CLUSTAL format seed alignment for MF_04099

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SPIKE_BCHK9      ------MLLILVLGVSLAAASRPECFN------------------PRFTLTP--------
SPIKE_CVHSA      ----MFIFLLFLTLTSGSDLDRCTTFD-------DVQ-------APNYTQHT--------
SPIKE_BCHK3      ----MKILIFAFLANLAKAQEGCGIIS-------RKP-------QPKMAQVS--------
SPIKE_BC279      ----MKVLIFALLFSLAKAQEGCGIIS-------RKP-------QPKMEKVS--------
SPIKE_BCRP3      ----MKILILAFLASLAKAQEGCGIIS-------RKP-------QPKMAQVS--------
SPIKE_CVHN1      -----MLLIIFILPTTLAVIGDFNCTN-FAINDLNTT-------VPRISEYV--------
SPIKE_CVHN5      ----MFLIIFI-LPTTLAVIGDFNCTN-SFINDYNKT-------IPRISEDV--------
SPIKE_CVHN2      ----MFLIIFI-LPTTLAVIGDFNCTN-SFINDYNKT-------IPRISEDV--------
SPIKE_CVRSD      ----MLFVFLTLLPSCLGYIGDFRCINLVNTRISNAR-------APSVSTEV--------
SPIKE_CVMA5      ----MLFVFILFLPSCLGYIGDFRCIQLVNSNGANVS-------APSISTET--------
SPIKE_CVMJC      ----MLFVFILFLPSCLGYIGDFRCIQTVNYNGNNAS-------APSISTEA--------
SPIKE_CVM4       ----MLFVFILLLPSCLGYIGDFRCIQTVNYNGNNAS-------APSISTEA--------
SPIKE_CVMJH      ----MLFVFILLLPSCLGYIGDFRCIQTVNYNGNNAS-------APSISTEA--------
SPIKE_CVP67      ----MFFILLISLPSAFAVIGDLKCTT-SLINDVDTG-------VPSISSEV--------
SPIKE_CVPIA      ----MFFILLITLPSVFAVIGDLKCNT-SSINDVDTG-------VPSISSEV--------
SPIKE_CVHOC      ----MFLILLISLPTAFAVIGDLKCTS-DNINDKDTG-------PPPISTDT--------
SPIKE_CVBLS      ----MFLILLISLPTAFAVIGDLKCTT-VSINDVDTG-------VPSISTDT--------
SPIKE_CVBOK      ----MFLILLISLPTAFAVIGDLKCTT-VSINDVDTG-------VPSISTDT--------
SPIKE_CVBEN      ----MFLILLISLPTAFAVIGDLKCTT-VSINDVDTG-------VPSISTDT--------
SPIKE_CVBLU      ----MFLILLISLPTAFAVIGDLKCTT-VSINDVDTG-------VPSISTDT--------
SPIKE_CVBM       ----MFLILLISLPMAFAVIGDLKCTT-VSINDVDTG-------APSISTDI--------
SPIKE_CVBQ       ----MFLILLISLPMAFAVIGDLKCTT-VSINDVDTG-------APSISTDI--------
SPIKE_CVBL9      ----MFLILLISLPMAFAVIGDLKCTT-VSINDVDTG-------APSISTDI--------
SPIKE_CVBV       ----MFLILLISLPMAFAVIGDLKCTT-VSINDVDTG-------APSISTDT--------
SPIKE_CVBF       ----MFLILLISLPMALAVIGDLKCTT-VSINDVDTG-------VPSISTDT--------
SPIKE_CVBLY      ----MFLILLISLPMALAVIGDLKCTT-VSINDVDTG-------VPSVSTDT--------
SPIKE_CVEMC      MIHSVFLLMFLLTPTESYVDVGPDSVK-----------------SACIEVDI-QQTFFDK
SPIKE_BCHK5      -----MIRSVLVLMCSLTFIGNLTRGQSVDMGHNGTGSCLDSQVQPDYFESV------HT
SPIKE_BC133      ----M-TRLMCLLMSLSIFVRGFDSQF-VDMSPASNA-------SECLESQVDAAAFSKL
SPIKE_BCHK4      ----M-TLLMCLLMSLLIFVRGCDSQF-VDMSPASNT-------SECLESQVDAAAFSKL
                          .                                                  

SPIKE_BCHK9      ---------LNHTLNYTSIKAKVSNVLLPDPYI-AYSGQTLRQNLFMADMSN-----TIL
SPIKE_CVHSA      --------SSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHT-----------
SPIKE_BCHK3      --------SSRRGVYYNDDIFRSDVLHLTQDYFLPFDSNLTQYFSLNVDSD------RYT
SPIKE_BC279      --------SSRRGVYYNDDIFRSDVLHLTQDYFLPFDSNLTQYFSLNIDSN------KYT
SPIKE_BCRP3      --------SSRRGVYYNDDIFRSNVLHLTQDYFLPFDSNLTQYFSLNVDSD------RFT
SPIKE_CVHN1      -----VDVSYGLGTYYILDRVYLNTTILFTGYF-PKSGANFRDLSLKGTTYL-----STL
SPIKE_CVHN5      -----VDVSLGLGTYYVLNRVYLNTTLLFTGYF-PKSGANFRDLALKGSIYL-----STL
SPIKE_CVHN2      -----VDVSLGLGTYYVLNRVYLNTTLLFTGYF-PKSGANFRDLALKGSKYL-----STL
SPIKE_CVRSD      -----VDVSKGLGTYYVLDRVYLNATLLLTGYY-PVDGSMYRNMALMGTNTL-----SLN
SPIKE_CVMA5      -----VEVSQGLGTYYVLDRVYLNATLLLTGYY-PVDGSKFRNLALRGTNSV-----SLS
SPIKE_CVMJC      -----VDVSKGLGTYYVLDRVYLNATLLLTGYY-PVDGSNYRNLALTGTNTL-----SLT
SPIKE_CVM4       -----VDVSKGLGTYYVLDRVYLNATLLLTGYY-PVDGSNYRNLALTGTNTL-----SLT
SPIKE_CVMJH      -----VDVSKGRGTYYVLDRVYLNATLLLTGYY-PVDGSNYRNLALTGTNTL-----SLT
SPIKE_CVP67      -----VDVTNGLGTFYVLDRVYLNTTLLLNGYY-PISGATFRNMALKGTRLL-----STL
SPIKE_CVPIA      -----VDVTNGLGTFYVLDRVYLNTTLLLNGYY-PISGATFRNVALKGTRLL-----STL
SPIKE_CVHOC      -----VDVTNGLGTYYVLDRVYLNTTLFLNGYY-PTSGSTYRNMALKGSVLL-----SRL
SPIKE_CVBLS      -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----STL
SPIKE_CVBOK      -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----STL
SPIKE_CVBEN      -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----STL
SPIKE_CVBLU      -----VDVTKGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----STL
SPIKE_CVBM       -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----SRL
SPIKE_CVBQ       -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----SRL
SPIKE_CVBL9      -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----SRL
SPIKE_CVBV       -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----SRL
SPIKE_CVBF       -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----STL
SPIKE_CVBLY      -----VDVTNGLGTYYVLDRVYLNTTLLLNGYY-PTSGSTYRNMALKGTLLL-----STL
SPIKE_CVEMC      TWPRPIDVSKADGIIYPQGRTYSNITITYQGLF-PYQGDHGDMYVYSAGHATGTT--PQK
SPIKE_BCHK5      TWPMPIDTSKAEGVIYPNGKSYSNITLTYTGLY-PKANDLGKQYLFSDGHSA--PGRLNN
SPIKE_BC133      VWPYPIDPAKVDGIIYPLGRTYSNITLEYTGLF-PLQGDLGMQYLYSVSHAVGNDGDPTK
SPIKE_BCHK4      MWPYPIDPSKVDGIIYPLGRTYSNITLAYTGLF-PLQGDLGSQYLYSVSHAVGHDGDPTK
                                *       .          .  .                      

SPIKE_BCHK9      YPVTPP---ANGANGGFIYNTSIIPVSAGLFVNTWMYRQPASSRAYCQEPFGVAFGDTFE
SPIKE_CVHSA      -FGNP----VIPFKDGIYFAAT----EKSNVVRGWVF------------------GSTMN
SPIKE_BCHK3      YFDNP----ILDFGDGVYFAAT----EKSNVIRGWIF------------------GSSFD
SPIKE_BC279      YFDNP----ILDFGDGVYFAAT----EKSNVIRGWIF------------------GSSFD
SPIKE_BCRP3      YFDNP----ILDFGDGVYFAAT----EKSNVIRGWIF------------------GSTFD
SPIKE_CVHN1      WYQKPF---LSDFNNGIFSRVK----NTKLYVNKTLYSE---------FS-TIVIGSVFI
SPIKE_CVHN5      WYKPPF---LSDFNNGIFSKVK----NTKLYVNNTLYSE---------FS-TIVIGSVFV
SPIKE_CVHN2      WYKPPF---LSDFNNGIFSKVK----NTKLYVNNTLYSE---------FS-TIVIGSVFV
SPIKE_CVRSD      WFEPPF---LSEFNDGIYAKVK----NLKASLPIGSASY---------FP-TIIIGSNFV
SPIKE_CVMA5      WFQPPY---LNQFNDGIFAKVQ----NLKTSTPSGATAY---------FP-TIVIGSLFG
SPIKE_CVMJC      WFKPPF---LSEFNDGIFAKVQ----NLKTNTPTGATSY---------FP-TIVIGSLFG
SPIKE_CVM4       WFKPPF---LSEFNDGIFAKVQ----NLKTNTPTGATSY---------FP-TIVIGSLFG
SPIKE_CVMJH      WFKPPF---LSEFNDGIFAKVQ----NLKTNTPTGATSY---------FP-TIVIGSLFG
SPIKE_CVP67      WFKPPF---LSPFNDGIFAKVK----NSRFSKDGVIYSE---------FP-AITIGSTFV
SPIKE_CVPIA      WFKPPF---LSPFNDGIFAKVK----NSRFSKHGVIYSE---------FP-AITIGSTFV
SPIKE_CVHOC      WFKPPF---LSDFINGIFAKVK----NTKVIKDRVMYSE---------FP-AITIGSTFV
SPIKE_CVBLS      WFKPPF---LSDFTNGIFAKVK----NTKVIKDGVKYSE---------FP-AITIGSTFV
SPIKE_CVBOK      WFKPPF---LSDFTNGIFAKVK----NTKVIKDGVKYSE---------FP-AITIGSTFV
SPIKE_CVBEN      WFKPPF---LSDFTNGIFAKVK----NTKVIKDGVMYSE---------FP-AITIGSTFV
SPIKE_CVBLU      WFKPPF---LSDFTNGIFAKVK----NTKVIKDGVMYSE---------FP-AITIGSTFV
SPIKE_CVBM       WFKPPF---LSDFINGIFAKVK----NTKVIKKGVMYSE---------FP-AITIGSTFV
SPIKE_CVBQ       WFKPPF---LSDFINGIFAKVK----NTKVIKKGVMYSE---------FP-AITIGSTFV
SPIKE_CVBL9      WFKPPF---LSDFINGIFAKVK----NTKVIKKGVMYSE---------FP-AITIGSTFV
SPIKE_CVBV       WFKPPF---LSDFINGIFAKVK----NTKVIKKGVMYSE---------FP-AITIGSTFV
SPIKE_CVBF       WFKPPF---LSDFINGIFAKVK----NTKVIKHGVMYSE---------FP-AITIGSTFV
SPIKE_CVBLY      WFKPPF---LSDFINGIFAKVK----NTKVIKNGVMYSE---------FP-AITIGSTFV
SPIKE_CVEMC      LFVANYSQDVKQFANGFVVRIG----AAANSTGTVIISPSTSATIRKIYP-AFMLGSSVG
SPIKE_BCHK5      LFVSNYSSQVESFDDGFVVRIG----AAANKTGTTVISQSTFKPIKKIYP-AFLLGHSVG
SPIKE_BC133      AYISNYSLLVNDFDNGFVVRIG----AAANSTGTIVISPSVNTKIKKAYP-AFILGSSLT
SPIKE_BCHK4      AYISNYSLLVNDFDNGFVVRIG----AAANSTGTIVISPSVNTKIKKAYP-AFILGSSLT
                               .*.                                      *  . 

