CLUSTAL format seed alignment for MF_04103

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BP07_BPT4             MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLG
G0YKE0_9CAUD          MTVKAPTVTSLTVSKLSANSLQLTWDDVGENFYYLVEMTKTRDLG-------EATWVSLG
Q7Y4Y0_BPR69          MTVKAPAVTSLRLSKLSANQVQIRWDEVGANFYYFVEIAETKTANGEAIPRNSYRWTNLG
E5EYT6_9CAUD          MIVKAPYVTSLEISKLSANHVEITWDDVGSNFFYFVEITETRNDI-------GIQWVNLG
A0A097BX10_9CAUD      MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTDSGENLPSDQYRWINLG
E3SEX0_9CAUD          MTVKAPSVTSLRIDKLSANQVSIKWDDVGSNFYYFVEIAQITENG-VRIPTRDLIWRDLG
A0A0A0YP99_9CAUD      MTVKAPSVTSLRIVKLSANHVYIKWDDVGANFYYFVELAETRDIMGNNIPPSNYQWRKLG
K7NRD1_9CAUD          -MIKAPSITSLRVDKLAANFVYLKWDDVGMDFYYVVELARSRDMDGTIIPDEELIWTQLG
Q19CN3_9CAUD          MIIKAPAVTSLKIKILSANQVYLTWDDVGSNFYYIVELLQTRAGY-------GTSWGQLG
C3V2E2_BPR51          MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKSNSGENLPSNQYRWINLG
I6YMI8_9CAUD          MIIKAPAVTSLKIKILSANQVYLTWDDVGSNFYYIVELLQTRAGS-------GTSWGQLG
A0A0A7HDG7_9CAUD      MSVKAPYVTSLRIDKLSANQVSIKWDNVGANFYYFVEIAPTKENG-VAIPEENLLWRNLG
A0A0K1Y4W1_9CAUD      -MTIAPFVTSLRIHKLSANQVNIRWDDVGANFYYFVELAETRNRAGEVIPADNLSWSSLG
K4F7A5_9CAUD          -MIKAPSITSLRVDKLAANFVYLKWDSVGMDFYYVVEMAETRGVGGVTIPDEDLTWFQLG
A0A097J4Z4_BPR10      MTVKAPSATSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTDSGENLPSDQYRWINLG
E5DIG9_9CAUD          MTVKAPSVTSLRITKLSANQVQIKWDDVGANFFYFVELAETRNSNGEIILPENYQWRNLG
E5E4E4_9CAUD          MTVKAPSITSLTIAKLSATSVSLKWDEVGENFYYFVEVAKTREPG-------NISWQSLG
C4MYW0_9CAUD          -MIKAPSVTSLTIEKLSANQAYITWDDVGENFFYFVELAETRTRDGEIIPVDELSWVNLG
D9ICQ5_9CAUD          -MIKAPSITSLRVDKLAANFVYLKWDSVGMDFYYVVEMAETRGAGGAVIPDADLTWFQLG
Q06EH2_BPR32          MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKSNSGENLPSNQYRWINLG
A0A0K1LKJ5_9CAUD      MSVQAPYVTSLRIDKLSANHVSILWDDVGANFYYFVELAQTKDAG-VEIPDDRLFWRNLG
A0A0A7HCC7_9CAUD      MSVQAPYVTSLRIDKLSANHVSILWDDVGANFYYFVELAQTKDAG-VEIPDENLFWRNLG
M9V2U0_9CAUD          -MIKAPSITSLRVDKLAANFVYLKWDSVGMDFYYVVEMAETRGAGGAVIPDADLTWFQLG
A0A0F6THW9_9CAUD      MTVKAPAVTSLRISKLSANQVQIRWDDVGANFYYFVEIAETKTADGEIIPPASYRWINLG
J7KIE4_9CAUD          MIIKAPAVTSLKIKILSANQVYLTWDDVGSNFYYIVELLQTRAES-------GTSWGQLG
J7I4F7_9CAUD          MIIKAPAVTSLKIKILSANQVYLTWDDVGSNFYYIVELLQTRAGS-------GTSWGQLG
A0A0K1LN09_9CAUD      MTVKAPSVTSLRIVKLSANHVYIKWDDVGANFYYFVELAETRDMMGNIIPPSNYQWRKLG
A0A0M4R4H6_9CAUD      -MIKAPSITSLRVDKLAANFVYLKWDSVGMDFYYVVEMAETRGAGGVTIPDEDLTWFQLG
A0A023ZW41_9CAUD      MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTDSGENLPSDQYRWINLG
I7J3Y4_9CAUD          -MIQAPVVTSLRIDKLSANQVSILWDDVGENFYYFVELAETRNFNGDEISPANYQWRSLG
A0A0K2FGX1_9CAUD      -MIKAPSITSLRVDKLAANFVYLKWDDVGMDFYYVVELARSRDMDGTIIPDENLIWSQLG
A0A0A0Q0S4_9CAUD      MTVKAPYVTSLRINKLSANQVSILWDNVGANFYYFVQIIQTRDAG-VPIDITNLSWRPLG
D7RMF8_9CAUD          MSVQAPSVTSLRIDKLSANHVSILWDDVGANFYYFVELAQTKDAG-ESIPDDKLFWRNLG
A0A0A0PZJ6_9CAUD      MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLG
E5EPU8_9CAUD          -MIKAPQITSLAISKLSANNLQLTWDDVGENFYYLVEMAKADTSG-------LLTWAPLG
K4IFJ4_9CAUD          MTVKAPSVTSLRIVKLSANHVHIKWDDVGANFYYFVELANTRTSEGVSLDPSRYQWRNLG
K4FK05_9CAUD          MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLG
A0A0B7MRJ1_9CAUD      -MIKAPSVTSLTIEKLSANQAYITWDDVGENFFYFVELAETRTRDGEIIPVDELSWVNLG
A0A0B6VL61_9CAUD      MTVKAPSVTSLRIDKLSANQVHIRWDNVGANFYYFVEITSTRNDA-GPLDPSKYNWRALG
Q56EM1_9CAUD          MVIKAPSVTSLKIKILSANQVYITWDDVGSNFYYIVELARTRDSS-------VINWTTLG
A0A0A7HGS7_9CAUD      MTVKAPSVTSLRIDKLSANQVSIKWDDVGSNFYYFVEIAQITENG-VHIPTRDLIWRDLG
D9I692_9CAUD          MTVQAPTITSLTITKLSANDVQIRWDNVGSNFFYLVEVTETRDPLT------GISWNQLP
F2VXL1_9CAUD          MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTDSGEKLPSNQYRWINLG
Q5QBX7_9CAUD          MSVQAPYVTSLRIDKLSANHVSILWDDVGANFYYFVELAQTKDAG-VEIPDDRLFWRNLG
A0A097J465_BPR09      MTVKAPSATSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTDSGENLPSDQYRWINLG
W6ATH0_9CAUD          MTVKAPSVTSLRITKLSANQVQIKWDDVGANFFYFVELAETRNQNGEIILPENYQWRNLG
                          **  *** :  *:*.   : **.** :*:*.*::                 *  * 

BP07_BPT4             YTANNSFFFDDAD-PLTTYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
G0YKE0_9CAUD          YTADNLWFSSDLE-ASTFYKFRVAVTSAGFEQSDWIETEEFETFDQNAYSFELMNELTLN
