CLUSTAL format seed alignment for MF_04096

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NCAP_CVHN1      MSYTPGH-YAGSRSSSGNRS--GILKKTSWADQSERNYQTFNRGR-KTQPKFTVSTQ---
NCAP_CVHN2      MSYTPGH-HAGSRSSSGNRS--GILKKTSWVDQSERSHQTYNRGR-KPQPKFTVSTQ---
NCAP_CVHN5      MSYTPGH-HAGSRSSSGNRS--GILKKTSWVDQSERSHQTYNRGR-KPQPKFTVSTQ---
NCAP_CVPV       MSFVPGQENAGSRSSSGNRAGNGILKKTTWADQTERGSNNQNRGR-RNQPKQTATTQ---
NCAP_CVRSD      MSFVPGQENAGSRSSSGNRAGNGILKKTTWADQTERGQNNGNRGR-RNQPKQTATTQ---
NCAP_CVM1       MSFVPGQENAGSRSSSVNRAGNGILKKTTWADQTERGPNNQNRGR-RNQPKQTATTQ---
NCAP_CVMJH      MSFVPGQENAGSRSSSGNRAGNGILKKTTWADQTERGLNNQNRGR-KNQPKQTATTQ---
NCAP_CVM2       MSFVPGQENAGSRSSSGNRAGNGILKKTTWADQTERG----NRGR-RNHPKQTATTQ---
NCAP_CVMS       MSFVPGQENAGSRSSSGSRSGNGILKKTTWADQTERAGNNGNRGR-RNQPKQTATTQ---
NCAP_CVRNJ      MSFVPGQENAGSRSSSGSRSGNGILKKTTWADQTERAGNNGNRGR-RNQPKQTATTQ---
NCAP_CVMDV      MSFVPGQENAGSRSSSGNRAGNGILKKTTWADQTERGPNNQNRGR-RNQPKQTATTQ---
NCAP_CVMA5      MSFVPGQENAGGRSSSVNRAGNGILKKTTWADQTERGPNNQNRGR-RNQPKQTATTQ---
NCAP_CVM3       MSFVPGQENAGGRSSSGNRAGNGILKKTTWADQTERGPNNQNRGR-RNQPKQTATTQ---
NCAP_CVEN9      MSFTPGKQSS-SRASSGNRAGNGILK---WADQSDQSSNFQTRGR-RAQPKQTATSQ---
NCAP_CVP67      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RVQSKQTATSQQ--
NCAP_CVPIA      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RVQSKQTATSQQ--
NCAP_CVHOC      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQVRNVQTRGR-RAQPKQTATSQQ--
NCAP_CVBEN      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQQ--
NCAP_CVBLU      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RAQSKQTATSQQ--
NCAP_CVBLS      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQQ--
NCAP_CVBF       MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQQ--
NCAP_CVBM       MSFTPGKQSS-SRASFGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQL--
NCAP_CVBQ       MSFTPGKQSS-SRASFGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQL--
NCAP_CVBLY      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQQ--
NCAP_CVBOK      MSFTPGKQSS-SRASSGNRSGNGILK---WADQSDQSRNVQTRGR-RAQPKQTATSQQ--
NCAP_BCHK9      -------MSGRNRSRSGTPSPKVTFKQESDGSDSESERRNGNRNG-A-RPKNNNSRGSAP
NCAP_BCHK3      ------------MSDNGPQSQRSAPR-ITFGGPADSNDNNQDGGRSGARPKQRR------
NCAP_BC279      ------------MSDNGPQNQRSAPR-ITFGGPSDSTDNNQDGGRSGARPKQRR------
NCAP_CVHSA      ------------MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRR------
NCAP_BCRP3      ------------MSDNGPQNQRSAPR-ITFGGPTDSTDNNQDGGRSGARPKQRR------
NCAP_CVEMC      ------------------MASPAAPRAVSFADNNDITNTNLSRGR-GRNPK---------
NCAP_BCHK5      M-ATPAPPRA-----------------VVFANDNETPTNSQRSG----RPRT----K---
NCAP_BCHK4      ------------------MATPAAPRTISFADNNDNQPNQQQRGR-GRNPK---------
NCAP_BC133      -MATPAAPRT-----------------ISFADNNDNQPNQQQRGR-GRNPK---------
                                               .  :        .    ...         