SPIKE_BCHK9      NDRI---------AILIMAPDNLGSWSAVAPRNQTNIYLLVC----------------SN
SPIKE_CVHSA      NKS----------QSVIIINN------------STNVVIRAC-----------------N
SPIKE_BCHK3      NTT----------QSAVIVNN------------STHIIIRVC-----------------N
SPIKE_BC279      NTT----------QSAIIVNN------------STHIIIRVC-----------------N
SPIKE_BCRP3      NTT----------QSAVIVNN------------STHIIIRVC-----------------N
SPIKE_CVHN1      NNS----------YTIVVQPH------------NGVLEITAC-----------------Q
SPIKE_CVHN5      NTS----------YTIVVQPH------------NGILEITAC-----------------Q
SPIKE_CVHN2      NTS----------YTIVVQPH------------NGILEITAC-----------------Q
SPIKE_CVRSD      NTS----------YTVVLEPY------------NGIIMASIC-----------------Q
SPIKE_CVMA5      YTS----------YTVVIEPY------------NGVIMASVC-----------------Q
SPIKE_CVMJC      NTS----------YTVVLEPY------------NNIIMASVC-----------------T
SPIKE_CVM4       NTS----------YTVVLEPY------------NNIIMASVC-----------------T
SPIKE_CVMJH      NTS----------YTVVLEPY------------NNIIMASVC-----------------T
SPIKE_CVP67      NTS----------YSIVVEPHTSLI----NGNLQGLLQISVC-----------------Q
SPIKE_CVPIA      NTS----------YSIVVKPHTSFI----NGNLQGFLQISVC-----------------Q
SPIKE_CVHOC      NTS----------YSVVVQPRTINSTQDGDNKLQGLLEVSVC-----------------Q
SPIKE_CVBLS      NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBOK      NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBEN      NTS----------YSVVVQPHTTIL----GNKLQGFLEISVC-----------------Q
SPIKE_CVBLU      NTS----------YSVVVQPHTTIL----GNKLQGFLEISVC-----------------Q
SPIKE_CVBM       NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBQ       NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBL9      NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBV       NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBF       NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVBLY      NTS----------YSVVVQPHTTNL----DNKLQGLLEISVC-----------------Q
SPIKE_CVEMC      NFSDGKMG-RFFNHTLVLLPDGC----------GTLLRAFYCILEPRSGNHCPAGNSYTS
SPIKE_BCHK5      NYTPSNRTGRYLNHTLVILPDGC----------GTILHAFYCVLHPRTQQNCAGETNFKS
SPIKE_BC133      NTSAGKPL--YANYSLTIIPDGC----------GTVLHAFYCILKPRTGNRCPSGSDYNA
SPIKE_BCHK4      NTSAGQPL--YANYSLTIIPDGC----------GTVLHAFYCILKPRTVNRCPSGTGYVS
                                  :                  :    *                  

SPIKE_BCHK9      ATLCINPGFNRWGP----AGSFIAPDALVDHSNSCFVNN---TFSVNISTSRISL----A
SPIKE_CVHSA      FELCDNPFFAVSKP----MGTQTHTMIFDNAFN-CTFEYISDAFSLDVSEKSGNFKHLRE
SPIKE_BCHK3      FNLCKEPMYTVSR------GTQQNAWVYQSAFN-CTYDRVEKSFQLDTTPKTGNFKDLRE
SPIKE_BC279      FNLCKEPMYTVSK------GTQQSSWVYQSAFN-CTYDRVEKSFQLDTAPKTGNFKDLRE
SPIKE_BCRP3      FNLCKEPMYTVSR------GAQQSSWVYQSAFN-CTYDRVEKSFQLDTAPKTGNFKDLRE
SPIKE_CVHN1      YTMCEYP-HTICKS-K--GSSRNESWHFDKSEPLCLFKK---NFTYNVSTDWLYF-----
SPIKE_CVHN5      YTMCEYP-HTVCKS-K--GSIRNESWHIDSSEPLCLFKK---NFTYNVSADWLYF-----
SPIKE_CVHN2      YTMCEYP-HTVCKS-K--GSIRNESWHIDSSEPLCLFKK---NFTYNVSADWLYF-----
SPIKE_CVRSD      YTICQLP-HTDCKP-NTGGNTLIGFWHTDLRPPVCILKR---NFTFNVNAEWLYF-----
SPIKE_CVMA5      YTICQLP-YTDCKP-NTNGNKLIGFWHTDVKPPICVLKR---NFTLNVNADAFYF-----
SPIKE_CVMJC      YTICQLP-YTPCKP-NTNGNRVIGFWHTDVKPPICLLKR---NFTFNVNAPWLYF-----
SPIKE_CVM4       YTICQLP-YTPCKP-NTNGNRVIGFWHTDVKPPICLLKR---NFTFNVNAPWLYF-----
SPIKE_CVMJH      YTICQLP-YTPCKP-NTNGNRVIGFWHTDVKPPICLLKR---NFTFNVNAPWLYF-----
SPIKE_CVP67      YTMCEYP-HTICHP-NL-GNQRIELWHYDTDVVSCLYRR---NFTYDVNADYLYF-----
SPIKE_CVPIA      YTMCEYP-QTICHP-NL-GNQRIELWHHDTDVVSCLYRR---NFTYDVNADYLYF-----
SPIKE_CVHOC      YNMCEYP-QTICHP-NL-GNHRKELWHLDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBLS      YTMCEYP-NTICNP-NL-GNQRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBOK      YTMCEYP-NTICNP-NL-GNQRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBEN      YTMCEYP-NTICNP-NL-GNQRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBLU      YTMCEYP-NTICNP-NL-GNRRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBM       YTMCEYP-HTICHP-NL-GNKRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBQ       YTMCEYP-HTICHP-KL-GNKRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBL9      YTMCEYP-HTICHP-NL-GNKRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBV       YTMCEYP-HTICHP-NL-GNQRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBF       YTMCEYP-NTICHP-NL-GNRRVELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVBLY      YTMCEYP-HTICHP-NL-GNRRIELWHWDTGVVSCLYKR---NFTYDVNADYLYF-----
SPIKE_CVEMC      FATYHTP-ATDCSDGNYNRNASLNSFKEYFNLRNCTFMY---TYNITEDEILEWF-----
SPIKE_BCHK5      LSLWDTP-ASDCVSGSYNQEATLGAFKVYFDLINCTFRY---NYTITEDENAEWF-----
SPIKE_BC133      YFIYETI-HSDCQS-TINRNASLNSFKSFFDLVNCTFFN---SWDITADETKEWF-----
SPIKE_BCHK4      YFIYETV-HNDCQS-TINRNASLNSFKSFFDLVNCTFFN---SWDITADETKEWF-----
                                                   *        :          :     

SPIKE_BCHK9      FLFKDGDLLIYHSGWLPTSNFEHGFSRGSHPMTYFMSLPVGGNLPRAQFFQSIVRSNAID
SPIKE_CVHSA      FVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDI
SPIKE_BCHK3      YVFKNRDGFLSVYQTYTAVNLPRGLPTGFSVLKPILKLPFGINITSYRVVMAMFSQTTSN
SPIKE_BC279      YVFKNRDGFLSVYQTYTAVNLPRGFPAGFSVLRPILKLPFGINITSYRVVMTMFSQFNSN
SPIKE_BCRP3      YVFKNRDGFLSVYQTYTAVNLPRGLPIGFSVLRPILKLPFGINITSYRVVMAMFSQTTSN
SPIKE_CVHN1      HFYQERGTFYAYYA-------DSGMPTTF-----LFSLYLGTLLSHYYVLPLTCNAISSN
SPIKE_CVHN5      HFYQERGVFYAYYA-------DVGMPTTF-----LFSLYLGTILSHYYVMPLTCNAISSN
SPIKE_CVHN2      HFYQERGVFYAYYA-------DVGMPTTF-----LFSLYLGTILSHYYVMPLTCKAISSN
SPIKE_CVRSD      HFYQQGGTFYAYYA-------DVSSATTF-----LFSSYIGAVLTQYFVLPYMCSPTTSG
SPIKE_CVMA5      HFYQHGGTFYAYYA-------DKPSATTF-----LFSVYIGDILTQYYVLPFICNPTAGS
SPIKE_CVMJC      HFYQQGGTFYAYYA-------DKPSATTF-----LFSVYIGDILTQYFVLPFICTPTAGS
SPIKE_CVM4       HFYQQGGTFYAYYA-------DKPSATTF-----LFSVYIGDILTQYFVLPFICTPTAGS
SPIKE_CVMJH      HFYQQGGTFYAYYA-------DKPSATTF-----LFSVYIGDILTQYFVLPFICTPTAGS
SPIKE_CVP67      HFYQEGGTFYAYFT-------DTGFVTKF-----LFKLYLGTVLSHYYVMPLTCNSA---
SPIKE_CVPIA      HFYQEGGTFYAYFT-------DTGFVTKF-----LFKLYLGTVLSHYYVMPLTCDSA---
SPIKE_CVHOC      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGMALSHYYVMPLTCNSK---
SPIKE_CVBLS      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVMPLTCNSA---
SPIKE_CVBOK      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVMPLTCNSA---
SPIKE_CVBEN      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVMPLTCNSA---
SPIKE_CVBLU      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVMPLTCNSA---
SPIKE_CVBM       HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVLPLTCSSA---
SPIKE_CVBQ       HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVLPLTCSSA---
SPIKE_CVBL9      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVLPLTCNSA---
SPIKE_CVBV       HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVLPLTCYSA---
SPIKE_CVBF       HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVMPLTCNSA---
SPIKE_CVBLY      HFYQEGGTFYAYFT-------DTGVVTKF-----LFNVYLGTVLSHYYVMPLTCNSA---
SPIKE_CVEMC      GITQTAQGVHLFSS-------RYVDLYGGNMFQ-FATLPVYDTIKYYSIIPHSIRSIQSD
SPIKE_BCHK5      GITQDTQGVHLYSS-------RKENVFRNNMFH-FATLPVYQKILYYTVIPRSIRSPFND
SPIKE_BC133      GITQDTQGVHLHSS-------RKGDLYGGNMFR-FATLPVYEGIKYYTVIPRSFRSKANK
SPIKE_BCHK4      GITQDTQGVHLYSS-------RKGDLYGGNMFR-FATLPVYEGIKYYTVIPRSFRSKANK
                  . :    .                         : .  .   :     .          