Q7Y4Y0_BPR69          YTADNNFFESGLN-SLTTYMMRVATAAEGFEQSDWRYTEEFETFEINAYTFQHMIEMQLA
E5EYT6_9CAUD          YTADRKYFFSDLD-PDTYYKMRVAVAAEGFEQSDWMETEEFQSFTENAYTFELMTEMSLI
A0A097BX10_9CAUD      YTANNSFFFDDAN-PLTSYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
E3SEX0_9CAUD          YTADNEWFEQEYIRPLTSYQMRVSVAAMGFERSDWEYTEEFETFATNAYTFEHMREFSLA
A0A0A0YP99_9CAUD      YVATNEYFEDTFVSPDRYYAMRVQTAAQGFDPSNWVQTEEFQMFSENAYTFETMLEMTLA
K7NRD1_9CAUD          YSYENEWFSDQ-VAPNTRYKFRIQTTHEGFEPSDWVISDELWTFDENAYAYTTMREFTPA
Q19CN3_9CAUD          VTSVEEWFEDTSIQADTYYKMRVRVSGKGFEMSDWVETEEFQTFSENAYYISAMKEFTPA
C3V2E2_BPR51          YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
I6YMI8_9CAUD          VTSVEEWFEDTSIQADTYYKMRVRVSGKGFEMSDWVETEEFQTFSENAYYISAMKEFTPA
A0A0A7HDG7_9CAUD      YTPDNEWFEQDFIRPVSFYKMRVAVAAMGFEQSDWVYTEEFETFATNAYTFEHMREFTLT
A0A0K1Y4W1_9CAUD      YTADNDWFEQNRIEPLTYYKMRVQTTSAGFEPSEWVETEEFQTFEENAYTFEHMQEFSLV
K4F7A5_9CAUD          YAYVNEWFSSD-VQPNNFYKFRVMVTHKGFEPSDWVYTDELWTFTLNAYAYSTMREFTPS
A0A097J4Z4_BPR10      YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWVYTEEFETFATNAYTFQNLIEMQLA
E5DIG9_9CAUD          YTAENEFFEDNYIRPLSYYVMRVAVAAEGFEQSNWKMTEEFQSFETNVYTFEMMREMTLS
E5E4E4_9CAUD          YTSDNFWFSSDLA-KLTYYKFRIAVGAEGFEQSDWVETEELQTFEQNAYTFELMNELTLN
C4MYW0_9CAUD          YTAEQNWFEDKNLFPEYYYKFRVAVAAEGFEQSKWIETEEFQTFKTNAYNFSMMREFNLA
D9ICQ5_9CAUD          YAYVNEWFSTA-VQPDSFYKFRIKVTHQGFEPSDWVYSDELWTFTLNAYAYSTMREFTPS
Q06EH2_BPR32          YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
A0A0K1LKJ5_9CAUD      YTPNNEWFEEAFISPNSFYKMRVAVAAQGFEQSEWVYTEEFETFSTNAYTFEHMREFTLS
A0A0A7HCC7_9CAUD      YTPNNEWFEETFISPNSFYKMRVAVAAQGFEQSEWVYTEEFETFATNAYTFEHMREFTLS
M9V2U0_9CAUD          YAYVNEWFSTA-VQPDSFYKFRIKVTHQGFEPSDWVYSDELWTFTLNAYAYSTMREFTPS
A0A0F6THW9_9CAUD      YTPNNNWFESSLD-PLTSYIIRVSTAAEGFERSDWVYTEIFESFQTNAYTFQHMIEMQLA
J7KIE4_9CAUD          VTSVEEWFEDTSIQADTYYKMRVRVSGKGFEMSDWVETEEFQTFSENAYYISAMKEFTPA
J7I4F7_9CAUD          VTSVEEWFEDTSIQADTYYKMRVRVSGKGFEMSDWVETEEFQTFSENAYYISAMKEFTPA
A0A0K1LN09_9CAUD      YVATNEYFEDTFVSPDRYYTMRVQTAAQGFDPSNWVQTEEFQMFSENAYTFETMLEMTLA
A0A0M4R4H6_9CAUD      YAFLNEWFSSD-VQPNNFYKFRVMVTHKGFEPSDWVYTDELWTFSLNAYAYSTMREFTPS
A0A023ZW41_9CAUD      YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWVYTEEFETFATNAYTFQNMIEMQLA
I7J3Y4_9CAUD          YTADNDWFEEALIRPTTYYKMRVAVAAKGFTQSLWVTTEEFQTFETNAYTFDMMNEFTMS
A0A0K2FGX1_9CAUD      YSYENEWFSDQ-VAPNTRYKFRIQTTHEGFEPSDWVISDELWTFDENAYAYTTMREFTPA
A0A0A0Q0S4_9CAUD      YTDENNWFEDQNILPNQYYKMRVAVAANGFEQSDWVETEEFQTFTVNAYTFEHMREFNLV
D7RMF8_9CAUD          YTPNNNWFEERFISPNSFYKMRVAVAAQGFEQSDWVYTEEFETFSTNAYTFEHMREFTLS
A0A0A0PZJ6_9CAUD      YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
E5EPU8_9CAUD          YTAENMWFSTDLS-PLSKYTFRISVASEGFEQSDWVYTDEFETFAQNAYAFEVMNELTLN
K4IFJ4_9CAUD          YTSENEFFESGFIRPNDYYVMRVSVAAQGFERSNWVQTEEFQTFLTNAYTFQSMLEMTLA
K4FK05_9CAUD          YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
A0A0B7MRJ1_9CAUD      YTAEQNWFEDKNLFPEYYYKFRVAVAAEGFEQSKWVETEEFQTFKTNAYNFSMMREFNLA
A0A0B6VL61_9CAUD      YTPDNDWFEDDTLSPLNYYKMRVSVAAKGFEQSDWETTEEFQTFATNAYTFTHMREFNLV
Q56EM1_9CAUD          ITPNEEWFEDKVIQSDTHYKMRVRVSGKGFEMSDWVETEEFQTFNTNAYYVSSMREFTPA
A0A0A7HGS7_9CAUD      YTADNEWFEQEYIRPLTSYQMRVSVAAMGFEQSDWEYTEEFETFATNAYTFEHMREFSLA
D9I692_9CAUD          YTTEAEYFYSQLK-PNTYYKMRVGVTAEGFTPSEWVETEEFQSFTQNAYTFETMGELNLI
F2VXL1_9CAUD          YTANNSFFFDDAD-PLTTYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLA
Q5QBX7_9CAUD          YTPNNEWFEEAFISPNSFYKMRVAVAAQGFEQSEWVYTEEFETFSTNAYTFEHMREFTLS
A0A097J465_BPR09      YTANNSFFFDDAD-PLTSYIIRVATAAQDFEQSDWVYTEEFETFATNAYTFQNLIEMQLA
W6ATH0_9CAUD          YTAENEFFEDNYIRPLSYYVMRVAVAAEGFEQSNWKMTEEFQSFETNVYTFEMMRQMTLS
                            :*          * :*: .   .*  * *  :: :  *  *.*    : ::   

BP07_BPT4             NKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
G0YKE0_9CAUD          KKFIDEKFIKGNNDYVNFSTDVVWAALTNESFVYSDAYSHISQISNFIIKENEYHEIQGD
Q7Y4Y0_BPR69          NEFISEKFTKNNTNYVDFNNDTIMAALMSESFQFSPAYTDVSSIRNFIIGENQYHEIQGH
E5EYT6_9CAUD          SKFISEKFTKNNQSYVDFNKDVIMASLVNEEFQFSPNYEHISSMSNFIIKENEYHEIQGS
A0A097BX10_9CAUD      NKFIQEKFTLNNSNYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