NCAP_CVHN1      ----PQ-GNTIPHYSWFSGITQFQKGRDFKFSDGQGVPIAFGVPPSEAKGYWYRHSRRSF
NCAP_CVHN2      ----PQ-GNPIPHYSWFSGITQFQKGRDFKFPDGQGVPIAYGIPPSEAKGYWYKHNRRSF
NCAP_CVHN5      ----PQ-GNPIPHYSWFSGITQFQKGRDFKFPDGQGVPIAYGIPPSEAKGYWYKHNRRSF
NCAP_CVPV       ----PNSGSVVPHYSWFSGITQFQKGKEFKFAEGQGVPIANGIPATEQKGYWFRHNRRSF
NCAP_CVRSD      ----PNTGSVVPHYSWFSGITQFQKGKEFQFAGGQGVPIANGIPPSEQKGYWYRHNRRSF
NCAP_CVM1       ----PNSGSVVPHYSWFSGITQFQKGKEFQFAQGQGVPIANGIPASEQKGYWYRHNRRSF
NCAP_CVMJH      ----PNSGSVVPHYSWFSGITQFQKGKEFQFAQGQGVPIANGIPASQQKGYWYRHNRRSF
NCAP_CVM2       ----PNAGSVVPHYSWFSGITQFQKGKEFQFAQGQGVPIASGIPASEQKGYWYRHNRRSF
NCAP_CVMS       ----PNSGSVVPHYSWFSGITQFQKGKEFQFVQGQGVPIANGIPASEQKGYWYRHNRRSF
NCAP_CVRNJ      ----PNSGSVVPHYSWFSGITQFQKGKEFQFADGQGVPIANGIPATEQKGYWYRHNRRSF
NCAP_CVMDV      ----SNSGSVVPHYSWFSGITQFQKGKEFQFADGQGVPIANGIPASEQKGYWYRHNRRSF
NCAP_CVMA5      ----PNSGSVVPHYSWFSGITQFQKGKEFQFAEGQGVPIANGIPASEQKGYWYRHNRRSF
NCAP_CVM3       ----PNSGSVVPHYSWFSGITQFQKGKEFQFAEGQGVPIANGIPASEQKGYWYRHNRRSF
NCAP_CVEN9      ----PAGGNVVPYYSWFSGITQFQKGKEFQFAEGQGVPIAPGIPATEAKGYWYRHNRRSF
NCAP_CVP67      ----PSGGTVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPSTEAKGYWYRHNRRSF
NCAP_CVPIA      ----PSGGTVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVHOC      ----PSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSF
NCAP_CVBEN      ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBLU      ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBLS      ----PSAGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBF       ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBM       ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBQ       ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBLY      ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_CVBOK      ----PSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSF
NCAP_BCHK9      KPEKPK-AAPPQNVSWFAPLVQTGK-AELRFPRGEGVPVSQGVDSTYEHGYWLR-TQRSF
NCAP_BCHK3      ----PQ-GLPNNTASWFTALTQHGK-EELRFPRGQGVPINTNSGKDDQIGYYRRATRR-V
NCAP_BC279      ----PQ-GLPNNTASWFTALTQHGK-EELRFPRGQGVPINTNSGKDDQIGYYRRATRR-V
NCAP_CVHSA      ----PQ-GLPNNTASWFTALTQHGK-EELRFPRGQGVPINTNSGPDDQIGYYRRATRR-V
NCAP_BCRP3      ----PQ-GLPNNTASWFTALTQHGK-EELRFPRGQGVPINTNSGKDDQIGYYRRATRR-V
NCAP_CVEMC      ----PR-AAPNNTVSWYTGLTQHGK-VPLTFPPGQGVPLNANSTPAQNAGYWRRQDRK-I
NCAP_BCHK5      ----PR-PAPNTTVSWFTGLTQHGK-QPLAFPPGQGVPLNANSTPAQNAGYWRRQDRK-I
NCAP_BCHK4      ----PR-PAPNNTVSWYTGLTQHGK-NPLAFPPGQGVPLNANSTTAQNAGYWRRQDRK-I
NCAP_BC133      ----PR-PAPNNTVSWYTGLTQHGK-NPLAFPPGQGVPLNANSTTAQNAGYWRRQDRK-I
                    .         **:: :.*  *   : *  *:* *:  .       **: .  .  .