SPIKE_BCHK9      KGDGMCTNFDVNLHVAHLINRDLLVSYFNNGSVANAADCADSAAEELYCVTGSFDPPTGV
SPIKE_CVHSA      WG-----TSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGI
SPIKE_BCHK3      FL-----PESAAYYVGNLKYSTFMLRFNENGTITDAVDCSQNPLAELKCTIKNFNVDKGI
SPIKE_BC279      FL-----PESAAYYVGNLKYTTFMLSFNENGTITDAVDCSQNPLAELKCTIKNFNVSKGI
SPIKE_BCRP3      FL-----PESAAYYVGNLKYTTFMLSFNENGTITNAIDCAQNPLAELKCTIKNFNVSKGI
SPIKE_CVHN1      TD-----NETLQYWVTPLSKRQYLLKFDNRGVITNAVDCSSSFFSEIQCKTKSLLPNTGV
SPIKE_CVHN5      TD-----NETLEYWVTPLSRRQYLLNFDEHGVITNAVDCSSSFLSEIQCKTQSFAPNTGV
SPIKE_CVHN2      TD-----NETLEYWVTPLSRRQYLLNFDEHGVITNAVDCSSSFLSEIQCKTQSFAPNTGV
SPIKE_CVRSD      -------VSSPQYWVTPLVKRQYLFNFNQKGIITSAVDCASSYTSEIKCKTQSMNPNTGV
SPIKE_CVMA5      -------TFAPRYWVTPLVKRQYLFNFNQKGVITSAVDCASSYTSEIKCKTQSMLPSTGV
SPIKE_CVMJC      -------TLLPLYWVTPLLKRQYLFNFNEKGVITSAVDCASSYISEIKCKTQSLLPSTGV
SPIKE_CVM4       -------TLLPLYWVTPLLKRQYLFNFNEKGVITSAVDCASSYISEIKCKTQSLLPSTGV
SPIKE_CVMJH      -------TLAPLYWVTPLLKRQYLFNFNEKGVITSAVDCASSYISEIKCKTQSLLPSTGV
SPIKE_CVP67      --------LSLEYWVTPLTTRQFLLAFDQDGVLYHAVDCASDFMSEIMCKTSSITPPTGV
SPIKE_CVPIA      --------LSLEYWVTPLTTRQFLLAFDQDGVLYHAVDCASDFMSEIMCKTSSITPPTGV
SPIKE_CVHOC      --------LTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGV
SPIKE_CVBLS      --------LTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBOK      --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBEN      --------LTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBLU      --------LTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBM       --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBQ       --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBL9      --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBV       --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBF       --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVBLY      --------MTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTLSIAPSTGV
SPIKE_CVEMC      R------KAWAAFYVYKLQPLTFLLDFSVDGYIRRAIDCGFNDLSQLHCSYESFDVESGV
SPIKE_BCHK5      R------KAWAAFYIYKLHPLTYLLNFDVEGYITKAVDCGYDDLAQLQCSYESFEVETGV
SPIKE_BC133      R------EAWAAFYVYKLHQLTYLLDFSVDGYIRRAIDCGHDDLSQLHCSYTSFEVDTGV
SPIKE_BCHK4      R------EAWAAFYVYKLHQLTYLLDFSVDGYIRRAIDCGHDDLSQLHCSYTSFEVDTGV
                               :  *     :. :   * :  * **  .   :: *   .:   .*:

SPIKE_BCHK9      YPLSRYRAQVAGFV--RVTQRGSYCT-PPYSVLQDPPQPVVWRRYMLYDCVFDFTVVVDS
SPIKE_CVHSA      YQTSNFRVVPSGDVVRF-PNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNS
SPIKE_BCHK3      YQTSNFRVSPTQEVIRF-PNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNS
SPIKE_BC279      YQTSNFRVTPTQEVVRF-PNITNRCPFDKVFNASRFPNVYAWERTKISDCVADYTVLYNS
SPIKE_BCRP3      YQTSNFRVSPTQEVIRF-PNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNS
SPIKE_CVHN1      YDLSGFTVKPVATVHRRIPDLPD-CDIDKWLNNFNVPSPLNWERKIFSNCNFNLSTLLRL
SPIKE_CVHN5      YDLSGFTVKPVATVYRRIPNLPD-CDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRL
SPIKE_CVHN2      YDLSGFTVKPVATVYRRIPNLPD-CDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRL
SPIKE_CVRSD      YDLSGYTVQPVGLVYRRVRNLPD-CKIEEWLAANTVPSPLNWERKTFQNCNFNLSSLLRF
SPIKE_CVMA5      YELSGYTVQPVGVVYRRVANLPA-CNIEEWLTARSVPSPLNWERKTFQNCNFNLSSLLRY
SPIKE_CVMJC      YDLSGYTVQPVGVVYRRVPNLPD-CKIEEWLTAKSVPSPLNWERRTFQNCNFNLSSLLRY
SPIKE_CVM4       YDLSGYTVQPVGVVYRRVPNLPD-CKIEEWLTAKSVPSPLNWERRTFQNCNFNLSSLLRY
SPIKE_CVMJH      YDLSGYTVQPVGVVYRRVPNLPD-CKIEEWLTAKSVPSPLNWERRTFQNCNFNLSSLLRY
SPIKE_CVP67      YELNGYTVQPVATVYRRIPDLPN-CDIEAWLNSKTVSSPLNWERKIFSNCNFNMGRLMSF
SPIKE_CVPIA      YELNGYTVQPVATVYRRIPDLPN-CDIEAWLNSKTVSSPLNWERKIFSNCNFNMGRLMSF
SPIKE_CVHOC      YELNGYTVQPIADVYRRKPNLPN-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBLS      YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBOK      YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBEN      YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBLU      YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBM       YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBQ       YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBL9      YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSCLMSF
SPIKE_CVBV       YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBF       YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVBLY      YELNGYTVQPIADVYRRIPNLPD-CNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSF
SPIKE_CVEMC      YSVSSFEAKPSGSVVEQ-AEGVE-CDFSPLLSGTP-PQVYNFKRLVFTNCNYNLTKLLSL
SPIKE_BCHK5      YSVSSFEASPRGEFIEQ-ATTQE-CDFTPMLTGTP-PPIYNFKRLVFTNCNYNLTKLLSL
SPIKE_BC133      YSVSSYEASATGTFIEQ-PNVTE-CDFSPMLTGVA-PQVYNFKRLVFSNCNYNLTKLLSL
SPIKE_BCHK4      YSVSSYEASATGTFIEQ-PNATE-CDFSPMLTGVA-PQVYNFKRLVFSNCNYNLTKLLSL
                 *  . : .     .          *           .    : *  : :*  :   :   

SPIKE_BCHK9      LPTHQLQCYGVSPRRLASMCYGSVTLDVMRINETHLNNLFNRVPDTFSLYNYALPDNFYG
SPIKE_CVHSA      TFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMG
SPIKE_BCHK3      TSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTG
SPIKE_BC279      TSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTG
SPIKE_BCRP3      TSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTG
SPIKE_CVHN1      VHTDSFSCNNFDESKIYGSCFKSIVLDKFAIPNSRRSDLQLGSSGFLQSSNYKIDTTSSS
SPIKE_CVHN5      VHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSS
SPIKE_CVHN2      VHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSS
SPIKE_CVRSD      VQAESLSCSNIDASKVYGMCFGSISIDKFAIPNSRRVDLQLGKSGLLQSFNYKIDTRATS
SPIKE_CVMA5      VQAESLFCNNIDASKVYGRCFGSISVDKFAVPRSRQVDLQLGNSGFLQTANYKIDTAATS
SPIKE_CVMJC      VQAESLSCNNIDASKVYGMCFGSVSVDKFAIPRSRQIDLQIGNSGFLQTANYKIDTAATS
SPIKE_CVM4       VQAESLSCNNIDASKVYGMCFGSVSVDKFAIPRSRQIDLQIGNSGFLQTANYKIDTAATS
SPIKE_CVMJH      VQAESLSCNNIDASKVYGMCFGSVSVDKFAIPRSRQIDLQIGNSGFLQTANYKIDTAATS
SPIKE_CVP67      IQADSFGCNNIDASRLYGMCFGSITIDKFAIPNSRKVDLQVGKSGYLQSFNYKIDTAVSS
SPIKE_CVPIA      IQADSFGCNNIDASRLYGMCFGSITIDKFAIPNSRKVDLQVGKSGYLQSFNYKIDTAVSS
SPIKE_CVHOC      IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBLS      IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBOK      IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBEN      IQAYSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBLU      IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBM       IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBQ       IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBL9      IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBV       IQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAAS
SPIKE_CVBF       IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVBLY      IQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATS
SPIKE_CVEMC      FSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPT
SPIKE_BCHK5      FQVSEFSCHQVSPSSLATGCYSSLTVDYFAYSTDMSSYLQPGSAGAIVQFNYKQDFSNPT
SPIKE_BC133      FAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPT
SPIKE_BCHK4      FAVDEFSCNGISPDSIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPT
                      : *  ..   :   *: .:  * :         :     . :   **        

SPIKE_BCHK9      CLHAFYLN-----------------------------------------STAPYAVANRF
SPIKE_CVHSA      CVLAWNTRNIDATSTG------NYNYKYRYLRH------GKLRPFERDISNVPFSPDGK-
SPIKE_BCHK3      CVIAWNTAKHD-----------TGNYYYRSHRK------TKLKPFERDLSS---------
SPIKE_BC279      CVIAWNTAQQD-----------QGQYYYRSYRK------EKLKPFERDLS----------
SPIKE_BCRP3      CVIAWNTAKQD-----------QGQYYYRSHRK------TKLKPFERDLS----------
SPIKE_CVHN1      CQLYYSLPAINVTINNYNPSSWNRRYGFNN---------FNLSSHSVVYSRYCFSVNNTF
SPIKE_CVHN5      CQLYYSLPLVNVTINNFNPSSWNRRYGFGS---------FNLSSYDVVYSDHCFSVNSDF
SPIKE_CVHN2      CQLYYSLPLVNVTINNFNPSSWNRRYGFGS---------FNVSSYDVVYSDHCFSVNSDF
SPIKE_CVRSD      CQLYYSLAQDNVTVINHNPSSWNRRYGFNDVAT------FHSGEHDVAYAEACFTVGASY
SPIKE_CVMA5      CQLHYTLPKNNVTINNHNPSSWNRRYGFNDAGV------FGKNQHDVVYAQQCFTVRSSY
SPIKE_CVMJC      CQLYYSLPKNNVTINNYNPSSWNRRYGFNDAGV------FGKSKHDVAYAQQCFIVRPSY
SPIKE_CVM4       CQLYYSLPKNNVTINNYNPSSWNRRYGFNDAGV------FGKSKHDVAYAQQCFTVRPSY
SPIKE_CVMJH      CQLYYSLPKNNVTINNYNPSSWNRRYGFK-------------------------------
SPIKE_CVP67      CQLYYSLPAANVSVTHYNPSSWNRRYGFNNQSF------GSRGLHDAVYSQQCFNTPNTY
SPIKE_CVPIA      CQLYYSLPAANVSVTHYNPSSWNRRYGFINQSF------GSRGLHDAVYSQQCFNTPNTY
SPIKE_CVHOC      CQLYYNLPAANVSVSRFNPSTWNKRFGFIEDSVFKPRPAGVLTNHDVVYAQHCFKAPKNF
SPIKE_CVBLS      CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNF
SPIKE_CVBOK      CQLYYNLPAANVSVSRFNPSIWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNF
SPIKE_CVBEN      CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKASTNF
SPIKE_CVBLU      CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNF
SPIKE_CVBM       CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNF
SPIKE_CVBQ       CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPKNF
SPIKE_CVBL9      CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNF
SPIKE_CVBV       CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNF
SPIKE_CVBF       CQLYYNLPAANVSLSRFNPSIWNRRFGFTEQSVFKPQPVGVFTDHDVVYAQHCFKAPTNF
SPIKE_CVBLY      CQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTDHDVVYAQHCFKAPTNF
SPIKE_CVEMC      CLILATVPHNLTTITK------PLKYSYINKC-------SRFLSDDRT-EVPQLVNANQY
SPIKE_BCHK5      CRVLATVPQNLTTITK------PSNYAYLTEC-------YKTSAYGKNY---LYNAPGAY
SPIKE_BC133      CRVMASVP-DNVTITK------PGAYGYISKC-------SRLTGVNQDIETPLYINPGEY
SPIKE_BCHK4      CRVMASVL-ANVTITK------PHAYGYISKC-------SRLTGANQDVETPLYINPGEY
                 *                                                           