E3SEX0_9CAUD          NKFIEEKFTNKNQSYINFNNDIIMASLMSEDFTWTSAYSHLSSISNYVLQEDQYHEIQGP
A0A0A0YP99_9CAUD      KKFIEEKFNKNNQSYVNFNRDTIYAALMNESFQFSPNYEIVSSVSNFVLKEEEYHEIQGS
K7NRD1_9CAUD          DSFINEKFAKNNRDYVDFNDDVIMASLMVEDFVYSPLYSDVSQISDKILKQESYHEIQDH
Q19CN3_9CAUD          ASFVREKFSKNNENYVNFNTDVIMASLMSEDFVFSNQFTDATNLYDKIVSNENYHEIQGF
C3V2E2_BPR51          NKFIQEKFTLNNSNYVNFNNDTIMAALMNESFQFSPSYADVSSISNFIIGENEYHEIQGS
I6YMI8_9CAUD          ASFVREKFSKNNENYVNFNTDVIMASLMSEDFVFSNQFTDATNLYDKIVSNENYHEIQGF
A0A0A7HDG7_9CAUD      NKFIEEKFANNNQAYINFNNDAITASLMSEDFSFTPAYSHLSSISNYVLKEDQYHEIQGS
A0A0K1Y4W1_9CAUD      KEFIKQKFSLNNMSYVNFNTSAMMASLMTESFQFSPEYSHLSAIENFVVGESGYHEIQGP
K4F7A5_9CAUD          DAFINEKFAKNNQNYVNFNTDVVMAALMKEDFVFSPLYTDVSQISDKILTQENYHEIQDH
A0A097J4Z4_BPR10      NKFIQEKFTLNNSNYVNFNNDTIIAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
E5DIG9_9CAUD          KQFIEEKFTKNNQDFVNFNRDTIMASLMDETFQFSPDYRTSSSVDNFILKEDEYHEIQGD
E5E4E4_9CAUD          KTFINEKFLKGNNSYVDFNRDVIWAALTNEQFTYSDGYSHISQMSNFIIKENEYHEIQGS
C4MYW0_9CAUD          NEFVKQKFTYDNRDYIKFNTDLIQASLMKEDFVFSPEYANMTNISNYIVVDENFHEIQDH
D9ICQ5_9CAUD          DAFINEKFAKNNQNYVNFNTDVVMAALMKEDFVFSPLYTDVSQISDKILTQENYHEIQDH
Q06EH2_BPR32          NKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
A0A0K1LKJ5_9CAUD      NKFIEEKFTKNNQNYVNFNTDAIMASLMTEDFNFTPAYSHLSSISNYVLKADRFHEIQGS
A0A0A7HCC7_9CAUD      NKFIEEKFTNNNQNYVNFNTDAIMASLMTEDFNFTPAYSHLSSISNYVLKAERFHEIQGS
M9V2U0_9CAUD          DAFINEKFAKNNQNYVNFNTDVVMAALMKEDFVFSPLYTDVSQISDKILTQENYHEIQDH
A0A0F6THW9_9CAUD      NTFIREKFTNNNMAYVDFNNDTIMAALMNESFQFSPAYADISSIKNFIIGENEYHEIQGS
J7KIE4_9CAUD          ASFVREKFSKNNENYVNFNTDVIMASLMSEDFVFSNQFTDATNLYDKIVSNENYHEIQGF
J7I4F7_9CAUD          ASFVREKFSKNNGNYVNFNTDVIMASLMSEDFVFSNQFTDATNLYDKIVSNENYHEIQGF
A0A0K1LN09_9CAUD      KKFIEEKFNKNNQSYVNFNRDTIYAALMNESFQFSPNYEIVSSVSNFVLKEEEYHEIQGS
A0A0M4R4H6_9CAUD      DAFINEKFAKNNQNYVNFNTDVVMAALMKEDFVFSPLYTDVSQISDKILTQENYHEIQDH
A0A023ZW41_9CAUD      NKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
I7J3Y4_9CAUD          KQLINRKFVHDDNSFVDFNRDLIYASLMTEDFQYSPDYTNVSAVSNFIVGEDEYHEIQGP
A0A0K2FGX1_9CAUD      DSFINEKFAKNNRDYVDFNDDVIMASLMVEDFVYSPLYSDVSQISDKILKQESYHEIQDH
A0A0A0Q0S4_9CAUD      TKFINEKFVNNNYDYIDFNRDDIQASLMTESFQFSPAYTDISSISNFILKADQYHEIQGP
D7RMF8_9CAUD          NKFIEEKFTKNNQSYVDFNSDAIMASMMTEDFTWTPAYSHLSSISNYVLKADRFHEIQGS
A0A0A0PZJ6_9CAUD      NKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
E5EPU8_9CAUD          KKFIEEKFTKGNNSYVDFNTDVIYAALTNESFMYSDAYSHVSQISNFIIKENEYHEIQGD
K4IFJ4_9CAUD          NKFIREKFTNNNQSYVDFNRDTVMAALMDESFQFSPNYEIVSSISDHILFEEEYHEIQSS
K4FK05_9CAUD          NKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYADVSSISNFIIGENEYHEIQGS
A0A0B7MRJ1_9CAUD      NEFIKEKFTYDNREYVKFNTDLIQASLMKEDFVFSPEYANMTNISNYIVVDENFHEIQDH
A0A0B6VL61_9CAUD      TKFIQEKFVLNN-GYIDFNKDQIIASLMSEDFQFSPSYVDISSIKNFVLQEDEFHEIQGP
Q56EM1_9CAUD          ATFINEKFTKNNKSYVDFNDDVIMASLMGEDFVFSPQFSNATNIADKIVTDENYHEIQGY
A0A0A7HGS7_9CAUD      NKFIEEKFTNNNQRYINFNNDAIMASLMSEDFTWTSAYSHLSSISNYVLQEDQYHEIQGP
D9I692_9CAUD          TKFIQEKFVKNNQSYVDFNSDVVYAALMGESFQYSPHYEDISSIQNHILFENEYHEIQED
F2VXL1_9CAUD          NKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
Q5QBX7_9CAUD          NKFIEEKFTKNNQNYVNFNTDAIMASLMTEDFNFTPAYSHLSSISNYVLKADRFHEIQGS
A0A097J465_BPR09      NKFIQEKFTLNNSNYVNFNNDTIIAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGS
W6ATH0_9CAUD          KQFIEEKFTKDNEDFVNFNRDTIMASLMDETFQFSPEYRTASSVNNFILKEDEYHEIQGD
                        :: .**   :  ::.*. . : *::  * * ::  :   : : : ::  . :****  

BP07_BPT4             IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
G0YKE0_9CAUD          ITPICRDI-DRMYLMEDEGILYLFERWQALVKVSNDRGQTWKAVQLMNDRVGWPLSKTVF
Q7Y4Y0_BPR69          IQDVCKDI-NRVYLMESEGILYLFERFQPIVKVSNDKGQTWKAVKLLNDRVGYPLSRTVY
E5EYT6_9CAUD          IEKVCTDI-NRVYLMESNDVLYLFERYQPIVKVSNDKGQTWKAVKLLNDRVGYPISPTVF
A0A097BX10_9CAUD      IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
E3SEX0_9CAUD          IQAVCVDQ-NRTMLAELGGVLYLFERFQPMVKVSNDKGQNWYYIRLFNERIGNPVSRTVY
A0A0A0YP99_9CAUD      VAVVCKDV-NRVMLMESEGVLYLFERFQPVVKVSNDKGQTWKAVKLLSDRAGNPVSRTPY
K7NRD1_9CAUD          IEHVCNDI-DRTFLVYSNGLLYLFERFQNMAKVSNDKGQTWYYYKALNDRVGNPVSRTVA
Q19CN3_9CAUD          IEPVCVDK-NRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRVGNPVSRTVT
C3V2E2_BPR51          IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
I6YMI8_9CAUD          IEPVCVDK-NRTMLAEIDNVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRVGNPVSRTVT
A0A0A7HDG7_9CAUD      IQPVCNDV-NRTMIAELGGVLYLFERFQTTVKVSNDKGQNWYYVKLFNDRIGNPVSRTIY
A0A0K1Y4W1_9CAUD      IEAVCVDK-NRTMLGEIDGILYLFERFQHMVKVSNDKGQNWQYVQLFNDRVGNPVSRVVI
K4F7A5_9CAUD          IEHVCNDI-NRTFLVASNGLLYLFERFQNMAKVSNDKGQTWHYYKAFNDRVGNPVSRSIA
A0A097J4Z4_BPR10      IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
E5DIG9_9CAUD          ITKICKDK-ERVMLMESEGILYLFERFQNIVKVSNDKGQTWKAVRLLNDRVGNPVSKNVY
E5E4E4_9CAUD          IQKVCKDL-ERMYLMEDDGVLYLFERWQGLVKVSNDKGQNWQAVKLLNDRVGWPLSQTVF
C4MYW0_9CAUD          IEKVCIDI-NRTMLAEMNGVLYLFERFQPIVKVSNDKGQSWKAYKAFNDRVGNPVSRTCV
D9ICQ5_9CAUD          IEHVCNDI-NRTFLVASNGLLYLFERFQNMAKVSNDKGQTWHYYKAFNDRVGNPVSRSVA
Q06EH2_BPR32          IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
A0A0K1LKJ5_9CAUD      IQAVCKDP-KRSILMELGGVLYLLERFQSTAKVSNDKGQNWHYIRLFNDRVGNPVSRTAH
A0A0A7HCC7_9CAUD      IQAVCKDP-KRSILMELGGVLYLLERFQSTAKVSNDKGQNWHYIRLFNDRVGNPVSRTVH
M9V2U0_9CAUD          IEHVCNDI-NRTFLVASNGLLYLFERFQNMAKVSNDKGQTWHYYKAFNDRVGNPVSRSVA
A0A0F6THW9_9CAUD      IQQVCHDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKSVKLFNDRVGYPVSRTVY
J7KIE4_9CAUD          IEPVCVDK-NRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRVGNPVSRTVT
J7I4F7_9CAUD          IEPVCVDK-NRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRVGNPVSRTVT
A0A0K1LN09_9CAUD      ITAVCKDV-NRVMLMESEGVLYLFERFQPVVKVSNDKGQTWKAVKLLSDRAGNPVSRTPY
A0A0M4R4H6_9CAUD      IEHVCNDI-NRTFLVASNGLLYLFERFQNMAKVSNDKGQTWHYYKAFNDRVGNPVSRSIA
A0A023ZW41_9CAUD      IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
I7J3Y4_9CAUD          IEAVCVDK-NRTMLMHSDGILYLFERFQPVVKVSNDKAQNWHYVRLFDDRVGNPVSRICT
A0A0K2FGX1_9CAUD      IEHVCNDI-DRTFLVYSNGLLYLFERFQNMAKVSNDKGQTWYYYKALNDRVGNPVSRTVA
A0A0A0Q0S4_9CAUD      IQAVCVDK-NRTMLAELNGVLYLFERFQPIVKVSNDKGQNWKSLKLFNDRIGNPVSRVVY
D7RMF8_9CAUD          IQAVCKDP-NRSILMELGGVLYLLERFQNTAKVSNDKAQNWHYIRLFNDRVGNPVSRTAH
A0A0A0PZJ6_9CAUD      IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
E5EPU8_9CAUD          VTPICRDI-NRMYLMEDDGILYLFERWQPLVKVSNDRGQTWQAVKLMNDRVGWPLSKTVF
K4IFJ4_9CAUD          ISAVCKDI-NRVMLMESEGILYLFERFQPVVKVSNNKGQTWQAVKLLNDRVGNPVSRTVY
K4FK05_9CAUD          IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
A0A0B7MRJ1_9CAUD      IEKVCTDI-NRTMLAEMNGVLYLFERFQPIVKVSNDKGQSWKAYKAFNDRVGNPVSRTCV
A0A0B6VL61_9CAUD      IQKVCSDDLERIMLAELGGVLYEFERFQPMVKVSNDKGQNWKYVKLLTDRAGNPVSKVPY
Q56EM1_9CAUD          IEGVCADI-DRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRIGNPITRTVT
A0A0A7HGS7_9CAUD      IQAVCVDQ-NRTMLAELGGVLYLFERFQPMVKVSNDKGQNWYYIRLFNERIGNPVSRTVY
D9I692_9CAUD          IQKVCTDI-DRVYLMESNGILYLFERYQPIVKVSNDKGQNWKAVKLLNDRVGYPLSRTVF
F2VXL1_9CAUD          IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
Q5QBX7_9CAUD          IQAVCKDP-RRSILMELGGVLYLLERFQSTAKVSNDKGQNWHYIRLFNDRVGNPVSRTAH
A0A097J465_BPR09      IQQVCKDI-NRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVY
W6ATH0_9CAUD          IAKTCKDK-ERVMLMESEGVLYLFERFQNIVKVSNDKGQTWKAVRLLNDRVGNPVSKNVY
                      :   * *   *  :    .:** :**:*  .****::.*.*   : :  * * *::    

BP07_BPT4             YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYA
G0YKE0_9CAUD          YQTSTTNYVLGWDKVFYGRKSTDVRWSSDEVRMSSDDITFAKIGDTLQLGFDVNIFGTYA
Q7Y4Y0_BPR69          YQSEYTTYLLGYDKIFYGRKSSDIRWSADDVRFSSQDVTFAKIGDRLNLGFDVEIFGTYA
E5EYT6_9CAUD          SQTASTSYVLGYDRIFYGRQSTDIRWSADDVRFSSQDITFAKIGDQLNLGFDVELFGTYA
A0A097BX10_9CAUD      YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGYQLHLGFDVEIFATYA
E3SEX0_9CAUD          YQTDTTTYVLGYDRIFYGRQSSDIRWSADDVRFSSEDITFAKVGSDINLGFDIEIFGNYA
A0A0A0YP99_9CAUD      YQTDYTTYLLGYDKLFYGRKSNDVRWSSDEIRFSSQDVTFAKIGDQLKLGFDVEIFGTYA
K7NRD1_9CAUD          YQSANTTYVLGYDRIFYGRTSTDIRWSSDEVRFSSDDVTFAKLGNQSGLDFDVDSYNTYA
Q19CN3_9CAUD          YQSSTTTYLLGYENIYYGRRANDARWSADDVRFSSDSVTFSKTGDELNLGFNVEIFNSYA
C3V2E2_BPR51          YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYA
I6YMI8_9CAUD          YQTSTTTYLLGYENIYYGRRANDVRWSADDVKFSSDSVTFSKTGDELNLGFDVEIFNSYA
A0A0A7HDG7_9CAUD      YQSDTTTYVLGYDRIFYGRKSSDVRWSADDVRFSSQDITFAKIGSDINLGFDIEIFGTYA
