EANPTPL
M3WK58_FELCA          ---------------QASPTP------GPRKSGK-------------------AADPAPW
E2R1C2_CANLF          ---------------QVSPTPQ-----GPARSGK-------------------AADSAAW
G1Q647_MYOLU          ---------------QPAPTL------GTMKNGK-------------------AADPAPR
Q17QL3_BOVIN          ---------------RAPPLP------GVMKNGQ-------------------VAGPAPQ
W5PKW6_SHEEP          ---------------RAPPLPALASPPGAMKNGQ-------------------AAGPAPQ
F1S7N8_PIG            ---------------LAPPSA--------VMNGK-------------------TAEPSPQ
YJU2_MOUSE            ---------------QVGVPTAA----GAPKSRK-------------------ADNPTPQ
A2VD11_RAT            ---------------QVRVPTT-----GAPESRK-------------------VANPAPQ
A0A1D5NVE0_CHICK      ---------------QKLSATQVNGAEKCGTATG-------------------TGSLPST
A0A1L8G899_XENLA      TKMDREKIAPKVTEMQNESALQSTGAVAESHSSN-------------------VNSSLPG
A0A1S3MW09_SALSA      ---------------TVTPAGSNTQTVSKAAAI--------VPT--------EATKPITA
H2MH03_ORYLA          ---------------DEANAAPTSHTDSKTNV---------------------------T
YJU2_DANRE            ---------------AAPPPAAAAAGTQTGAVKPESSITSSSAS--------SNIQPVSC
A7RF79_NEMVE          AFNPSEG-ENKNTSQLVKPVKPVEQSNSTQQSNR------------------TQQSNSGQ
Q7Q081_ANOGA          ---------EMPPPKAPPPVASVTGQGTSATQPT-------------------APEPKEC
W5J0T5_ANODA          --VTVDAGKEMPPPKAPPPVPAADKPVEVEDKPT-------------------AAKPVTT
B0XG44_CULQU          --VAATVEGEKPKEILPKPVPAAAVVVTESATSR-------------------ATDS-TA
Q170L2_AEDAE          VASTGGGEPSKTEPVSAKTTTATTTMTVASSSSS-------------------STVNVAS
Q7JVH0_DROME          ------------TAVAKPTVATGTTQVESKPAAT-------------------TPSVVSA
A0A087ZNQ1_APIME      -------SVTNTDKKEIQTVTSKETGISIEEHKT-------------------SENTHNS
A8XPL2_CAEBR          ---------------PTTSSATTSSAPTTSTTPS-------------------ASKPSTS
Q20124_CAEEL          ---------------PSTSS-------TASSTSS-------------------APPPLPS
G7LCI0_MEDTR          -----------VTIAVIKK-PGISNVRSAEEDKQ-------------------KKKEEDN
I1MJ16_SOYBN          -----------VRISVIKK-PVTSDVKSPAEPEQ-------------------KKQEKDN
Q9SHH1_ARATH          -----------VHIKVIKKQPQPTSSSTPAPAKP-------------------EEKKSDG
Q0JLM7_ORYSJ          -----------TPTDPIKKQKTETTAGPDTGKAP-------------------VAEENSE
C5XPH3_SORBI          -----------ASADPHKKQKIESMAVQDNGKGL-------------------DDEQKGE
YJU2_DICDI            -----------TPTTNQKTSILGNKVKVVINKQE-------------------EPIPKNN
Q5KJN1_CRYNJ          ---------------PSVQNLLAAKGKVLETAGP-------------------NGVGAPP
A0A0D1DX63_USTMA      ----------------------ATKTSCSALTAS-------------------TSVPAPP
Q2UAI3_ASPOR          ----------------NGATPD----PKPSD-----------------------APPSFA
Q5AUM9_EMENI          ----------------PEQATI----SAP--------------------------PPSFT
Q0CAQ9_ASPTN          ----------------PNGSATPESKTESPA-----------------------PPPSFA
A5AAC5_ASPNC          ----------------PDNGVGGSGAGEMPP-----------------------PPPSFA
C5GID0_AJEDR          ----------------SSGGATPAVEKSDMP-----------------------PPPSFA
C0NTC1_AJECG          ----------------SSNGRTLANEKSDMP-----------------------PP-SFT
J3K869_COCIM          ----------------SDTGDSPVPNSAEMP-----------------------PP-SFA
A7E9N8_SCLS1          ----------------DDAGAGPA-------------------------------PKITK
G4MZ75_MAGO7          ----------------DDSAVGGAAAGTNGPAASSTAGPSAAAAATSVGDSEMKPPAAMK
Q0UBH1_PHANO          ----------------MDAPIEAPVATAFTKKPKEKKDFSAALG--------IKKKAAAP
V5IN45_NEUCR          ANGEGSSGSSPSAGIGPSSASSTAATATAATASNPASAATTDM-----------PPPSFK
B2B6W9_PODAN          GEEKGVDGSNGGPSLSLSEGVKPATTAAATAAATTAGTDTTDM-----------PPPSFK
A0A098DXM6_GIBZE      ----------------PVELAEPEPIAPA-------------------------PAPSFK
YJU2_SCHPO            ---------------VEKELPKPIDLVSE--------------------------KLATS
YJU2_YEAST            -------------DEKRTPLFNPTSTKGKIQKKS--------------------------
Q6FTZ8_CANGA          -------------DKSETTAVQNTDTFSQLQSRSNLPELKNTSMEAK-----QKPTKIKL
Q75DJ8_ASHGO          -------------APAPARKPAGKNPLGVVVRNKK-----------------------KQ
Q6BJB5_DEBHA          -------------DSNSSNKPVAIEDPSSLKRSYENALQDNQTNSTT-----KKQSKTIV
Q5A7K1_CANAL          -----------------STKPVAKRKLV--------------------------IPTTIK