SPIKE_BCHK9      ----------------------PIKPGGRQSNSAFIDTV---------------------
SPIKE_CVHSA      -PCTP-----------------PALNCYWPLNDYGFYTT---------------------
SPIKE_BCHK3      ----------------------DDGNGVYTLSTYDFNPN---------------------
SPIKE_BC279      ----------------------SDENGVYTLSTYDFYPS---------------------
SPIKE_BCRP3      ----------------------SDENGVRTLSTYDFYPS---------------------
SPIKE_CVHN1      CPCAKPSFASSCKSH-------KPPSASCPIGTNYRSCE--------STTVLDHTDWCRC
SPIKE_CVHN5      CPCADPSVVNSCAKS-------KPPSAICPAGTKYRHCD--------LDTTLYVKNWCRC
SPIKE_CVHN2      CPCADPSVVNSCVKS-------KPLSAICPAGTKYRHCD--------LDTTLYVNNWCRC
SPIKE_CVRSD      CPCAKPSTVYSCVTG-------KPKSANCPTGTSNRECN---------VQASGFKSKCDC
SPIKE_CVMA5      CPCAQ-----------------PDIVSPCTTQTKPKSAF---------------------
SPIKE_CVMJC      CPCAQPDIVSACTSQT------KPMSAYCPTGTIHRECSLWNGPHLRSARVGSGTYTCEC
SPIKE_CVM4       CPCAQPDIVSACTSQT------KPMSAYCPTGTIHRECSLWNGPHLRSARVGSGTYTCEC
SPIKE_CVMJH      ------------------------------------------------------------
SPIKE_CVP67      CPCRT--SQCIGG----------AGTGTCPVGTTVRKCFA----------AVTKATKCTC
SPIKE_CVPIA      CPCRT--SQCIGG----------AGTGTCPVGTTVRKCFA----------AVTNATKCTC
SPIKE_CVHOC      CPCKLNGS-CVGSGPG-----KNNGIGTCPAGTNYLTCD--------------N------
SPIKE_CVBLS      CPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCH--------------NAAQCGC
SPIKE_CVBOK      CPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCH--------------NAAQCGC
SPIKE_CVBEN      CPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCH--------------NAAQCDC
SPIKE_CVBLU      CPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCH--------------NAAQCDC
SPIKE_CVBM       CPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH--------------NAAQCNC
SPIKE_CVBQ       CPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH--------------NAAQCDC
SPIKE_CVBL9      CPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH--------------NAAQCDC
SPIKE_CVBV       CPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH--------------NAAQCDC
SPIKE_CVBF       CPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH--------------NAAQCNC
SPIKE_CVBLY      CPCKLDGSLCVGSGSGIDAGYKNSGIGTCPAGTNYLTCH--------------NAAQCDC
SPIKE_CVEMC      SPCVS-----------------IVPSTVWEDGDYYRKQL---------------------
SPIKE_BCHK5      TPCLS-----------------LASRGFSTKYQSHSDGE---------------------
SPIKE_BC133      SICRD-----------------FAPLGFSEDGQVFKRTL---------------------
SPIKE_BCHK4      SICRD-----------------FSPGGFSEDGQVFKRTL---------------------
                                                                             

SPIKE_BCHK9      -----------------------INAAHYSP-----------------------------
SPIKE_CVHSA      -----------------------TGIGYQPY-----------------------------
SPIKE_BCHK3      -----------------------VPVAYQAT-----------------------------
SPIKE_BC279      -----------------------IPVEYQAT-----------------------------
SPIKE_BCRP3      -----------------------VPVAYQAT-----------------------------
SPIKE_CVHN1      SCLPDPITA--YDPRSCSQKKSLVGVGEHCAGFGVDEEKCGVLDGSYNVSCLCSTDAFLG
SPIKE_CVHN5      SCLPDPIST--YSPNTCPQKKVVVGIGEHCPGLGINEEKCG--TQLNHSSCFCSPDAFLG
SPIKE_CVHN2      SCLPDPIST--YSPNTCPQKKVVVGIGEHCPGLGINEEKCG--TQLNHSSCSCSPDAFLG
SPIKE_CVRSD      TCNPSPLT---TYDPRCLQARSMLGVGDHCEGLGILEDKCG-----GSNICNCSADAFVG
SPIKE_CVMA5      -----------------------VNVGDHCEGLGVLEDNCG--NADPHKGCICANNSFIG
SPIKE_CVMJC      TCKPNPFD---TYDLRCGQIKTIVNVGDHCEGLGVLEDKCG--NSDPHKGCSCAHDSFIG
SPIKE_CVM4       TCKPNPFD---TYDLRCGQIKTIVNVGDHCEGLGVLEDKCG--NSDPHKGCSCANDSFIG
SPIKE_CVMJH      ------------------------------------------------------------
SPIKE_CVP67      WCQPDPSTYKGVNAWTCPQSKVSIQPGQHCPGLGLVEDDCS--GNP----CTCKPQAFIG
SPIKE_CVPIA      WCQPDPSTYKGVNAWTCPQSKVSIQPGQHCPGLGLVEDDCS--GNP----CTCKPQAFIG
SPIKE_CVHOC      LCTPDPITF--TGTYKCPQTKSLVGIGEHCSGLAVKSDYCG--GNS----CTCRPQAFLG
SPIKE_CVBLS      LCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CSCQPQAFLG
SPIKE_CVBOK      LCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CSCRPQAFLG
SPIKE_CVBEN      LCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDHCG--GNP----CTCQPQAFLG
SPIKE_CVBLU      LCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDHCG--GNP----CTCQPQAFLG
SPIKE_CVBM       LCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CTCQPQAFLG
SPIKE_CVBQ       LCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CTCQPQAFLG
SPIKE_CVBL9      LCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CTCQPQAFLG
SPIKE_CVBV       LCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CTCQPQAFLG
SPIKE_CVBF       LCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CTCQPQAFLG
SPIKE_CVBLY      LCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCG--GNP----CTCQPQAFLG
SPIKE_CVEMC      --------------SPLEGGGWLVASGSTVA-----------------------------
SPIKE_BCHK5      ----------------------LTTTGYIYP-----------------------------
SPIKE_BC133      --------------TQFEGGGLLIGVGTRVP-----------------------------
SPIKE_BCHK4      --------------TQFEGGGLLIGVGTRVP-----------------------------
                                                                             

SPIKE_BCHK9      -------FSYVYGLAVITLKPAAGSKLVCP---VANDTVVITDR---CVQYNLYGYTGTG
SPIKE_CVHSA      ----------RVVVLSFELLNA--PATVCGPKL---STDLIKNQ---CVNFNFNGLTGTG
SPIKE_BCHK3      ----------RVVVLSFELLNA--PATVCGPKL---STELVKNQ---CVNFNFNGLKGTG
SPIKE_BC279      ----------RVVVLSFELLNA--PATVCGPKL---STQLVKNQ---CVNFNFNGLRGTG
SPIKE_BCRP3      ----------RVVVLSFELLNA--PATVCGPKL---STQLVKNQ---CVNFNFNGLKGTG
SPIKE_CVHN1      WSYDTCVSNNRCNIFSNFILNGINSGTTCSNDLLQPNTEVFTDV---CVDYDLYGITGQG
SPIKE_CVHN5      WSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEISTGV---CVNYDLYGITGQG
SPIKE_CVHN2      WSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEVSTGV---CVNYDLYGITGQG
SPIKE_CVRSD      WAMDSCLSNARCHIFSNLMLNGINSGTTCSTDFQLPNTEVVTGV---CVKYDLYGSTGQG
SPIKE_CVMA5      WSHDTCLVNDRCQIFANILLNGINSGTTCSTDLQLPNTEVVTGI---CVKYDLYGITGQG
SPIKE_CVMJC      WSHDTCLVNDHSQIFANILLNGINSGTTCSTDLQLPNTEVATGV---CVRYDLYGITGQG
SPIKE_CVM4       WSHDTCLVNDRCQIFANILLNGINSGTTCSTDLQLPNTEVATGV---CVRYDLYGITGQG
SPIKE_CVMJH      -------VNDRCQIFANILLNGINSGTTCSTDLQLPNTEVATGV---CVRYDLYGITGQG
SPIKE_CVP67      WSSETCLQNGRCNIFANFILNDVNSGTTCSTDLQQGNTIITTDV---CVNYDLYGITGQG
SPIKE_CVPIA      WSSETCLQNGRCNIFANFILNDVNSGTTCSTDLQQGNTNITTDV---CVNYDLYGITGQG
SPIKE_CVHOC      WSADSCLQGDKCNIFANFILHDVNSGLTCSTDLQKANTDIILGV---CVNYDLYGILGQG
SPIKE_CVBLS      WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBOK      WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBEN      WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBLU      WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBM       WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBQ       WSVDSCLQGDRCNIFANFIFHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBL9      WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBV       WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBF       WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVBLY      WSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGV---CVNYDLYGITGQG
SPIKE_CVEMC      ------MTEQLQMGFGITVQYGTDTNSVC-PKLEFANDTKIASQLGNCVEYSLYGVSGRG
SPIKE_BCHK5      ------VTGNLQMAFIISVQYGTDTNSVC-PMQALRNDTSIEDKLDVCVEYSLHGITGRG
SPIKE_BC133      ------MTANLEMGFVISVQYGTGTDSVC-PMLDLGDSLTITNRLGKCVDYSLYGVTGRG
SPIKE_BCHK4      ------MTDNLQMSFIISVQYGTGTDSVC-PMLDLGDSLTITNRLGKCVDYSLYGVTGRG
                                   :     .  .*       .     .    ** :.: *  * *