NCAP_CVHN1      KTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQ
NCAP_CVHN2      KTADGQQKQLLPRWYFYYLGTGPYASSSYGDAHEGIFWVASHQADTSIPSDVSARDPTIQ
NCAP_CVHN5      KTADGQQKQLLPRWYFYYLGTGPYASSSYGDAHEGIFWVASHQADTSIPSDVSARDPTIQ
NCAP_CVPV       KSPDGQQKQLLPRWYFYYLGTGPYAGAEYGDDVEGVCWVANKQADTRTSADIAERDPSSH
NCAP_CVRSD      KTPDGQQKQLLPRWYFYYLGTGPHAGASFGDSIEGVFWVANSQADTNTSADIVERDPSSH
NCAP_CVM1       KTPDGQQKQLLPRWYFYYLGTGPHAGAEYGDDIDGVVWVASQQADTKTTADIVERDPSSH
NCAP_CVMJH      KTPDGQQKQLLPRWYFYYLGTGPYAGAEYGDDIEGVVWVASQQAETRTSADIVERDPSSH
NCAP_CVM2       KTPDGQHKQLLPRWYFYYLGTGPHAGAEYGDDIEGVVWVASQQADTKTTADVVERDPSSH
NCAP_CVMS       KTPDGQQKQLLPRWYFYYLGTGPHAGAEYGDDIEGVVWVASQQADTKTTADIVERDPSSH
NCAP_CVRNJ      KTPDGQQKQLLPRWYFYYLGTGPHAGAIYGDSIEGVFWVANSQADTNTRADIVERDPSSH
NCAP_CVMDV      KTPDGQQKQLLPRWYFYYLGTGPHAGATYGDSIEGVFWVANSQADTNTRSDIVERDPSSH
NCAP_CVMA5      KTPDGQQKQLLPRWYFYYLGTGPHAGASYGDSIEGVFWVANSQADTNTRSDIVERDPSSH
NCAP_CVM3       KTPDGQQKQLLPRWYFYYLGTGPHAGASYGDSIEGVFWVANSQADTNTRSDIVERDPSSH
NCAP_CVEN9      KTADGNQRQLLPRWYFYYLGTGPHAKAQYGTNIDGVFWVANKQADVNTPADVVDRDPSSD
NCAP_CVP67      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADINTPADIVDRDPSSD
NCAP_CVPIA      KTADGNQRQLLPRWYFYYLGTGPHAKHQYGTDIDGVFWVASNQADINTPADIVDRDPSSD
NCAP_CVHOC      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSD
NCAP_CVBEN      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADILDRDPSSD
NCAP_CVBLU      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADILDRDPSSD
NCAP_CVBLS      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSD
NCAP_CVBF       KTRDGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSD
NCAP_CVBM       KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSD
NCAP_CVBQ       KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSD
NCAP_CVBLY      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSD
NCAP_CVBOK      KTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSD
NCAP_BCHK9      QKG-GKQVLANPRWYFYYTGTGRFGDLRFGTKNPDIVWVGQEGANINRLGDMGTRNPSND
NCAP_BCHK3      RGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNN
NCAP_BC279      RGGDGKMKKLSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNN
NCAP_CVHSA      RGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNN
NCAP_BCRP3      RGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNN
NCAP_CVEMC      NTGNG-IKQLAPRWYFYYTGTGPEAALPFRAVKDGIVWVHEDGA-TDAPSTFGTRNPNND
NCAP_BCHK5      NTGNG-TKPLAPRWYFYYTGTGPEANLPFRSVKDGIIWVHENGA-TDAPSVFGTRNPAND
NCAP_BCHK4      NTGNG-VKQLAPRWFFYYTGTGPEANLPFRSVKDGIVWVYEEGA-TDAPSVFGTRNPAND
NCAP_BC133      NTGNG-VKQLAPRWFFYYTGTGPEANLPFRSVKDGIVWVYEEGA-TDAPSVFGTRNPAND
                .   *      ***:*** ***  .   :     .: **    *       .  *:*   

NCAP_CVHN1      EAIPTRFPPGTILPQGYYVEGSG-------RSASNSRPGSRSQSRGPNNRSLSRSNSNFR
NCAP_CVHN2      EAIPTRFSPGTILPQGYYVEGSG-------RSASNSRPGSRSQSRGPNNRSLSRSNSNFR
NCAP_CVHN5      EAIPTRFSPGTILPQGYYVEGSG-------RSASNSRPGSRSQSRGPNNRSLSRSNSNFR
