CLUSTAL format seed alignment for MF_04015

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRM2_HHV11       --------------------------------------------MAGREGRTRQRTLRDT
TRM2_HHV2H       --------------------------------------------MAGRAGRTRPRTLRDA
TRM2_PSHV1       --------------------------------------------MASLIGAGTAARLDRV
TRM2_EHV1B       MYGRSNAPGCQPPVRAHPPSSPMTSRLQLAAMEQNASDAALSGMQQARSRQASPKRLRDL
TRM2_GAHVM       ------------------------------------------MAGENTSRRTGSARLDEV
TRM2_VZVD        --------------MYESENASEHHPELEDVFSENTGDSNPSMGSSDSTRSISGMRARDL
TRM2_EHV2        ------------------------------------------------MTSFHTRRVEDR
TRM2_HHV8P       -----------------------------------------------------MEYASDQ
TRM2_ALHV1       ---------------------------------------------------MDLSNLLDF
TRM2_HCMVM       --------------------MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDED
TRM2_HCMVA       --------------------MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDED
TRM2_HHV6U       -----------------------------MMDS--------------SPEKTNLELLYER
TRM2_HHV6Z       -----------------------------MMDS--------------SPEKTNLELLYEQ
G3CKQ2_EBVG      ------------------------------------------MTHLGGKVRSSGFLIPGS
                                                                             

TRM2_HHV11       IPDC-------ALRSQTLESLDARYVSRDGAHDAAVWFEDMTPAELEVVFPTTDAKLNYL
TRM2_HHV2H       IPDC-------ALRSQTLESLDARYVSRDGAGDAAVWFEDMTPAELEVIFPTTDAKLNYL
TRM2_PSHV1       IPEQ-------ELAERPLSELFRDYVESAPERRYEVWFFNVTPPEMELALPTTDAKLNYL
TRM2_EHV1B       IPSS-------DVESMSLNALDDAY----GHHDFSVWFEDLMPPEMELLMPTTDAKLNYL
TRM2_GAHVM       IPEF-------ELVSTDVKILAEKYLQ--DERIYRIWFEYLIPDEIDLIFPTTDGKLNYL
TRM2_VZVD        ITDT-------DVNLLNIDALESKYFPADSTFTLSVWFENLIPPEIEAILPTTDAQLNYI
TRM2_EHV2        D--------------------------------SLIDFQSMLPPDIKIIAPTTYTRLNLL
TRM2_HHV8P       ----------------------------------------LLPRDMQILFPTIYCRLNAI
TRM2_ALHV1       --------------------------------------PSILPEDIQVIAPTSYAKLSLL
TRM2_HCMVM       AEPAAGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFV
TRM2_HCMVA       AEPAAGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFV
TRM2_HHV6U       V----------------CEQGRE----------FEVVFYPMLPRLYEMMLPSLEARLNFL
TRM2_HHV6Z       V----------------CEQGRE----------FEVVFYPMLPRLYEMMLPSLEARLNFL
G3CKQ2_EBVG      APVSGTP-------PQGQGGLASSRVYEDSGGSFLSFSPMIHPNLAPIIAPSAYARLNLL
                                                         : *       *:   :*. :

TRM2_HHV11       SRTQRLASLLTYAGPIKAPDDAAAPQTPDTA---CVHGELLAAKRERFAAVINRFLDLHQ
TRM2_HHV2H       SRTQRLASLLTYAGPIKAPDGPAAPHTQDTA---CVHGELLARKRERFAAVINRFLDLHQ
TRM2_PSHV1       AHTANLASAVRYD---------CAGDTDGGR---CVHARLLERRRERFAKILNKFLDLHQ
TRM2_EHV1B       SFTRRLASSVFHS---------PDNRMPGGA---CDHTSALDARKERFATIINKFLDLHQ
TRM2_GAHVM       SFTKRLASAIRYGRIKTAVSNNSSSNSYGSTEHVCDHGTSLCGRSERFASVINRFLDLHQ
TRM2_VZVD        SFTSRLASVLKHK--------ESNDSEKSAYVVPCEHSASVTRRRERFAGVMAKFLDLHE
TRM2_EHV2        NYCQFLELFMQLR---------------ASG-CRCEHGEILESKIRAVRQVISKIVETDT
TRM2_HHV8P       NYCQYLKTFLVQR---------------AQP-AACDHTLVLESKVDTVRQVLRKIVSTDA
TRM2_ALHV1       SHCQHLKLFIGQQ---------------GSK-GVCAHSRVLEEKLEAVKEVISKIIETDK
TRM2_HCMVM       NAGQKYAAFLKYV---------------HGDCATCSHGEILREKTQLLTAIVSKLMDING
TRM2_HCMVA       NAGQKYAAFLKYV---------------HGDCATCSHGEILREKTQLLTAIVSKLMDING
TRM2_HHV6U       SVGYRHVAFARYV---------------HGD-VDCVHREVMAQKMVLLTSILSKLLNVNG
TRM2_HHV6Z       SVGYRHVAFSRYV---------------HGD-VDCVHREVMAQKMVLLTSILSKLLNVNG
G3CKQ2_EBVG      NHCIFLEAFKEEN---------------SGQGLGGVQREVL--KRDIIKQVIARIVAADS
                                                     :   :  :   .  :: :::  . 

TRM2_HHV11       ILRG---------------
TRM2_HHV2H       ILRG---------------
TRM2_PSHV1       ILGTIQQ------------
TRM2_EHV1B       ILHDA--------------
TRM2_GAHVM       ILKDC--------------
TRM2_VZVD        ILKDA--------------
TRM2_EHV2        VFNGVKKN-----------
TRM2_HHV8P       VFSEARARP----------
TRM2_ALHV1       ILEKSEKFL----------
TRM2_HCMVM       ILEGKDEPAPGK-------
TRM2_HCMVA       ILEGKDESAPGK-------
TRM2_HHV6U       ILEHQEYLNTE--------
TRM2_HHV6Z       ILEHQEYLNTE--------
G3CKQ2_EBVG      TLDLVNHGEPGREAPRRAQ
                  :