SPIKE_BCHK9      VLSKNTSLVIPDGKVFTASSTGTIIGVS--INSTTYSIMPCVTVPVSVGY--HPNF-ERA
SPIKE_CVHSA      VLTP-SSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVA
SPIKE_BCHK3      VLTS-SSKRFQSFQQFGRDTSDFTDSVRDPQTLEILDISPCSFGGVSVITPGTNASSEVA
SPIKE_BC279      VLTT-SSKRFQSFQQFGRDTSDFTDSVRDPQTLEILDISPCSFGGVSVITPGTNASSEVA
SPIKE_BCRP3      VLTE-SSKRFQSFQQFGRDTSDFTDSVRDPQTLEILDISPCSFGGVSVITPGTNASSEVA
SPIKE_CVHN1      IFKEVSAVYYNSWQNLLYDSNGNIIGFKDFVTNKTYNIFPCYAGRVSAAF--HQNASSLA
SPIKE_CVHN5      IFKEVSAAYYNNWQNLLYDSNGNIIGFKDFLTNKTYTILPCYSGRVSAAF--YQNSSSPA
SPIKE_CVHN2      IFKEVSAAYYNNWQNLLYDSNGNIIGFKDFLTNKTYTILPCYSGRVSAAF--YQNSSSPA
SPIKE_CVRSD      VFKEVKADYYNSWQNLLYDVNGNLNGFRDIVTNKTYLLRSCYSGRVSAAY--HQDAPEPA
SPIKE_CVMA5      VFKEVKADYYNSWQTLLYDVNGNLNGFRDLTTNKTYTIRSCYSGRVSAAF--HKDAPEPA
SPIKE_CVMJC      VFKEVKADYYNSWQALLYDVNGNLNGFRDLTTNKTYTIRSCYSGRVSAAY--HKEAPEPA
SPIKE_CVM4       VFKEVKADYYNSWQALLYDVNGNLNGFRDLTTNKTYTIRSCYSGRVSAAY--HKEAPEPA
SPIKE_CVMJH      VFKEVKADYYNSWQALLYDVNGNLNGFRDLTTNKTYTIRSCYSGRVSAAY--HKEAPEPA
SPIKE_CVP67      ILIEVNATYYNSWQNLLYDSSGNLYGFRDYLSNRTFLIRSCYSGRVSAVF--HANSSEPA
SPIKE_CVPIA      ILIEVNATYYNSWQNLLYDSSGNLYGFRDYLSNRTFLIRSCYSGRVSAVF--HANSSEPA
SPIKE_CVHOC      IFVEVNATYYNSWQNLLYDSNGNLYGFRDYIINRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBLS      IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBOK      IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBEN      IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBLU      IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBM       IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBQ       IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBL9      IFVEVNAPYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBV       IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBF       IFVEANATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVBLY      IFVEVNATYYNSWQNLLYDSNGNLYGFRDYLTNRTFMIRSCYSGRVSAAF--HANSSEPA
SPIKE_CVEMC      VFQNCTAVGVRQ-QRFVYDAYQNLVGYYS-DDGNYYCLRACVSVPVSVIY--DKETKTHA
SPIKE_BCHK5      VFHNCTSVGLRN-QRFVYDTFDNLVGYHS-DNGNYYCVRPCVSVPVSVIY--DKASNSHA
SPIKE_BC133      VFQNCTAVGVKQ-QRFVYDSFDNLVGYYS-DDGNYYCVRPCVSVPVSVIY--DKSTNLHA
SPIKE_BCHK4      VFQNCTAVGVKQ-QRFVYDSFDNLVGYYS-DDGNYYCVRPCVSVPVSVIY--DKSTNLHA
                 ::   .:      : :  .      .           : .*    **.           *

SPIKE_BCHK9      LLFNGLSCSQRSRAV---TEPVSVLWSASATAQDAFDTPSGCVVNVELRNTTIVNTCAMP
SPIKE_CVHSA      VLYQDVNCTDVSTAIH--ADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSY--ECDIP
SPIKE_BCHK3      VLYQDVNCTDVPTAIR--ADQLTPAWRVYSTGVNVFQTQAGCLIGAEHVNASY--ECDIP
SPIKE_BC279      VLYQDVNCTDVPTSIH--ADQLTPAWRVYSTGVNVFQTQAGCLIGAEHVNASY--ECDIP
SPIKE_BCRP3      VLYQDVNCTDVPAAIH--ADQLTPAWRVYSTGTNVFQTQAGCLIGAEHVNASY--ECDIP
SPIKE_CVHN1      LLYRNLKCSYV-----------LNNISLTTQP--YFDSYLGCVFNADNLTDYSVSSCALR
SPIKE_CVHN5      LLYRNLKCSYV-----------LNNISFISQPF-YFDSYLGCVLNAVNLTSYSVSSCDLR
SPIKE_CVHN2      LLYRNLKCSYV-----------LNNISFISQPF-YFDSYLGCVLNAVNLTSYSVSSCDLR
SPIKE_CVRSD      LLYRNLKCDYV----------FNNNISREETPLNYFDSYLGCVINADNSTEQSVDACDLR
SPIKE_CVMA5      LLYRNINCSYV----------FSNNISREENPLNYFDSYLGCVVNADNRTDEALPNCDLR
SPIKE_CVMJC      LLYRNINCSYV----------FTNNISREENPLNYFDSYLGCVVNADNRPDEALPNCDLR
SPIKE_CVM4       LLYRNINCSYV----------FTNNISREENPLNYFDSYLGCVVNADNRTDEALPNCDLR
SPIKE_CVMJH      LLYRNINCSYV----------FTNNISREENPLNYFDSYLGCVVNADNRTDEALPNCNLR
SPIKE_CVP67      LMFRNLKCSHV----------FNNTILRQIQLVNYFDSYLGCVVNAYNNTASAVSTCDLT
SPIKE_CVPIA      LMFRNLKCSHV----------FNYTILRQIQLVNYFDSYLGCVVNAYNNTASAVSTCDLT
SPIKE_CVHOC      LLFRNIKCNYV----------FNNSLTRQLQPINYFDSYLGCVVNAYNSTAISVQTCDLT
SPIKE_CVBLS      LLFRNFKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBOK      LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBEN      LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBLU      LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBM       LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBQ       LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBL9      LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBV       LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSVVQTCDLT
SPIKE_CVBF       LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTASAVQTCDLT
SPIKE_CVBLY      LLFRNIKCNYV----------FNNTLSRQLQPINYFDSYLGCVVNADNSTSSAVQTCDLT
SPIKE_CVEMC      TLFGSVACEHISSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVN-SSLFVEDCKLP
SPIKE_BCHK5      TLFGSVACSHVTTMMSQFSRMTKTNLLARTTP-GPLQTTVGCAMGFIN-SSMVVDECQLP
SPIKE_BC133      TLFGSVACEHVTTMMSQFSRLTQSNLRRRDSNT-PLQTAVGCVIGLSN-NSLVVSDCKLP
SPIKE_BCHK4      TLFGSVACEHVTTMMSQFSRLTQSNLRRRDSNI-PLQTAVGCVIGLSN-NSLVVSDCKLP
                  :: .. *                           :::  ** ..           * : 

SPIKE_BCHK9      IGNSLCFING-----SIATANADSLPRLQLVNYDPLYDNSTATPMTPV---YWVKVPTNF
SPIKE_CVHSA      IGAGICASYHTVS--LLRSTSQKSIVAYTMSLGADSSIAYSNNTI---------AIPTNF
SPIKE_BCHK3      IGAGICASYHTAS--VLRSTGQKSIVAYTMSLGAENSIAYANNSI---------AIPTNF
SPIKE_BC279      IGAGICASYHTAS--VLRSTGQKSIVAYTMSLGAENSIAYANNSI---------AIPTNF
SPIKE_BCRP3      IGAGICASYHTAS--TLRSVGQKSIVAYTMSLGAENSIAYANNSI---------AIPTNF
SPIKE_CVHN1      MGSGFCVDYNSPSSSSSRRKRRSISASYRFVTFEPFNVSFVNDSIESVGGLYEIKIPTNF
SPIKE_CVHN5      MGSGFCIDYALP---SSRRKRRGISSPYRFVTFEPFNVSFVNDSVETVGGLFEIQIPTNF
SPIKE_CVHN2      MGSGFCIDYALP---SSRRKRRGISSPYRFVTFEPFNVSFVNDSVETVGGLFEIQIPTNF
SPIKE_CVRSD      MGSGLCVNYS-----IAHRARRSVSTGYKLTTFEPFTVSIVNDSVESVGGLYEMQIPTNF
SPIKE_CVMA5      MGAGLCVDYS-----KSRRAHRSVSTGYRLTTFEPYTPMLVNDSVQSVDGLYEMQIPTNF
SPIKE_CVMJC      MGAGLCVDYS-----KSRRARRSVSTGYRLTTFEPYMPMLVNDSVQSVGGLYEMQIPTNF
SPIKE_CVM4       MGAGLCVDYS-----KSRRARRSVSTGYRLTTFEPYMPMLVNDSVQSVGGLYEMQIPTNF
SPIKE_CVMJH      MGAGLCVDYS-----KSRRARRSVSTGYRLTTFEPYMPMLVNDSVQSVGGLYEMQIPTNF
SPIKE_CVP67      VGSGYCVDYV-----TALRSRRSFTTGYRFTNFEPFAANLVNDSIEPVGGLYEIQIPSEF
SPIKE_CVPIA      VGSGYCVDYV-----TALRSRRSFTTGYRFTNFEPFAANLVNDSIEPVGGLYEIQIPSEF
SPIKE_CVHOC      VGSGYCVDYS-----KNRRSRGAITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBLS      VGSGYCVDYS-----TKRRSRRSITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBOK      VGSGYCVDYS-----TKRRSRRSITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBEN      VGSGYCVDYS-----TKRRSRRSITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBLU      VGSGYCVDYS-----TKRRSRRSITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBM       VGSGYCVDYS-----TKRRSRRAITTGYRFTTFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBQ       VGSGYCVDYS-----TKRRSRRAITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBL9      VGSGYCVDYS-----TKRRSRRAITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBV       VGSGYCVDYS-----TKRRSRRAITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBF       VGSGYCVDYS-----TKRRSVRAITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVBLY      VGSGYCVDYS-----TKRRSRRAITTGYRFTNFEPFTVNSVNDSLEPVGGLYEIQIPSEF
SPIKE_CVEMC      LGQSLCALPDTPST-LTPRSVRSVPGEMRLASIA-FNHPIQVDQLNSSY--FKLSIPTNF
SPIKE_BCHK5      LGQSLCAIPPTTSS-RVRRATSGASDVFQIATLN-FTSPLTLAPINSTG--FVVAVPTNF
SPIKE_BC133      LGQSLCAVP------PVSMFRSYSASQFQLAVLN-YTSPIVVTPINSSG--FTAAIPTNF
SPIKE_BCHK4      LGQSLCAVP------PVSTFRSYSASQFQLAVLN-YTSPIVVTPINSSG--FTAAIPTNF
                 :* . *                       :              :          :*::*