A0A0K1Y4W1_9CAUD      YQSKTTSYVLGYDKIFYGRKSSDVRWSSNEVKFSDNEVTFAKLGDQLKLGFEVELFGTYA
K4F7A5_9CAUD          YQSRNTTYVLGYDRIFYGRTSTDIRWSADDVRFSADDVTFAKLGNQTGLDFDVDSYNTFA
A0A097J4Z4_BPR10      YQSASTTYVLGYDKIFYGRKFTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFGTYA
E5DIG9_9CAUD          YQTRNTTYLLGYDRVFYGRKSNDIRWSADDVKFSSQDVTFAKIGDQLKLGFDVEIFGTYA
E5E4E4_9CAUD          YQTSSTNYVLGWDRIFYGRKSTDTRWSSDEVRFSAEDITFAKKGDTLKLGFDVNIFGTYA
C4MYW0_9CAUD          YQSKTTTYVLGYDRIFYGRQARDTRWSADDVRFSDDTITFAKVGDENDLGFDVEVFGVFS
D9ICQ5_9CAUD          YQSTNTTYVLGYDRIFYGRTSTDIRWSADDVRFSADDIIFAKLGNQTGLDFDVDSYNTFA
Q06EH2_BPR32          YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYA
A0A0K1LKJ5_9CAUD      YQTETTTYVLGYDQIFYGRKSSDIRWSADDVRFSSQDITFAKIGSDIDLPFEIEIFGSYA
A0A0A7HCC7_9CAUD      YQTETTTYVLGYDQIFYGRKSSDIRWSADDVRFSSQDVTFAKIGSDIDLPFEIEIFGSYA
M9V2U0_9CAUD          YQSTNTTYVLGYDRIFYGRTSTDIRWSADDVRFSADDVTFAKLGNQAGLDFDVDSYNTFA
A0A0F6THW9_9CAUD      YQTDYTTYVLGYDKLFYGRKSTDVRWSADDVRFSSQDITFAKIGDQLNLGFDVEIFGNYA
J7KIE4_9CAUD          YQSSTTTYLLGYENIYYGRRANDARWSADDVRFSSDSVTFSKTGDELNLGFDVEIFNSYA
J7I4F7_9CAUD          YQTSTTTYLLGYENIYYGRRANDVRWSADDVRFSSDSVTFSKTGDELNLGFDVEIFNSYA
A0A0K1LN09_9CAUD      YQTDYTTYLLGYDKLFYGRKSNDVRWSSDEIRFSSQDVTFAKIGDQLKLGFDVEIFGTYA
A0A0M4R4H6_9CAUD      YQSRNTTYVLGYDRIFYGRTSTDIRWSADDVRFSADDVTFAKLGNQTGLDFDVDSYNTFA
A0A023ZW41_9CAUD      YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYA
I7J3Y4_9CAUD          YQSNTTTYVIGYDRLFYGRLSNDTRWSADDVRFSSQDITFAKIGDQLNLGFDVEIFGTYA
A0A0K2FGX1_9CAUD      YQSANTTYVLGYDRIFYGRTSTDIRWSSDEVRFSADDVTFAKLGNQSGLDFDVDSYNTYA
A0A0A0Q0S4_9CAUD      YQSKTTTYVLGYDRVFYGRQSNDVRWSADDVKFSSQSVTFSKIGDQYNLGFDVEIFGTYA
D7RMF8_9CAUD          YQTDTTTYVLGYDRIFYGRKSSDIRWSADDVRFSSQDVTFAKIGSDIDLDFEIEIFGSYA
A0A0A0PZJ6_9CAUD      YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYA
E5EPU8_9CAUD          YQSTTTNYVLGWDRIFYGRKSTDVRWSSDEVRFSSDDITFAKIGDTLQLGFDVNIFGTYA
K4IFJ4_9CAUD          YQSEYTTYLLGYDRIFYGRKSNDIRWSSDEVRFSSQDVTFAKIGDQLKLGFDVEIFGTYV
K4FK05_9CAUD          YQSASTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFGTYA
A0A0B7MRJ1_9CAUD      YQSKTTTYVLGYDRIFYGRQASDTRWSADDVRFSDDTITFAKVGDENDLGFDVEVFGVFS
A0A0B6VL61_9CAUD      YQTITTTYLLGYDRVFYGRKSNDVRWSSDTVKMSSQDVTFAKIGDQLKLGFDVEIFGTYA
Q56EM1_9CAUD          YQTSTTTYVLGYENIYYGRRANDVRWSADDVRFSSDTVTFAKTGDELNLGFDVELFNSYA
A0A0A7HGS7_9CAUD      YQTDTTTYVLGYDRIFYGRQSSDIRWSADDVRFSSEDITFAKVGSDINLGFDIEIFGNYA
D9I692_9CAUD          YQTSTTTYLLGLDRIFYGRQSTDVRWSADDVKFSSQDVTFAKVGDQLNLGYDVELFSSYA
F2VXL1_9CAUD          YQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYA
Q5QBX7_9CAUD          YQTETTTYVLGYDQIFYGRKSSDIRWSADDVRFSSQDVTFAKIGSDIDLPFEIEIFGSYA
A0A097J465_BPR09      YQSASTTYVLGYDKIFYGRKFTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFGTYA
W6ATH0_9CAUD          YQTRNTTYLLGYDRVFYGRKSNDIRWSADDVKFSSQDVTFAKIGDQLKLGFDVEIFGTYA
                       *:  *.*::* :.::***   * ***:: :::* : : *:* *    * :::: :  : 

BP07_BPT4             TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNALIDFDPLSPTYSERLFEPDTMTIT
G0YKE0_9CAUD          SLPGDVAKIAEAITCNDDYIYVVARDKVRFAKAKNAPIDTDEQSPTYKEKLFEKESHSIT
Q7Y4Y0_BPR69          SLPGNVSRIAEAITCNDDYVYIAARDKVRFVKTSNAPIDSDPLSPTYSERLFEPETFTIT
E5EYT6_9CAUD          RLPGDMSTIAESIVATEEFIYVVARDKVRYVKVRNAPTDTDPLSPTFGEKVFEPDSMNIT
A0A097BX10_9CAUD      TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
E3SEX0_9CAUD          RLPAYISQIAEAITVSDEFIYVAARGRVYKAKTSDAPIDTTPGSPTFGEKLFETGYSTIT
A0A0A0YP99_9CAUD      TLPGDVSRKAEAITANDDYVYVAARDKVRFAKTKNAPVDQNPLSPTFGEKLFEDQVLTIT
K7NRD1_9CAUD          RLPGGVSKYAEAIACSNEWLYVAAKNVMRRIALRNTPIDTDPGSPTFGERIFDEVSYTIV
Q19CN3_9CAUD          RLPGDIFRKGEAIAADDDWVYVAARNKLRRIKTSNAPIDNDPGSPTFGEKLFDPTAFNIT
C3V2E2_BPR51          TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
I6YMI8_9CAUD          RLPGDIFRKGEAIAADDDWIYVAARNKLRRIKTSNAPVDNNPGSPTFGEKLFDPTVFNIT
A0A0A7HDG7_9CAUD      RLPAYISTIAEAITTTDSMIYVSGRDRVYKAKSSDAPIDNDPNSPTFGEKLFEAGFSTIS
A0A0K1Y4W1_9CAUD      SLPADVTKYAEAFTCNDDYLYVVAKDTVRKVKLKDAPIDTDPLSPTFGEKVFEKEVSHIT
K4F7A5_9CAUD          KLPGNVSKYAEAMACSDDWLYVVAKNVVRRIALKQTPIDTDPSSPTFGEKIFDTASYTIV
A0A097J4Z4_BPR10      TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
E5DIG9_9CAUD          RLPLAVQKYAEAITATDDMIYVAGRDVVYRAQTRNAPIDQDPLSPTFGEKLFDTWTSRIT