NCAP_CVPV       EAIPTRFAPGTFLPQGYYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVRSD      EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVM1       EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVMJH      EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRPQSRGPN--NRARSSSNQR
NCAP_CVM2       EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVMS       EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVRNJ      EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPS--NRARSSSNQR
NCAP_CVMDV      EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGSN--NRARSSSNQR
NCAP_CVMA5      EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVM3       EAIPTRFAPGTVLPQGFYVEGSG-------RSAPASRSGSRSQSRGPN--NRARSSSNQR
NCAP_CVEN9      EAIPTRFPPGTVLPQGYYIEGSG-------RSVPNSRSTSRASSRASSAGSRNRSNSGTR
NCAP_CVP67      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRAPNRAPSAGSRSRANSGNR
NCAP_CVPIA      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRAPNRAPSAGSRSRANSGNR
NCAP_CVHOC      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRTSSRASSAGSRSRANSGNR
NCAP_CVBEN      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRANSGNR
NCAP_CVBLU      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRANSGNR
NCAP_CVBLS      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRTSSRASSAGSRSRANSGNR
NCAP_CVBF       EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRANSGNR
NCAP_CVBM       EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRANSGNR
NCAP_CVBQ       EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRANSGNR
NCAP_CVBLY      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRADSGNR
NCAP_CVBOK      EAIPTRFPPGTVLPQGYYIEGSG-------RSAPNSRSTSRASSRASSAGSRSRANSGNR
NCAP_BCHK9      GAIPVQLAGG--IPKGFYAEGRGSRGNSRSSSRNSSRASSRGNSRASS-----RGASPGR
NCAP_BCHK3      AAIVLQLPQGTTLPKGFYAEGSRGGSQSSSRSSSRSRGNSRNSTPGSS-----RGSSPAR
NCAP_BC279      AAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSS-----RGNSPAR
NCAP_CVHSA      AATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSS-----RGNSPAR
NCAP_BCRP3      AAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSS-----RGNSPAR
NCAP_CVEMC      SAIVTQFAPGTKLPKNFHIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGP
NCAP_BCHK5      PAIVTQFAPGTTLPKNFHIEGTGGNSQS--SSRASSRSSSRSSSRNGRSNNSSRNASPAP
NCAP_BCHK4      AAIVCQFAPGTLIPKNFHIEGTGGNSQSSSRASSNSRNSSRSSSRGGRSTSNSRGTSPVS
NCAP_BC133      AAIVCQFAPGTLIPKNFHIEGTGGNSQSSSRASSNSRNSSRSNSRGGRSTSNSRGTSPVS
                 *   .:. *  :*:.:: **          :   **  **  .         *  *   

NCAP_CVHN1      HSDSIVK-----PDMADEIANLVLAKLGKD--S-KP-QQVTKQNAKEIRHKILTKPRQKR
NCAP_CVHN2      HSDSIVK-----PDMADEIASLVLAKLGKD--S-KP-QQVTKQNAKEIRHKILMKPRQKR
NCAP_CVHN5      HSDSIVK-----PDMADEIASLVLAKLGKD--S-KP-QQVTKQNAKEIRHKILMKPRQKR
NCAP_CVPV       QPASIVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVRSD      QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVM1       QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVMJH      QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVM2       QPASAVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILTKPRQKR
NCAP_CVMS       QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVRNJ      QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVMDV      QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVMA5      QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVM3       QPASTVK-----PDMAEEIAALVLAKLGKD--AGQP-KQVTKQSAKEVRQKILNKPRQKR
NCAP_CVEN9      TPTSGVT-----SDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEVRQKILNKPRQKR
NCAP_CVP67      TSTPGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEVRQKILNKPRQKR
NCAP_CVPIA      TSTPGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEVRQKILNKPRQKR
NCAP_CVHOC      TPTSGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKHTAKEVRQKILNKPRQKR
NCAP_CVBEN      TPTSGVT-----PDMADQIASLVLAKLGKD--AAKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBLU      TPTSGVT-----PDMADQIASLVLAKLGKD--AAKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBLS      TPTSGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBF       TPTSGVT-----PDMADQIVSLVLAKLGKD--ATKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBM       TPTSGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBQ       TPTSGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBLY      TPTSGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_CVBOK      TPTSGVT-----PDMADQIASLVLAKLGKD--ATKP-QQVTKQTAKEIRQKILNKPRQKR
NCAP_BCHK9      PAANPSTEPWM-AYLVQKLERLESQVSGTKPATKNP-VQVTKNEAAANAKK----LRHKR
NCAP_BCHK3      LASGGGETALA-LLLLDRLNQLESKVSGKG--QQQPGQTVTKKSAAEASKK----PRQKR
NCAP_BC279      MASGSGETALA-LLLLDRLNQLESKVSGKG--QQQQGQTVTKKSAAEASKK----PRQKR
NCAP_CVHSA      MASGGGETALA-LLLLDRLNQLESKVSGKG--QQQQGQTVTKKSAAEASKK----PRQKR
NCAP_BCRP3      MASGGGETALA-LLLLDRLNQLESKVSGRS--QQQQGQTVTKKSAAEASKK----PRQKR
NCAP_CVEMC      SGIGAVGGDLLYLDLLNRLQALESGKVKQS----QP-KVITKKDAAAAKNK----MRHKR
NCAP_BCHK5      HGVGDVVGAGTLSVLLDLQKRLADLEAGKG--NKQP-KVITKKDAQAAKQK----MRHKR
NCAP_BCHK4      HGVGSAESLAALPLLLDLQKRLADLESGK---SKQP-KVVTKKDAAAAKNK----MRHKR
NCAP_BC133      HGVGSAESLAALPLLLDLQKRLADLESGK---SKQP-KVVTKKDAAAAKNK----MRHKR
                              : :    *            :    :**: *    :*     *:**

NCAP_CVHN1      TPNKHCNVQQCFGKRGPSQ---NFGNAEMLKLGTNDPQFPILAELAPTPGAFFFGSKLDL
NCAP_CVHN2      TPNKFCNVQQCFGKRGPLQ---NFGNSEMLKLGTNDPQFPILAELAPTPGAFFFGSKLEL
NCAP_CVHN5      TPNKFCNVQQCFGKRGPLQ---NFGNSEMLKLGTNDPQFPILAELAPTPGAFFFGSKLEL
NCAP_CVPV       TPNKQCPVQQCFGKRGPNQ---NFGGPEMLKLGTSDPQFPILAELAPTAGAFFFGSKLEL
NCAP_CVRSD      TPNKQCPVQQCFGKRGPNQ---NFGGPEMLKLGTSDPQFPILAELAPTPGAFFFGSKLEL
NCAP_CVM1       TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTPSAFFFGSKLEL
NCAP_CVMJH      TPNKQCPVQQCFGKRGPNQ---NFGGPEMLKLGTSDPQFPILAELAPTAGAFFFGSKLEL
NCAP_CVM2       TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTPSAFFFGSKLEL
NCAP_CVMS       TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTAGAFFFGSKLEL
NCAP_CVRNJ      TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTPGAFFFGSKLEL
NCAP_CVMDV      TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTPGAFFFGSKLEL
NCAP_CVMA5      TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTVGAFFFGSKLEL
NCAP_CVM3       TPNKQCPVQQCFGKRGPNQ---NFGGSEMLKLGTSDPQFPILAELAPTVGAFFFGSKLEL