SPIKE_BCHK9      TLSATEEYIQTTAPKITIDCARYLCGDSSRCLNVLLHYGTFCNDINKALSRVSTILDSAL
SPIKE_CVHSA      SISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNT
SPIKE_BCHK3      SISVTTEVMPVSMAKTAVDCTMYICGDSLECSNLLLQYGSFCTQLNRALTGIAIEQDKNT
SPIKE_BC279      SISVTTEVMPVSIAKTSVDCTMYICGDSLECSNLLLQYGSFCTQLNRALTGIAIEQDKNT
SPIKE_BCRP3      SISVTTEVMPVSMAKTSVDCTMYICGDSLECSNLLLQYGSFCTQLNRALSGIAIEQDKNT
SPIKE_CVHN1      TIVGQEEFIQTNSPKVTIDCSLFVCSNYAACHDLLSEYGTFCDNINSILDEVNGLLDTTQ
SPIKE_CVHN5      TIAGHEEFIQTSSPKVTIDCSAFVCSNYAACHDLLSEYGTFCDNINSILNEVNDLLDITQ
SPIKE_CVHN2      TIAGHEEFIQTSSPKVTIDCSAFVCSNYAACHDLLSEYGTFCDNINSILNEVNDLLDITQ
SPIKE_CVRSD      TIASHQEFIQTRSPKVTIDCAAFVCGDYTACRQQLVDYGSFCDNINAILGEVNNLIDTMQ
SPIKE_CVMA5      TIGHHEEFIQTRSPKVTIDCAAFVCGDNTACRQQLVEYGSFCVNVNAILNEVNNLLDNMQ
SPIKE_CVMJC      TIGHHEEFIQIRAPKVTIDCAAFVCGDNAACRQQLVEYGSFCDNVNAILNEVNNLLDNMQ
SPIKE_CVM4       TIGHHEEFIQIRAPKVTIDCAAFVCGDNAACRQQLVEYGSFCDNVNAILNEVNNLLDNMQ
SPIKE_CVMJH      TIGHHEEFIQIRAPKVTIDCAAFVCGDNAACRQQLVEYGSFCDNVNAILNEVNNLLDNMQ
SPIKE_CVP67      TIGNLEEFIQTRSPKVTIDCATFVCGDYAACRQQLAEYGSFCENINAILTEVNELLDTTQ
SPIKE_CVPIA      TIGNLEEFIQTSSPKVTIDCATFVCGDYAACRQQLAEYGSFCENINAILIEVNELLDTTQ
SPIKE_CVHOC      TIGNMVEFIQTSSPKVTIDCAAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBLS      TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBOK      TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBEN      TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBLU      TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBM       TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBQ       TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBL9      TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBV       TIGNMEEFIQTSSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBF       TIGNMEEFIQTSSPKVTIDCSAFVCGDCAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVBLY      TIGNMEEFIQISSPKVTIDCSAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQ
SPIKE_CVEMC      SFGVTQEYIQTTIQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSV
SPIKE_BCHK5      TFGVTQEFIETTIQKITVDCKQYVCNGFKKCEDLLKEYGQFCSKINQALHGANLRQDESI
SPIKE_BC133      SFSLTQEYIETSIQKVTVDCKQYVCNGFTRCEKLLVEYGQFCSKINQALHGANLRQDESV
SPIKE_BCHK4      SFSVTQEYIETSIQKVTVDCKQYVCNGFTRCEKLLVEYGQFCSKINQALHGANLRQDESV
                 ::    * :     * ::**  ::*..   * . *  ** ** .:*  *       *   

SPIKE_BCHK9      LSLVKELSIN-TRDEVTTFSFDGD---YNFTGL-MGCLGPNCGA----TTY---RSAFSD
SPIKE_CVHSA      REVFAQVKQ--MYKTPTLKYFGG----FNFSQI-LPDPLK--------PTK---RSFIED
SPIKE_BCHK3      QEVFAQVKQ--MYKTPAIKDFGG----FNFSQI-LPDPSK--------PTK---RSFIED
SPIKE_BC279      QEVFAQVKQ--MYKTPAIKDFGG----FNFSQI-LPDPSK--------PTK---RSFIED
SPIKE_BCRP3      QEVFAQVKQ--MYKTPAIKDFGG----FNFSQI-LPDPSK--------PTK---RSFIED
SPIKE_CVHN1      LHVADTLMQGVTLSSNLNTNLHFDVDNINFKSL-VGCLGPHCG-----SSS---RSFFED
SPIKE_CVHN5      LQVANALMQGVTLSSNLNTNLHSDVDNIDFKSL-LGCLGSQCG-----SSS---RSLLED
SPIKE_CVHN2      LQVANALMQGVTLSSNLNTNLHSDVDNIDFKSL-LGCLGSQCG-----SSS---RSLLED
SPIKE_CVRSD      LQVASALIQGVTLSSRLADGISGQIDDINFSPL-LGCLGSDCSEGTKAAQG---RSAIED
SPIKE_CVMA5      LQVASALMQGVTISSRLPDGISGPIDDINFSPL-LGCIGSTCAEDGNGPSAIRGRSAIED
SPIKE_CVMJC      LQVASALMQGVTISSRLPDGISGPIDDINFSPL-LGCIGSTCAEDGNGPSAMRGRSAIED
SPIKE_CVM4       LQVASALMQGVTISSRLPDGISGPIDDINFSPL-LGCIGSTCAEDGNGPSAIRGRSAIED
SPIKE_CVMJH      LQVASALMQGVTISSRLPDGISGPIDDINFSPL-LGCIGSTCAEDGNGPSAIRGRSAIED
SPIKE_CVP67      LQVANSLMNGVTLSTKIKDGINFNVDDINFSPV-LGCLGSECNR----AST---RSAIED
SPIKE_CVPIA      LQVANSLMNGVTLSTKIKDGINFNVDDINFSSV-LGCLGSECNR----AST---RSAIED
SPIKE_CVHOC      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSECSK----ASS---RSAIED
SPIKE_CVBLS      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBOK      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBEN      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBLU      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBM       LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBQ       LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSACNK----VSS---RSAIED
SPIKE_CVBL9      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBV       LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVBF       LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSECNK----VSS---RSAIED
SPIKE_CVBLY      LQVANSLMNGVTLSTKLKDGVNFNVDDINFSPV-LGCLGSDCNK----VSS---RSAIED
SPIKE_CVEMC      RNLFASVKS--SQSSPIIPGFGG---DFNLTLLEPVSISTGS------RSA---RSAIED
SPIKE_BCHK5      ANLFSSIKT--QNTQPLQAGLNG---DFNLTMLQIPQVTTGE------RKY---RSTIED
SPIKE_BC133      YSLYSNIKT--TSTQTLEYGLNG---DFNLTLLQVPQIGG--------SSY---RSAIED
SPIKE_BCHK4      YSLYSNIKT--TSTQTLEYGLNG---DFNLTLLQVPQIGGSS------SSY---RSAIED
                   :   :             .       ::. :                     ** :.*

SPIKE_BCHK9      LLYDKVRITDPGFMQSYQKCIDSQWGGSIRDLLCTQTYNGIAVLPPIVSPAMQALYTSLL
SPIKE_CVHSA      LLFNKVTLADAGFMKQYGEC--LG-DINARDLICAQKFNGLTVLPPLLTDDMIAAYTAAL
SPIKE_BCHK3      LLFNKVTLADAGFMKQYGDC--LG-DVSARDLICAQKFNGLTVLPPLLTDEMVAAYTAAL
SPIKE_BC279      LLFNKVTLADAGFMKQYGEC--LG-DISARDLICAQKFNGLTVLPPLLTDEMIAAYTAAL
SPIKE_BCRP3      LLFNKVTLADAGFMKQYGEC--LG-DISARDLICAQKFNGLTVLPPLLTDEMIAAYTAAL
SPIKE_CVHN1      LLFDKVKLSDVGFVEAYNNC--TG-GSEIRDLLCVQSFNGIKVLPPILSESQISGYTTAA
SPIKE_CVHN5      LLFNKVKLSDVGFVEAYNNC--TG-GSEIRDLLCVQSFNGIKVLPPILSETQISGYTTAA
SPIKE_CVHN2      LLFNKVKLSDVGFVEAYNNC--TG-GSEIRDLLCVQSFNGIKVLPPILSETQISGYTTAA
SPIKE_CVRSD      VLFDKVKLSDVGFVESYNNC--TG-GQEVRDLLCVQSFNGIKVLPPVLSESQISGYTAGA
SPIKE_CVMA5      LLFDKVKLSDVGFVEAYNNC--TG-GQEVRDLLCVQSFNGIKVLPPVLSESQISGYTTGA
SPIKE_CVMJC      LLFDKVKLSDVGFVEAYNNC--TG-GQEVRDLLCVQSFNGIKVLPPVLSESQISGYTAGA
SPIKE_CVM4       LLFDKVKLSDVGFVEAYNNC--TG-GQEVRDLLCVQSFNGIKVLPPVLSESQISGYTAGA
SPIKE_CVMJH      LLFDKVKLSDVGFVEAYNNC--TG-GQEVRDLLCVQSFNGIKVLPPVLSESQISGYTAGA
SPIKE_CVP67      LLFDKVKLSDVGFVQAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVPIA      LLFDKVKLSDVGFVQAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTSAA
SPIKE_CVHOC      LLFDKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYKGIKVLPPLLSENQISGYTLAA
SPIKE_CVBLS      LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVBOK      LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVBEN      LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVBLU      LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVBM       LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSVNQISGYTLAA
SPIKE_CVBQ       LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSVNQISGYTLAA
SPIKE_CVBL9      LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSVNQISGYTLAA
SPIKE_CVBV       LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSVNQISGYTLAA
SPIKE_CVBF       LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVBLY      LLFSKVKLSDVGFVEAYNNC--TG-GAEIRDLICVQSYNGIKVLPPLLSENQISGYTLAA
SPIKE_CVEMC      LLFDKVTIADPGYMQGYDDCMQQG-PASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSL
SPIKE_BCHK5      LLFNKVTIADPGYMQGYDECMQQG-PQSARDLICAQYVAGYKVLPPLYDPYMEAAYTSSL
SPIKE_BC133      LLFDKVTIADPGYMQGYDDCMKQG-PQSARDLICAQYVSGYKVLPPLYDPNMEAAYTSSL
SPIKE_BCHK4      LLFDKVTIADPGYMQGYDDCMKQG-PQSARDLICAQYVSGYKVLPPLYDPNMEAAYTSSL
                 :*:.** ::* *::: * .*       . ***:*.*   *  ****:      : **   