E5E4E4_9CAUD          RLPGDVSQIAEAITANDDYIYVVARDKVRFAKAKNAPIDTDPLSSTFGEKLFEDESHTIT
C4MYW0_9CAUD          RLTGDTTKYAEAMACSDDYLWVGAKDVIRRIRLKNTPVDTVQGSPTFGEKIFDPDVIRVT
D9ICQ5_9CAUD          KLPGDVSKYAEAMACSDDWLYVAAKNIVRRIALKQTPIDTDPSSPTFGEKIFDETSYTIV
Q06EH2_BPR32          TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
A0A0K1LKJ5_9CAUD      KLPLPISTIAEAICASDDFIYVAGRDRVYKAKTSEAPIDTDPSSPTYGEKIFESRYSTIT
A0A0A7HCC7_9CAUD      KLPLPISTIAEAICASDDFIYVAGRDRVYKAKTSEAPIDTDPSSPTYGEKIFESGYSTIT
M9V2U0_9CAUD          KLPGDVSKYAEAIACSDEWLYVVAKNVMRRIALKQTPIDTDPSSPTFGEKIFDTTSYTVV
A0A0F6THW9_9CAUD      SLPANVSRIAEAIVCNDDYVYVAARDKVRFIKTSNAPIDSDPLSPTYSERLFEQETFNIT
J7KIE4_9CAUD          RLPGDIFRKGEAIAADDDWVYVAARNKLRRIKTSNAPIDNDPGSPTFGEKLFDPTAFNIT
J7I4F7_9CAUD          RLPGDIFRKGEAIAADDDWVYVAARNKLRRIKTSNAPIDTDPGSPTFGEKLFDPTSFNIT
A0A0K1LN09_9CAUD      TLPGDVSRKAEAITANDNYVYVAARDKVRFAKTKNAPIDQNPLSPTFGEKLFEDQVLTIT
A0A0M4R4H6_9CAUD      KLPGNVSKYAEAMACSDDWLYVVAKNVVRRIALKQTPIDTDPSSPTFGEKIFDTASYTVV
A0A023ZW41_9CAUD      TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
I7J3Y4_9CAUD          KYPGDVSKYVEAMTCNNNNLYVVARDTVRFIKLKNAPIDSDPASPTYNEKLFEDEVLQIT
A0A0K2FGX1_9CAUD      RLPGGVSKYAEAMACSSDWLYVAAKNVMRRIALRNTPIDTDPGSPTFGERIFDEVSYTIV
A0A0A0Q0S4_9CAUD      KLPAAVSQIAEAITVSDDFIYIAGRDRVYKAKTSNAPIDTTPGSPTFGEKLFESTYSNIT
D7RMF8_9CAUD          RLPLAISTIAEAMCASDDFIYVAARDRVYKAKTTDAPIDTDPGSPTYGEKIFESGYSTIT
A0A0A0PZJ6_9CAUD      TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDIMTIT
E5EPU8_9CAUD          RLPADVSQIAEAITCNEDFIYVVARDKVRFAKTKNAPIDGNPVSPTFGEKLFEKESQSIT
K4IFJ4_9CAUD          SLPADVSRIAEAITTTDDFIYVVARDKVRFAKTRNAPIDQDPLSPTFGEKLFEPEVLTIT
K4FK05_9CAUD          TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFESDTMTIT
A0A0B7MRJ1_9CAUD      RLTGDTTKYAEAMACSDDYLWVGAKDVIRRIRLKNTPVDTVQGSPTFGEKIFDPDVIRVT
A0A0B6VL61_9CAUD      RLPLAVSTIAEAMTVSDDFIYVAGRGKVYKAKVTNAPIDLDPGSPSFGEKLFETGFSTIV
Q56EM1_9CAUD          RLPGDMYRKAEAIAADDDWIYVAARNNMRRIRTSNAPIETDPGSPNFGEKLFDPVAYMVT
A0A0A7HGS7_9CAUD      RLPAYISQIAEAITVSDEFIYVAARGRVYKAKTSDAPIDTTPGSPTFGEKLFETGYSTIT
D9I692_9CAUD          RLPAALSKITESIASTEEYVYVVARDKVQRIKTQNAPTDTDPLSPTFGEKLFDSWTSNIT
F2VXL1_9CAUD          TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
Q5QBX7_9CAUD          KLPLPISTIAEAMCASDDFIYVAGRDRVYKAKTSEAPIDTDPSSPTYGEKIFESGYSTIT
A0A097J465_BPR09      TLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNAPIDSDPLSPTYSERLFEPDTMTIT
W6ATH0_9CAUD          RLPLAVQKYAEAITATDSMIYVAGRDVVYRAKTRNAPIDQDPLSPTFGEKLFDNWTSRIT
                        .       *::   .. ::: .:. :      ::  :    *..: *::*:     : 

BP07_BPT4             G-NPKAVCYKMDSICDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDEK-TWKR
G0YKE0_9CAUD          G-NPKVVTWKMDCVDGKIFALVVGEMAQEKQDPR-KFPILDSKDKGVYILEDHDTGKWTR
Q7Y4Y0_BPR69          G-NPKAVCYKMDSVGGRIFALIIGEV-ENVNDDPRTKPILDSVDKGVYVLDHDAG-TFKR
E5EYT6_9CAUD          G-NPKAVCYKLETVNGKVFALITGEVKVAGQDPRNTANIVDSNLKGVYRLEDDN--TWTR
A0A097BX10_9CAUD      G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDTK-TWKR
E3SEX0_9CAUD          T-NPKAVCYKMDSVQGHTFALITGEVKEERQDPTKPENVVDSLDKGVYKLDPDT-DTWTR
A0A0A0YP99_9CAUD      G-NSKAVVYKMDSVDGKVFVIITGEVKEELMDPTIPENVVDSLDKGVYILQDDG--TFKR
K7NRD1_9CAUD          PGNDKIVVKKMDVLNDRLYVLVTGEVKTAMMDPTVKANVIPSNDAGVYLWDENAK-TFTR
Q19CN3_9CAUD          T-NARAVTKKLDTFNGKLYALITGVVTQAGLDPTKPENVVHDPVAGVYEF--DGS-SWKK
C3V2E2_BPR51          G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNQDTK-TWKR
I6YMI8_9CAUD          A-NARAVTKKLDTFNGKLYALITGVVTQAGLDPTKPENVVHDPVAGVYEF--DGS-TWKK
A0A0A7HDG7_9CAUD      G-NPKAVCYKMDSIDGEVFALITGEVKEERQDPTKPENVVDSLSKGVYKLNTDT-DTWTR
A0A0K1Y4W1_9CAUD      G-NPKSVCFKMDSVGGKIFALITGEVKTLGLDPTDPRNVVDSATKGVYVYQEG-TNTWKR
K4F7A5_9CAUD          PGNDKIVVKKMDVMDGILYALVTGEVKTALQDPTKPANVVPSADAGVYQWQEDTK-TFVR
A0A097J4Z4_BPR10      G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDMK-TWKR
E5DIG9_9CAUD          G-NSKAVCHNLVSVEGKTLALITGEVKNDLDDRTVADNVVDSDSKGVYILEGD---TWTR
E5E4E4_9CAUD          G-NPKVVTWKMDSVEGRVFALVIGEMEQAGQDPR-KFPILDSLDKGVYILEDHDTGKWTR
C4MYW0_9CAUD          G-NDKAVIQKMDVIDGKLLVFVTGEVKQRYQDPTKPENVVPSDDAGVYLIGSDGL-SFQR
D9ICQ5_9CAUD          PGNDKIVVKKMDVMDSKLYVLVTGEVKVALQDPTKPENVVPSVDSGVYQWQEDTK-TFVR
Q06EH2_BPR32          G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHATK-TWKR