Q6CE77_YARLI          -------------GEKIKRVEVAKVDASVKKVSKP-----------------------VV
                                                                                  

G7PYL7_MACFA          TPGASS----------LSQLGAYLDSDDSNGSN-----------------
H9FWZ2_MACMU          TPGASS----------LSQLGAYLDSDDSNGSN-----------------
YJU2_HUMAN            TPGASS----------LSQLGAYLDSDDSNGSN-----------------
M3WK58_FELCA          TPGTSS----------LSQLGAYSDSEDSSGSS-----------------
E2R1C2_CANLF          TPGASS----------LSQLGAYSDSEDSSGSN-----------------
G1Q647_MYOLU          TPGTSS----------LSQLGAYSDSEDSSSSS-----------------
Q17QL3_BOVIN          MPGTSS----------LSQLGVYSDSEDSSGSN-----------------
W5PKW6_SHEEP          MPSTSS----------LSQLGVYSDSEDSSGSN-----------------
F1S7N8_PIG            APGPSS----------LSQLGVYSDSEDSSGSN-----------------
YJU2_MOUSE            TPGTSS----------LSQLGAYGDSEDSDS-------------------
A2VD11_RAT            TPGASS----------LSQLGAYGDSEDSDS-------------------
A0A1D5NVE0_CHICK      VSTTSS----------LSLLGAYTDSESD---------------------
A0A1L8G899_XENLA      SSGVSS----------LMQLGAYSDSEESN--------------------
A0A1S3MW09_SALSA      QNGSSS----------LSLLGAYSDSDDSNNSE-----------------
H2MH03_ORYLA          QNGSSS----------LSLLGAYSGSDSSDGE------------------
YJU2_DANRE            QNGSS-----------LGLLGAYSDSDDSSSD------------------
A7RF79_NEMVE          TLGANS----------LGMLGDYGSSEESD--------------------
Q7Q081_ANOGA          QTAAT---GSSG-IGSLGLLGAYSDSDEGSDEN-----------------
W5J0T5_ANODA          PAVAG---GGGGGIGSLGLLGAYSDSRMKTKFKPASLLLCWPGC------
B0XG44_CULQU          PAVVT---PVSG----LGLLGAYSDSDNSSGEGDE---------------
Q170L2_AEDAE          AAVATTVNSAGSAVSGLGLLGAYSDSDNSSDGNE----------------
Q7JVH0_DROME          PAETKATNQPAAAPAGLSLLAAYSDSSEDSN-------------------
A0A087ZNQ1_APIME      TNNSN---------NGLSLLGTYSGSSDNDSN------------------
A8XPL2_CAEBR          QPAPSG----------LSLLAGYGSDSDSE--------------------
Q20124_CAEEL          SAASSG----------LSLLADYGSGSDSD--------------------
G7LCI0_MEDTR          KTNTTW--------GTTISVSKLWK-------------------------
I1MJ16_SOYBN          ETNTAS--------GLLSLCQNYGSDDED---------------------
Q9SHH1_ARATH          AANTS----------LASLFQNYGSDEDED--------------------
Q0JLM7_ORYSJ          -PAQNN--------VLQSLCQNYDSDESE---------------------
C5XPH3_SORBI          SAKQTN--------VLQSLCQNYDSDDSE---------------------
YJU2_DICDI            NNSEPN--------SFSSFMSAYSDDEED---------------------
Q5KJN1_CRYNJ          QVKRKR----------EGMQKLLGIKKKAKA-------------------
A0A0D1DX63_USTMA      VKKKK------------NAPNAFGLVRKKK--------------------
Q2UAI3_ASPOR          RVKKAK----------KPLPNSLGIKKKAKPSLV----------------
Q5AUM9_EMENI          RVKKAK----------KPLANTLGIKKKPKPSLV----------------
Q0CAQ9_ASPTN          RVKKAK----------KPPVNSLGIKKKVKPSLV----------------
A5AAC5_ASPNC          RVKKAK----------KPAVNSLGIKKKAKPSLV----------------
C5GID0_AJEDR          RVRKPK----------KPFNAGLGIKK--KPPLV----------------
C0NTC1_AJECG          RVRKQK----------KPFNAGLGIKK--KAPLV----------------
J3K869_COCIM          RVKKPK----------KPFSAGLGIKK--KTSLV----------------
A7E9N8_SCLS1          EEALAM----------PPP----SFKRVMIPE------------------
G4MZ75_MAGO7          STSTDM----------PPPPVPTSFKRQVKKKTDRAALLGIKKKT-----
Q0UBH1_PHANO          AVAPVM----------KTPAAPSKLSTMLVAGYDSDDD------------
V5IN45_NEUCR          RQVKKK----------KDHSALLGIKKKQPLV------------------
B2B6W9_PODAN          RVVKRK----------KDHAALLGIKKKKVA-------------------
A0A098DXM6_GIBZE      KVIKKK----------KDHSAALGLKRKA---------------------
YJU2_SCHPO            NIPNFQ----------PPKYAKRKMEKKKVLV------------------
YJU2_YEAST            SVRTNP----------LGIVIKRGKSLK----------------------
Q6FTZ8_CANGA          KVKRNT----------LGIVKRQRK-------------------------
Q75DJ8_ASHGO          RARLAA----------QHRVPTDSAPADPSA-------------------
Q6BJB5_DEBHA          LKKKQP----------LTNPKSDVPSMESRSNNIESLSGALGDYSSSDEE
Q5A7K1_CANAL          LPKKPR----------LARPN---PETQNRST------------------
Q6CE77_YARLI          KMKKRM----------KGIVRK----------------------------