SPIKE_BCHK9      VGAVASSGYTFGITSAGVIPFATQLQFRLNGIGVTTQVLVENQKLIASSFNNALVNIQKG
SPIKE_CVHSA      VSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQES
SPIKE_BCHK3      VSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQES
SPIKE_BC279      VSGTATAGWTFGAGSALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQES
SPIKE_BCRP3      VSGTATAGWTFGAGSALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQES
SPIKE_CVHN1      TVAAMFPPWSAAAG----IPFSLNVQYRINGLGVTMDVLNKNQKLIATAFNNALLSIQNG
SPIKE_CVHN5      TVAAMFPPWSAAAG----VPFSLNVQYRINGLGVTMDVLNKNQKLIANAFNKALLSIQNG
SPIKE_CVHN2      TVAAMFPPWSAAAG----VPFSLNVQYRINGLGVTMDVLNKNQKLIANAFNKALLSIQNG
SPIKE_CVRSD      TASAMFPPWSAAAG----VPFALSVQYRINGLGVTMNVLSENQKMIASSFNNAIGAIQEG
SPIKE_CVMA5      TAAAMFPPWSAAAG----VPFSLSVQYRINGLGVTMNVLSENQKMIASAFNNALGAIQDG
SPIKE_CVMJC      TAAAMFPPWTAAAG----VPFSLNVQYRINGLGVTMNVLSENQKMIASAFNNALGAIQEG
SPIKE_CVM4       TAAAMFPPWTAAAG----VPFSLNVQYRINGLGVTMNVLSENQKMIASAFNNALGAIQEG
SPIKE_CVMJH      TAAAMFPPWTAAAG----VPFSLNVQYRINGLGVTMNVLSENQKMIASAFNNALGAIQEG
SPIKE_CVP67      TAASLFPPWTAAAG----VPFYLNVQYRINGLGVTMDVLSQNQKLIASAFNNALDAIQEG
SPIKE_CVPIA      TAASLFPPWTAAAG----VPFYLNVQYRINGLGVTMDVLSQNQKLIASAFNNALDSIQEG
SPIKE_CVHOC      TSASLFPPWTAAAG----VPFYLNVQYRINGLGVTMDVLSQNQKLIANAFNNALYAIQEG
SPIKE_CVBLS      TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALGAIQEG
SPIKE_CVBOK      TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALGAIQEG
SPIKE_CVBEN      TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALGAIQEG
SPIKE_CVBLU      TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALGAIQEG
SPIKE_CVBM       TSASLFPPLSAAVG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALDAIQEG
SPIKE_CVBQ       TSASLFPPLSAAVG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALDAIQEG
SPIKE_CVBL9      TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALDAIQEG
SPIKE_CVBV       TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALDAIQEG
SPIKE_CVBF       TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALDAIQEG
SPIKE_CVBLY      TSASLFPPWSAAAG----VPFYLNVQYRINGIGVTMDVLSQNQKLIANAFNNALDAIQEG
SPIKE_CVEMC      LGSIAGVGWTAGLSSFAAIPFAQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTG
SPIKE_BCHK5      LGSIAGASWTAGLSSFAAIPFAQSIFYRLNGVGITQQVLSENQKIIANKFNQALGAMQTG
SPIKE_BC133      LGSIAGAGWTAGLSSFAAIPFAQSMFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTG
SPIKE_BCHK4      LGSIAGAGWTAGLSSFAAIPFAQSMFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTG
                   .      : .      :**  .: :*:**:*:* :** :*** **. **.*:  :* .

SPIKE_BCHK9      FTETSIALSKMQDVINQHAAQLHTLVVQLGNSFGAISSSINEIFSRLEGLAANAEVDRLI
SPIKE_CVHSA      LTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLI
SPIKE_BCHK3      LSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLI
SPIKE_BC279      LTTTSTALGKLQDVVNDNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLI
SPIKE_BCRP3      LTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLI
SPIKE_CVHN1      FSATNSALAKIQSVVNSNAQALNSLLQQLFNKFGAISSSLQEILSRLDALEAQVQIDRLI
SPIKE_CVHN5      FTATNSALAKIQSVVNANAQALNSLLQQLFNKFGAISSSLQEILSRLDNLEAQVQIDRLI
SPIKE_CVHN2      FTATNSALAKIQSVVNANAQALNSLLQQLFNKFGAISSSLQEILSRLDNLEAQVQIDRLI
SPIKE_CVRSD      FDATNSALAKIQSVVNANAEALNNLLNQLSNRFGAISASLQEILSRLDALEAQAQIDRLI
SPIKE_CVMA5      FDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISASLQEILTRLEAVEAKAQIDRLI
SPIKE_CVMJC      FDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISASLQEILTRLDRVEAKAQIDRLI
SPIKE_CVM4       FDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISASLQEILTRLDAVEAKAQIDRLI
SPIKE_CVMJH      FDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISASLQEILTRLDAVEAKAQIDRLI
SPIKE_CVP67      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISASLQEILSRLDALEAKAQIDRLI
SPIKE_CVPIA      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISASLQEILSRLDALEAKAQIDRLI
SPIKE_CVHOC      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISASLQEILSRLDALEAEAQIDRLI
SPIKE_CVBLS      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBOK      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBEN      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBLU      FDATNSALVKIQAVVNANAETLNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBM       FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBQ       FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBL9      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBV       FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVBF       FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQRQIDRLI
SPIKE_CVBLY      FDATNSALVKIQAVVNANAEALNNLLQQLSNRFGAISSSLQEILSRLDALEAQAQIDRLI
SPIKE_CVEMC      FTTTNEAFHKVQDAVNNNAQALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLI
SPIKE_BCHK5      FTTTNLAFNKVQDAVNANAMALSKLAAELSNTFGAISSSISDILARLDTVEQEAQIDRLI
SPIKE_BC133      FTTSNLAFSKVQDAVNANAQALSKLASELSNTFGAISSSISDILARLDTVEQDAQIDRLI
SPIKE_BCHK4      FTTSNLAFSKVQDAVNANAQALSKLASELSNTFGAISSSISDILARLDTVEQDAQIDRLI
                 :  :  *: *:* .:* :*  * .*  :* . *****: : :*: **: :  . ::****

SPIKE_BCHK9      NGRMMVLNTYVTQLLIQASEAKAQNALAAQKISECVKAQSLRNDFCGNGTHVLSIPQLAP
SPIKE_CVHSA      TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAP
SPIKE_BCHK3      TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAP
SPIKE_BC279      TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAP
SPIKE_BCRP3      TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAP
SPIKE_CVHN1      NGRLTALNAYVSQQLSDISLVKFGAALAMEKVNECVKSQSPRINFCGNGNHILSLVQNAP
SPIKE_CVHN5      NGRLTALNAYVSQQLSDITLIKAGASRAIEKVNECVKSQSPRINFCGNGNHILSLVQNAP
SPIKE_CVHN2      NGRLTALNAYVSQQLSDITLIKAGASRAIEKVNECVKSQSPRINFCGNGNHILSLVQNAP
SPIKE_CVRSD      NGRLTALNAYVSKQLSDMTLIKVSAAQAIEKVNECVKSQSPRINFCGNGNHILSLVQNAP
SPIKE_CVMA5      NGRLTALNAYISKQLSDSTLIKVSAAQAIEKVNECVKSQTTRINFCGNGNHILSLVQNAP
SPIKE_CVMJC      NGRLTALNAYISKQLSDSTLIKFSAAQAIEKVNECVKSQTTRINFCGNGNHILSLVQNAP
SPIKE_CVM4       NGRLTALNAYISKQLSDSTLIKFSAAQAIEKVNECVKSQTTRINFCGNGNHILSLVQNAP
SPIKE_CVMJH      NGRLTALNAYISKQLSDSTLIKFSAAQAIEKVNECVKSQTTRINFCGNGNHILSLVQNAP
SPIKE_CVP67      NGRLTALNAYVSQQLSDSTLVKFSAAQAIEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVPIA      NGRLTALNAYVSQQLSDSTLVKFSAAQAIEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVHOC      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBLS      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBOK      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBEN      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBLU      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBM       NGRLTALNVYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBQ       NGRLTALNVYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBL9      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBV       NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBF       NGRFTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVBLY      NGRLTALNAYVSQQLSDSTLVKFSAAQAMEKVNECVKSQSSRINFCGNGNHIISLVQNAP
SPIKE_CVEMC      NGRLTTLNAFVAQQLVRSESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAP
SPIKE_BCHK5      NGRLTSLNAFVAQQLVRTEAAARSAQLAQDKVNECVKSQSKRNGFCGTGTHIVSFAINAP
SPIKE_BC133      NGRLTSLNAFVSQQLVRSETAARSAQLASDKVNECVKSQSKRNGFCGSGTHIVSFVVNAP
SPIKE_BCHK4      NGRLISLNAFVSQQLVRSETAARSAQLASDKVNECVKSQSKRNGFCGSGTHIVSFVVNAP
                 .**:  *:.:::: *            *  *:.*** .*: * .*** * *::*:   **

SPIKE_BCHK9      NGVLFIHYAYTPTEYAFVQTSAGLCHNG---TGYAPRQGMFVLPNNTNM-------WHFT
SPIKE_CVHSA      HGVVFLHVTYVPSQERNFTTAPAICHEG---KAYFPREGVFVFNGTS---------WFIT
SPIKE_BCHK3      HGVVFLHVTYVPSQEKNFTTAPAICHEG---KAYFPREGVFVSNGTS---------WFIT
SPIKE_BC279      HGVVFLHVTYVPSQERNFTTAPAICHEG---KAYFPREGVFVSNGTS---------WFIT
SPIKE_BCRP3      HGVVFLHVTYVPSQERNFTTAPAICHEG---KAYFPREGVFVSNGTS---------WFIT
SPIKE_CVHN1      YGLLFMHFSYKPISFKTVLVSPGLCISGD--VGIAPKQGYFIKHNDH---------WMFT
SPIKE_CVHN5      YGLLFIHFSYKPTSFKTVLVSPGLCLSGD--RGIAPKQGYFIKQNDS---------WMFT
SPIKE_CVHN2      YGLLFIHFSYKPTSFKTVLVSPGLCLSGD--RGIAPKQGYFIKQNDS---------WMFT
SPIKE_CVRSD      YGLYFIHFSYVPTSFTTVNVSPGLCISGD--RGLAPKAGYFVQDHGE---------WKFT
SPIKE_CVMA5      YGLYFIHFSYVPISFTTANVSPGLCISGD--RGLAPKAGYFVQDDGE---------WKFT
SPIKE_CVMJC      YGLCFIHFSYVPTSFKTANVSPGLCISGD--RGLAPKAGYFVQDNGE---------WKFT
SPIKE_CVM4       YGLCFIHFSYVPTSFKTANVSPGLCISGD--RGLAPKAGYFVQDNGE---------WKFT
SPIKE_CVMJH      YGLCFIHFSYVPTSFKTANVSPGLCISGD--RGLAPKAGYFVQDNGE---------WKFT
SPIKE_CVP67      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--IGISPKSGYFINVNNS---------WMFT
SPIKE_CVPIA      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--IGISPKSGYFINVNNS---------WMFT
SPIKE_CVHOC      YGLYFIHFSYVPTKYVTARVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMYT
SPIKE_CVBLS      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBOK      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBEN      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBLU      YGLYFIHFSYVPTKYVTAKVSPGLCIAGG--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBM       YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBQ       YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBL9      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBV       YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBF       YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVBLY      YGLYFIHFSYVPTKYVTAKVSPGLCIAGD--RGIAPKSGYFVNVNNT---------WMFT
SPIKE_CVEMC      NGLYFMHVGYYPSNHIEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDE----WSYT
SPIKE_BCHK5      NGLYFFHVGYQPTSHVNATAAYGLCNTENPQKCIAPIDGYFVLNQTTSTVADSDQQWYYT
SPIKE_BC133      NGFYFFHVGYVPTNYTNVTAAYGLCNHNNPPLCIAPIDGYFITNQTTTYSVDTE--WYYT
SPIKE_BCHK4      NGFYFFHVGYVPTNYTNVTAAYGLCNNNNPPLCIAPIDGYFITNQTTTYSVDTE--WYYT
                  *. *:*  * * .      : .:*          *  * *:              *  *