A0A0K1LKJ5_9CAUD      G-NPKAVCYKLDSIQGHTFALITGEVKEEKMDPTVESNVVDSESKGVYWLDTST-DTWTR
A0A0A7HCC7_9CAUD      G-NPKAVCYKLDSIQGHTFALITGEVKEEKMDPTVEANVIDSESKGVYWLDVET-DTWTR
M9V2U0_9CAUD          PGNDKIVVKKMDVMNGILYALVSGEVKTALQDPTKPENVVPSDDSGVYQWQEDTK-TFVR
A0A0F6THW9_9CAUD      G-NPKAVCYKMDSVGGKIFALIIGEV-VNLNDDPRTTPIVDSADKGIYVLDHDAG-TFKR
J7KIE4_9CAUD          T-NARAVTKKLDTFNGKLYALITGVVTQAGLDPTKPENVVHDPVAGVYEF--DGS-SWKK
J7I4F7_9CAUD          A-NARAVTKKLDTFNGKLYALITGVVTQAGLDPTNPKNVVHDPIAGVYEF--DGT-SWRK
A0A0K1LN09_9CAUD      G-NSKAVVYKMDSVDGKVFVLITGEVKEELMDPTIPENVVDSLDKGVYILQDDG--TFKR
A0A0M4R4H6_9CAUD      PGNDKIVVKKMDVMNGILYALVTGEVKTALQDPTKPANVVPSAAAGVYQWQEDTK-TFVR
A0A023ZW41_9CAUD      G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDEK-TWKR
I7J3Y4_9CAUD          G-NNKAVCYKMDSIGSNIFALITGEVKTYGLDPTNPDNVVNSEDKGVYVLQN--DNTFKR
A0A0K2FGX1_9CAUD      PGNDKIVVKKMDVLNDRLYVLVTGEVKTAMMDPTVKANVIPSNDAGVYLWDETEK-TFTR
A0A0A0Q0S4_9CAUD      G-NPKAVCFKLDSVNGETFALITGEVKEEKMDPTVVSNVINSESKGVYKLKSD--DTWER
D7RMF8_9CAUD          G-NPKAVCYKLDSIQGNTFALITGEVKEERMDPTKEENVVDSESKGVYWLDVET-DTWTR
A0A0A0PZJ6_9CAUD      G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDTK-TWKR
E5EPU8_9CAUD          G-NNKAVTWKMDCVNGKIFALVVGEVKEFRQDPRVQENIVDSLDKGVYMLEDHDTGKWVR
K4IFJ4_9CAUD          G-NPKAVCYKMEAVNGKVFALITGEVKEDRMDPTVPENVIDSQSKGIYILQSDN--TFKR
K4FK05_9CAUD          G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSTDKGIYVLNHDTK-TWKR
A0A0B7MRJ1_9CAUD      G-NDKAVIQKMDVIDGKLLVFVTGEVKQRYQDPTKPENVVPSDDAGVYLIGSDGL-SFQR
A0A0B6VL61_9CAUD      D-NTKAVCFKMDSVQGNTYALITGEVKEEGQDPTIPSNVISSESKGVYLLDPET-DVWTR
Q56EM1_9CAUD          N-DPSAIVKKMDTFNGKLYALVTGKVKSQWLDPTVPANIVSTDAIGVYMF--DGA-TWTR
A0A0A7HGS7_9CAUD      A-NPKAVCYKMDSVQGHTFALITGEVKEERQDPTKPENVVDSLDKGVYKLDPVT-DTWTR
D9I692_9CAUD          G-SPKAVCYKLDAVDGEVFALITGEVAQVGFDPR-TSEILDSDLKGVYRLTGD---TWTR
F2VXL1_9CAUD          G-NPKAVCYKMDSVGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDTK-TWKR
Q5QBX7_9CAUD          G-NPKAVCYKLDSIQGHTFALITGEVKEEKMDPTVEANVIDSESKGVYWLDVET-DTWTR
A0A097J465_BPR09      G-NPKAVCYKMDSIGDKVFALIIGEV-ETLNANPRTSKIIDSADKGIYVLNHDMK-TWKR
W6ATH0_9CAUD          G-NSKAVCHNLVSVDGVTLALITGEVRNELDDRTIPDNVIDSESKGVYLLEGD---NWVR
                        .   :  ::  . .   .:: * :            ::     *:*         : :

BP07_BPT4             VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQL--IGAVKY
G0YKE0_9CAUD          IFGNTEEERRRIEVGYTNMSCDDRELFISSSNWHALPEDIVPDTELPEKYPNEVVTAVKQ
Q7Y4Y0_BPR69          IFGNTEEERRRIEPAFTNMSTDGVELYISSSNFKFLESDIVDDPETQSKYGL--LGAVKY
E5EYT6_9CAUD          TYGNTTEERRRIEHGYSSISSNGNEVFFSSSNYRLNQDQMIDDPELVSKYPDEVSSAVKV
A0A097BX10_9CAUD      VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNIVNDPETASKYQL--IGAVKY
E3SEX0_9CAUD          VFGNTEEERRRIEHGYASMSTDGIEVFFSSSNFKYSVE---PDTELPLKYPDEVNEAVKY
A0A0A0YP99_9CAUD      VFGNTEEERRRIEHGYTSMSTNGKEIFISSSNFKFQKDQIVDDPETADKYQL--LGAVKY
K7NRD1_9CAUD          VYGKTEDERFYITHEYTNMSTNGDEVYISVGNYKYPGT--LPDLDLVEKYPEDVHSAVKY
Q19CN3_9CAUD          VFGIGED-HAWISHDYSNMSTNGEEVFVSQINFKYPGT--LPDTDLP-ARYDNVFEAVKY
C3V2E2_BPR51          VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAVKYQL--IGAVKY
I6YMI8_9CAUD          VFGIGED-HVWISHEYSNMSTNGEEVFVSQVNFKYPGT--LPDTDLP-TRYDNVFEAVKY
A0A0A7HDG7_9CAUD      VFGNTEDERRRIEHGYTSMSTDGIELFISSSNFHYSVE---PDTALPEKYPDEVNSAVKY
A0A0K1Y4W1_9CAUD      VFGNTDEEKRRIEHLWTSMSTDGKEIFFSSANFKTTEY--AQDIELETKYPELISTAVKN
K4F7A5_9CAUD          LYGNTEEERFYIQHEYTNMSTNGTEIFISVANYKYPGT--LPDPELLIENPALV-GAVKY
A0A097J4Z4_BPR10      VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQL--IGAVKY
E5DIG9_9CAUD          VFGNTAEERRRIEHGYTSLSTNGTEIFFSSSNFKFLDSNVVPDPDTAAKYGL--LGAVKY
E5E4E4_9CAUD          VFGNTEEERRRIELGYTNMSCDNKEIFISSSNYKILDKDLVPDTELPAKYPGVVSSAVKP
C4MYW0_9CAUD          VFGNTPQEREYIQHGFSNMSTNGDEVFISHYNHHFESI--LPDPETA-AKYE-LGEAVKY
D9ICQ5_9CAUD          LYGNTEEERFFIEHEYTNMSTNGKEIYISVANYKYPGT--LPDPELLITNPELV-AAVKY
Q06EH2_BPR32          VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNIVNDPETAAKYQL--IGAVKY
A0A0K1LKJ5_9CAUD      VFGNTEEERRRIEHGYTSMSTDGEELFFSSSNFRYEVE---VDSELPLEYPEIVTSAVKY
A0A0A7HCC7_9CAUD      VFGNTEEERRRIEHGYTSMSTDGEELFFSSSNFRYEVE---VDSELPLEYPEIVTSAVKY
M9V2U0_9CAUD          LYGNTEEERFFIEHEYTNMSTNGKEIFISVANYKYPGT--LPDPELLVTNPELI-SAVKY