NCAP_CVEN9      SPNKQCTVQQCFGKRGPNQ---NFGGAEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVP67      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVPIA      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVHOC      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBEN      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBLU      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBLS      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBF       SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBM       SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBQ       SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBLY      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_CVBOK      SPNKQCTVQQCFGKRGPNQ---NFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLEL
NCAP_BCHK9      TAHKGSGVTVNYGRRGPGDLEGNFGDREMIKLGTDDPRFAAAAQMAPNVSSFLFMSHLST
NCAP_BCHK3      TATKQYNVTQAFGRRGPEQTQGNFGDQELIRQGIDYKHWPQIAQFAPSASAFFGMSRIGM
NCAP_BC279      TATKSYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKYWPQIAQFAPSASAFFGMSRIGM
NCAP_CVHSA      TATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGM
NCAP_BCRP3      TATKQYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGM
NCAP_CVEMC      TSTKSFNMVQAFGLRGPGDLQGNFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKL
NCAP_BCHK5      VATKGYNVVQAFGMRGPGPLQSNFGDMQYNKLGTEDPRWPQIAELAPSASAFMSTSQFKV
NCAP_BCHK4      VATKGFNVTQAFGLRGPGPLQGNFGDMNYNKFGTEDPRWPQMAELAPSASAFMSMSQFKL
NCAP_BC133      VATKGFNVTQAFGLRGPGPLQGNFGDMNYNKFGTEDPRWPQMAELAPSASAFMSMSQFKL
                 . *   :   :* ***     ***. :  . * .   :.  *::**. .:*:  *.:  

NCAP_CVHN1      --VKRDS-EADSPVKDVFELHYSGSIRFDSTLPGFETIMKVLEENLNAYVNSNQNTDSDS
NCAP_CVHN2      --FKRDS-DADSPSKDTFELRYSGSIRFDSTLPGFETIMKVLKENLDAYVNSNQNTVSGS
NCAP_CVHN5      --FKRDS-DADSPSKDTFELRYSGSIRFDSTLPGFETIMKVLKENLDAYVNSNQNTVSGS
NCAP_CVPV       --VKKNSVGVDEPTKDVYELQYSGAVRFDSTLPGFETIMKVLRENLNAY--QNQDGGADV
NCAP_CVRSD      --VKKNSGGVDEPTKDVYELQYSGAVRFDSTLPGFETIMKVLNENLNAY--QNQAGGADV
NCAP_CVM1       --VKKNSGGADDPTKDVYELQYSGAIRFDSTLPGFETIMKVLNENLDAY--QDQAGGADV
NCAP_CVMJH      --VKKNSGGADGPTKDVYELQYSGAVRFDSTLPGFETIMKVLNENLNAY--QNQDGGADV
NCAP_CVM2       --VKKNSGGADEPTKDVYELQYSGAIRFDSTLPGFETIMKVLTENLNAY--QDQAGSVDL
NCAP_CVMS       --VKKNSGGADEPTKDVYELQYSGAVRFDSTLPGFETIMKVLNENLNAY--QKD-GGADV
NCAP_CVRNJ      --VKKNSGGADEPTKDVYELQYSGAIRFDSTLPGFETIMKVLNENLNAY--QKEAGGVDV
NCAP_CVMDV      --VKKNSGGVDEPTKDVYELLYSGAIRFDSTLPGFETIMKVLNENLNAY--QNQAGGVDV
NCAP_CVMA5      --VKKNSGGADEPTKDVYELQYSGAVRFDSTLPGFETIMKVLNENLNAY--QKD-GGADV
NCAP_CVM3       --VKKNSGGADEPTKDVYELQYSGAVRFDSTLPGFETIMKVLNENLNAY--QKD-GGADV
NCAP_CVEN9      AKVQNLSGNFDEPQKDVYELRYNGAIRFDSTLPGFETIMKVLNENLNAY--QQQDDGTN-
NCAP_CVP67      AKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNQNLNAY--QHQEDGMMN
NCAP_CVPIA      AKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNQNLNAY--QHQEDGMMN
NCAP_CVHOC      AKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_CVBEN      AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGTMN
NCAP_CVBLU      AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGTMN
NCAP_CVBLS      AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_CVBF       AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_CVBM       AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_CVBQ       AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_CVBLY      AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_CVBOK      AKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAY--Q-QQDGMMN
NCAP_BCHK9      -----------RDEDDALWLHYKGAIKLPKDDPNYEQWTKILAENLNAY------KDFPP
NCAP_BCHK3      -----------EVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAY------KTFPP
NCAP_BC279      -----------EVTPLGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAY------KAFPP
NCAP_CVHSA      -----------EVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAY------KTFPP
NCAP_BCRP3      -----------EVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAY------KIFPP
NCAP_CVEMC      --THQNNDDHGNP---VYFLRYSGAIKLDPKNPNYNKWLELLEQNIDAY------KTFPK
NCAP_BCHK5      --THQSNDENGEP---VYFLSYSGAIKLDPKNPNYNKWMEILDANIDAY------KSFPK
NCAP_BCHK4      --THQSNDDKGDP---IYFLSYSGAIKLDPKNPNYKKWLELLESNIDAY------KTFPK
NCAP_BC133      --THQSNDDKGDP---IYFLSYSGAIKLDPKNPNYKKWLELLEANIDAY------KTFPK
                                   * * *::.:    . ::    :*  :::**           

NCAP_CVHN1      LSSKPQRKRGVK------------QLPEQF-------------------------DSLNL
NCAP_CVHN2      LSPKPQRKRGVK------------QSPESF-------------------------DSLNL
NCAP_CVHN5      LSPKPQRKRGVK------------QSPESF-------------------------DSLNL
NCAP_CVPV       VSPKPQRKRGQRQV--------AQKKNDEV-------------------------DNVSV
NCAP_CVRSD      VSPKPQRKRGTK----------QTAQKEEL-------------------------DSISV
NCAP_CVM1       VSPKPQRKRGTK----------QKALKGEV-------------------------DNVSV
NCAP_CVMJH      VSPKPQRKRGTK----------QKAQKDEV-------------------------DNVSV
NCAP_CVM2       VSPKPPRRGRRQ----------AQEKKDEV-------------------------DNVSV
NCAP_CVMS       VSPKPQRKGRRQ----------AQEKKDEV-------------------------DNVSV
NCAP_CVRNJ      VSPKPQRKGRRQ----------AQEKKDEV-------------------------DNVSV
NCAP_CVMDV      VSPKPQRKGRRQ----------AQEKKDEV-------------------------DNVSV
NCAP_CVMA5      VSPKPQRKGRRQ----------AQEKKDEV-------------------------DNVSV
NCAP_CVM3       VSPKPQRKGRRQ----------AQEKKDEV-------------------------DNVSV
NCAP_CVEN9      MSPKPQRQRGQQ-------------KGGEN-------------------------EDVSV
NCAP_CVP67      ISPKPQRQRGQK------------NGQVEN-------------------------DNVSV
NCAP_CVPIA      ISPKPQRQRGQK------------NGQVEN-------------------------DNISV
NCAP_CVHOC      MSPKPQRQRGHK------------NGQGEN-------------------------DNISV
NCAP_CVBEN      MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBLU      MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBLS      MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBF       MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBM       MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBQ       MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBLY      MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_CVBOK      MSPKPQRQRGQK------------NGQGEN-------------------------DNISV