SPIKE_BCHK9      TMQFYNPVNISASNTQVLTSCSVNYTSVNYTVLEPSVPGDY--DFQKEFDKFYKNLSTIF
SPIKE_CVHSA      QRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELD--SFKEELDKYFKNHTSPD
SPIKE_BCHK3      QRNFYSPQLITTDNTFVSGNCDVVIGIINNTVYDPLQPELD--SFKEELDKYFKNHTSPD
SPIKE_BC279      QRNFYSPQIITTDNTFVAGNCDVVIGIINNTVYDPLQPELD--SFKEELDKYFKNHTSPD
SPIKE_BCRP3      QRNFYSPQIITTDNTFVAGSCDVVIGIINNTVYDPLQPELD--SFKEELDKYFKNHTSPD
SPIKE_CVHN1      GSSYYYPEPISDKNVVFMNTCSVNFTKAPLVYLNHSVPKLS--DFESELSHWFKNQTSIA
SPIKE_CVHN5      GSSYYYPEPISDKNVVFMNSCSVNFTKAPFIYLNNSIPNLS--DFEAELSLWFKNHTSIA
SPIKE_CVHN2      GSSYYYPEPISDKNVVFMNSCSVNFTKAPFIYLNNSIPNLS--DFEAEFSLWFKNHTSIA
SPIKE_CVRSD      GSNYYYPESITDKNSVVMSSCAVNYTKAPEVFLNTSITNLP--DFKEELDKWFKNQTSIV
SPIKE_CVMA5      GSSYYYPEPITDKNSVIMSSCAVNYTKAPEVFLNTSIPNPP--DFKEELDKWFKNQTSIA
SPIKE_CVMJC      GSNYYYPEPITDKNSVVMISCAVNYTKAPEVFLNNSIPNLP--DFKEELDKWFKNQTSIA
SPIKE_CVM4       GSNYYYPEPITDKNSVVMISCAVNYTKAPEVFLNNSIPNLP--DFKEELDKWFKNQTSIA
SPIKE_CVMJH      GSNYYYPEPITDKNSVAMISCAVNYTKAPEVFLNNSIPNLP--DFKEELDKWFKNQTSIA
SPIKE_CVP67      GSSYYYPEPITQNNVVVMSTCAVNYTKAPDLMLNTSTPNLP--DFKEELYQWFKNQSSVA
SPIKE_CVPIA      GSGYYYPEPITQNNVVVMSTCAVNYTKAPDLMLNTSTPNLP--DFKEELYQWFKNQSSLA
SPIKE_CVHOC      GSGYYYPEPITENNVVVMSTCAVNYTKAPYVMLNTSIPNLP--DFKEELDQWFKNQTSVA
SPIKE_CVBLS      GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLP--DFKEELDQWFKNQTSVA
SPIKE_CVBOK      GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLP--DFKEELDQWFKNQTSVA
SPIKE_CVBEN      GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLP--YFKEELDQWFKNQTSVA
SPIKE_CVBLU      GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLP--DFKEELDQWFKNQTSVA
SPIKE_CVBM       GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLH--DFKEELDQWFKNQTSVA
SPIKE_CVBQ       GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLH--DFKEELDQWFKNQTSVA
SPIKE_CVBL9      GSGYYYPEPITGNNVVVMSTCAANYTKAPDVMLNISTPNLH--DFKEELDQWFKNQTSVA
SPIKE_CVBV       GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLH--DFKEELDQWFKNQTSVA
SPIKE_CVBF       GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLP--DFKEELDQWFKNQTSVA
SPIKE_CVBLY      GSGYYYPEPITGNNVVVMSTCAVNYTKAPDVMLNISTPNLP--DFKEELDQWFKNQTSVA
SPIKE_CVEMC      GSSFYAPEPITSLNTKYVAP-QVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSI
SPIKE_BCHK5      GSSFFHPEPITEANSKYVSM-DVKFENLTNRLPPPLLSNSTDLDFKEELEEFFKNVSSQG
SPIKE_BC133      GSSFFKPEPITQANSRYVSS-DVKFEKLENNLPPPLLENSTDVDFKDELEEFFKNVTSHG
SPIKE_BCHK4      GSSFYKPEPITQANSRYVSS-DVKFDKLENNLPPPLLENSTDVDFKDELEEFFKNVTSHG
                    :: *  *:  *        .                     *: *:  ::** ::  

SPIKE_BCHK9      NNTF-NPNDFNFSTVDVTAQIKSLHDVVNQLNQSFIDLKKLNVYEKTIKWPWYVWLAMIA
SPIKE_CVHSA      VDLG-DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIA
SPIKE_BCHK3      VDLG-DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIA
SPIKE_BC279      VDLG-DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIA
SPIKE_BCRP3      VDLG-DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIA
SPIKE_CVHN1      PNLTLNLHTINATFLDLYYEMNLIQESIKSLNNSYINLKDIGTYEMYVKWPWYVWLLISF
SPIKE_CVHN5      PNLTFNSH-INATFLDLYYEMNVIQESIKSLNSSFINLKEIGTYEMYVKWPWYIWLLIVI
SPIKE_CVHN2      PNLTFNSH-INATFLDLYYEMNVIQESIKSLNSSFINLKEIGTYEMYVKWPWYIWLLIVI
SPIKE_CVRSD      PDLSFDIGKLNVTFLDLSYEMNRIQDAIKNLNESYINLKEIGTYEMYVKWPWYVWLLIGL
SPIKE_CVMA5      PDLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKEVGTYEMYVKWPWYVWLLIGL
SPIKE_CVMJC      PDLSLDFEKLNVTFLDLTYEMNRIQDAIKKLNESYINLKEVGTYEMYVKWPWYVWLLIGL
SPIKE_CVM4       PDLSLDFEKLNVTFLDLTYEMNRIQDAIKKLNESYINLKEVGTYEMYVKWPWYVWLLIGL
SPIKE_CVMJH      PDLSLDFEKLNVTFLDLTYEMNRIQDAIKKLNESYINLKEVGTYEMYVKWPWYVWLLIGL
SPIKE_CVP67      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGL
SPIKE_CVPIA      PDLSFDY--INVTFLDLQDEMNRLQEAIKVLNHSYINLKDIGTYEYYVKWPWYVWLLICL
SPIKE_CVHOC      PDLSLDY--INVTFLDLQVEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLICL
SPIKE_CVBLS      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBOK      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBEN      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBLU      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBM       PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBQ       PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBL9      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBV       PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBF       PDLSLDY--INVTFLDLQDEMNRLQEAIKLLNQSYINLKDIGTYEYYVKWPWYVWLLIGF
SPIKE_CVBLY      PDLSLDY--INVTFLDLQDEMNRLQEAIKVLNQSYINLKDIGTYEYYVKWPWYVWLLIGL
SPIKE_CVEMC      PNFG-SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIA
SPIKE_BCHK5      PNFQ-EISKINTTLLNLNTELMVLSEVVKQLNESYIDLKELGNYTFYQKWPWYIWLGFIA
SPIKE_BC133      PNFA-EISKINTTLLDLSDEMAILQEVVKQLNDSYIDLKELGNYTYYNKWPWYIWLGFIA
SPIKE_BCHK4      PNFA-EISKINTTLLDLSDEMAMLQEVVKQLNDSYIDLKELGNYTYYNKWPWYVWLGFIA
                  :   .   :* : :::  ::  : :  : ** * *:*:.:. *    *****:** :  

SPIKE_BCHK9      GIVGLVLAVIMLMCMTNCCSCFKGMCDCRRCCGSYDSYDDVYPAVRVNKKRTV
SPIKE_CVHSA      GLIAIVMVTILLCCMTSCCSCLKGACSCGSCC-KFDEDDS-EPVLKGVKLHYT
SPIKE_BCHK3      GLIAIVMVTILLCCMTSCCSCLKGACSCGSCC-KFDEDDS-EPVLKGVKLHYT
SPIKE_BC279      GLIAIVMVTILLCCMTSCCSCLKGACSCGSCC-KFDEDDS-EPVLKGVKLHYT
SPIKE_BCRP3      GLIAIVMVTILLCCMTSCCSCLKGACSCGSCC-KFDEDDS-EPVLKGVKLHYT
SPIKE_CVHN1      SFIIFLVLLFFICCCTGCGSACFS--KCHNCCDEYGGHHD-FVI---KTSHDD
SPIKE_CVHN5      LFIIFLMILFFICCCTGCGSACFS--KCHNCCDEYGGHND-FVI---KASHDD
SPIKE_CVHN2      LFIIFLMILFFICCCTGCGSACFS--KCHNCCDEYGGHND-FVI---KASHDD
SPIKE_CVRSD      AGVAVCVLLFFICCCTGCGSCCFK--KCGNCCDEYGGRQA-GIVIHNISSHED
SPIKE_CVMA5      AGVAVCVLLFFICCCTGCGSCCFK--KCGNCCDEYGGHQD-SIVIHNISSHED
SPIKE_CVMJC      AGVAVCVLLFFICCCTGCGSCCFR--KCGSCCDEYGGHQD-SIVIYNISAHED
SPIKE_CVM4       AGVAVCVLLFFICCCTGCGSCCFR--KCGSCCDEYGGHQD-SIVIHNISAHED
SPIKE_CVMJH      AGVAVCVLLFFICCCTGCGSCCFR--KCGSCCDEYGGHQD-SIVIHNISAHED
SPIKE_CVP67      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-FVI---KTSHDD
SPIKE_CVPIA      AGVVMLVLLFFICCCTGCGTSCFK--KCGGCFDDYTGHQE-FVI---KTSHDD
SPIKE_CVHOC      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGYQE-LVI---KTSHDD
SPIKE_CVBLS      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBOK      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBEN      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-LVI---KTSHED
SPIKE_CVBLU      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-LVI---KTSHED
SPIKE_CVBM       AGVAMLVLLFFICCCTGCGTSCFK--ICGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBQ       AGVAMLVLLFFICCCTGCGTSCFK--ICGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBL9      AGVAMLVLLFFICCCTGCGTSCFK--ICGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBV       AGVAMLVLLFFICCCTGCGTSCFK--ICGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBF       AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVBLY      AGVAMLVLLFFICCCTGCGTSCFK--KCGGCCDDYTGHQE-LVI---KTSHDD
SPIKE_CVEMC      GLVALALCVFFILCCTGCGTNCMGKLKCNRCCDRYEEYDL-EP----HKVHVH
SPIKE_BCHK5      GLVALALCVFFILCCTGCGTSCLGKLKCNRCCDSYDEYEV-E------KIHVH
SPIKE_BC133      GLVALLLCVFFLLCCTGCGTSCLGKMKCKNCCDSYEEYDV-E------KIHVH
SPIKE_BCHK4      GLVALLLCVFFLLCCTGCGTSCLGKMKCKNCCDSYEEYDV-E------KIHVH
                   : . :  ::: * *.* :       *  *   :               .