NCAP_BCHK9      TEPKKDKKKKEETAQDTVIFEDASTGTDQTVVKVWVKDQDAQTDDEWLGGDETVYEDEDD
NCAP_BCHK3      TEPKKDKKKK----------------TDEA-------------------------QPLPQ
NCAP_BC279      TEPKKDKKKK----------------TDEA-------------------------QPLPQ
NCAP_CVHSA      TEPKKDKKKK----------------TDEA-------------------------QPLPQ
NCAP_BCRP3      TEPKKDKKKK----------------TDEA-------------------------QPLPQ
NCAP_CVEMC      KEKKQKAPKEES--------------TDQM-------------------------SE---
NCAP_BCHK5      KERKQKPSGDDA-A--------TAPATSQM-------------------------EDVPE
NCAP_BCHK4      KERKPKTTEDGA-V--------ASSSASQM-------------------------EDVDA
NCAP_BC133      KERKPKTTEDGAVV--------ASSSASQM-------------------------EDVDA
                 . *                        .                          .    

NCAP_CVHN1      SAGT----QHISNDFTPEDHSLLAT-LDDPYV-----EDSVA
NCAP_CVHN2      SADT----QHISNDFTPEDHSLLAT-LDDPYV-----EDSVA
NCAP_CVHN5      SADT----QHISNDFTPEDHSLLAT-LDDPYV-----EDSVA
NCAP_CVPV       AKPKSAVQRNVNRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVRSD      AKPKSAVQRNVSRELTPEDRSLLAQILDDGVVPDGL-DDSNV
NCAP_CVM1       AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVMJH      AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVM2       AKPKSLVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVMS       AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVRNJ      AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGL-DDSNA
NCAP_CVMDV      AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVMA5      AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVM3       AKPKSSVQRNVSRELTPEDRSLLAQILDDGVVPDGLEDDSNV
NCAP_CVEN9      AAPKSRVQQNKSRELTAEDISLVKQ-MDDPLT----EDNSEM
NCAP_CVP67      AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVPIA      AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVHOC      AVPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVBEN      AAPKSRVQQNKIRELTAEDISLLKK-MDEPFT----EDTSEI
NCAP_CVBLU      AAPKSRVQQNKIRELTAEDISLLKK-MDEPFT----EDTSEI
NCAP_CVBLS      AAPKSRVQQNKSRELTAEDISLLKK-MDEPFT----EDTSEI
NCAP_CVBF       AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVBM       AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVBQ       AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVBLY      AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_CVBOK      AAPKSRVQQNKSRELTAEDISLLKK-MDEPYT----EDTSEI
NCAP_BCHK9      RPKTQR--RHKKRGSTASRVT-----IADPTN----AGAERS
NCAP_BCHK3      RQKK----QPTVTLLPAADMDDFSRQLQHSMS-GASADSTQA
NCAP_BC279      R-KK----QPTVTLLPAADMDDFSRQLQNSMS-GASADSTQA
NCAP_CVHSA      RQKK----QPTVTLLPAADMDDFSRQLQNSMS-GASADSTQA
NCAP_BCRP3      RQKK----QPTVTLLPAADMDDFSRQLQNSMS-GASADSTQA
NCAP_CVEMC      -PPKEHRVQGTQRTRTRPS-----------VQPGPMIDVNTD
NCAP_BCHK5      LPPKQQRKKRVVQGSIPQRSAGVPS-FEDVV--DAIFPDSEA
NCAP_BCHK4      KPQRKPKSR-VAGSITMRSGSLPA--LQDVTF------DSEA
NCAP_BC133      KPQRKPKSR-VAGSITMRSGSSPA--LQDVTF------DSEA
                        .