A0A0F6THW9_9CAUD      VFGNTEEERRRIEPGYTSMSTDGVELSISSSNFKFLESDIVDDPKTQIKYGL--IGAVKY
J7KIE4_9CAUD          VFGIGED-HVWISHEYSNMSTNGEEVFVSQINFKYPGT--LPDTDLP-TRYDNVFEAVKY
J7I4F7_9CAUD          VFGIGED-HTWISHEYSNMSTNGEEIFVSQINFKYPGT--LPDLDLP-NKYDNVFEAVKY
A0A0K1LN09_9CAUD      VFGNTEEERRRIEHGYTSMSTNGKEIFISSSNFKFQKDQIVDDPETADKYQL--LGAVKY
A0A0M4R4H6_9CAUD      LYGNTEEERFYIQHEYTNMSTNGTEIFISVANYKYPGT--LPDPELLIENPALV-GAVKY
A0A023ZW41_9CAUD      VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNIVNDPETVVKYQL--IGAVKY
I7J3Y4_9CAUD          VFGNTPEERERIEHTWTSMSTDGKELFFSGSNFEFTEF--VKDDTLIEKYPSVVFDAIKV
A0A0K2FGX1_9CAUD      VYGKTEEERFYITHEYTNMSTNGDEVYISVGNYKYPGT--LPDPDLVEKYPEDVHSAVKY
A0A0A0Q0S4_9CAUD      VFGNTEEERRRIEHGYTSMATDGIEVFISSSNYRYSVE---NDSELPLEFPNIVNSAVKY
D7RMF8_9CAUD          VFGNTEEERRRIEHGYTSMSTDGEEIFFSSSNFKYEVE---VDNELPLEYP-IVASAVKY
A0A0A0PZJ6_9CAUD      VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQL--IGAVKY
E5EPU8_9CAUD          IFGNTEEERRRIEVGYTNMSCDDEELFISSSNYKVLQENIVPDTELPAKYPDAVNYAVKE
K4IFJ4_9CAUD          VFGNTEEERRRIEHGYTSMSTNGTEVFISSSNFKFLNDQIVQDPDTALKYDL--LGAVKY
K4FK05_9CAUD          VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLNDNVVNDPETVAKYQL--IGAVKY
A0A0B7MRJ1_9CAUD      VFGNTPQEREYIQHGFSNMSTNGDEVFISHYNHHFESI--LPDPETA-AKYE-LGEAVKY
A0A0B6VL61_9CAUD      VFGNTEEERRRIEHGWTSMGANGDEVYFSSSNFAYQVE---NDPEVVQKYPDQVNEGVKF
Q56EM1_9CAUD          VFGNTADERRWFSHEYTNMSTNGDELFISQVNFKFPGT--LPDLELP-EKNSQVIEAVKY
A0A0A7HGS7_9CAUD      VFGNTEEERRRIEHGYASMSTDGIEVFFSSSNFKYSVE---PDTELPLKYPDEVNEAVKY
D9I692_9CAUD          IFGNTEEERYRIEVGYTSMSTDGNELFISSSNHRLTDEFIVPDPELSQKYPD-VQAAVKS
F2VXL1_9CAUD          VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDHETAAKYQL--IGAVKY
Q5QBX7_9CAUD          VFGNTEEERRRIEHGYTSMSTDGEELFFSSSNFRYEVE---VDSELPWKYPEIVTSAVKY
A0A097J465_BPR09      VFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQL--IGAVKY
W6ATH0_9CAUD          VFGNTAEERRRIEHGYTSMSTNGTDIFFSSSNFKFLDSNVVPDPETTAKYGL--LGAVKY
                       :*   : :  :   ::.:. :.  : .*  *          *             .:* 

BP07_BPT4             EFPREWLADKHYHMMAFIADETSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
G0YKE0_9CAUD          LYPDQWIHDKHYLMMSFRANGHDGWDKWAPGRMRYYAEPFFSKCTNSGTRCWVNNSNKVV
Q7Y4Y0_BPR69          EYPREWLADKHYHMMIFASNEESNWETFSPTPMQYYAEPFFSYSRKSGTRSWINNSDRAV
E5EYT6_9CAUD          AMDNNWVHDKHYMMMSFRANANDDFREFKPGRMQYYAEPFFSVCRKSNTRCWINNSRDVV
A0A097BX10_9CAUD      EFPREWLADKHYHMMAFIADEKSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
E3SEX0_9CAUD          VYDEQWIHDKHYLMMSFRAGEDSGFEEFKPGRMTYYAEPFFNWSRRDDTRCWITTSDRAM
A0A0A0YP99_9CAUD      EFPREWLSDKHYHMMSFRSNKDSGFESFTPGPMQYYAEPFFSWSRKSGTRCWIDNSNRVV
K7NRD1_9CAUD          DLVPGYTASISINFATVRAN-QNDPTVWNFGPQEYYNEANFSWHFRDKVSTWITNDNRPL
Q19CN3_9CAUD          ELAPGYNSDIPIHMGTFRIN-ADD-PVWKLGPQQYYNEAAFNWMGRSGTRCWITNNDRVL
C3V2E2_BPR51          EFPREWLADKHYHMMAFIADEKSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDKAV
I6YMI8_9CAUD          ELTPGYNSDVPIHMGTFRIN-ADD-PAWKLGPQQYYNEAAFNWMGRSGTRCWITNNDRVL
A0A0A7HDG7_9CAUD      VYDEQWIHDKHYLMMSFRSNKDSGWEEFKPGRMTYYAEPFFNWSRRDDTRCWITTSDRAL
A0A0K1Y4W1_9CAUD      VNPIQYHSDKHYHMMSFRADEFSRWETFVPGPMRFYAEPWFVWMAREGNRCWISTSDNAV
K4F7A5_9CAUD          DLRPGYTASLAINFATIRAH-IDDPTVWKFGAQEYYNEANYSWFFRDSVRTWITNDNRPL
A0A097J4Z4_BPR10      EFPREWLADKHYHMMAFIADEKSDWETFTLQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
E5DIG9_9CAUD          EYTREWLSDKHYHMMSFRTNSKSGFKTFVPGAMNYYAEPFFNWSRKSKSRCWIDTSYRVV
E5E4E4_9CAUD          LIEQQFLHDKHYLMMSFRANGFDGWDKWKPGRMRYYAEPFFSKCTNSGTRCWVNNDWRVV
C4MYW0_9CAUD          SQEPTYLTDKKIHQTTFRAS-YDDLRIWELGPQAYYNEADYTWMRRNGVRVWITNDNRPL
D9ICQ5_9CAUD          DLRPGYTASLSINFATIRAN-IDDPTVWKFGAQEYYNEANYSWFFRDSVRTWITNDNRPL
Q06EH2_BPR32          EFPREWLADKHYHMMAFIADEKSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
A0A0K1LKJ5_9CAUD      VKDEQWIHDKHYLMMSFRSNSKSDFKEFKPGRMAYYAEPFFSWSRRDGTRSWITTGDHAM
A0A0A7HCC7_9CAUD      VKDEQWIHDKHYLMMSFRSNSKSDFKEFKPGRMAYYAEPFFSWSRRDGTRSWITTGDHAM
M9V2U0_9CAUD          DLRPGYTASLSINFATIRAH-IDDPTVWEFGPQEYYNEANYSWFFRDSVRTWITNDNRPL
A0A0F6THW9_9CAUD      EYPREWLADKHYHMMAFISTEDSQWESFTPQPMEYYAEPFFSYSRKSGTRCWINNSDKAV
J7KIE4_9CAUD          ELTPGYNSDVPIHMGTFRIN-ADD-PAWKLGPQQYYNEAAFNWMGRSGTRCWITNNDRVL
J7I4F7_9CAUD          ELTPGYNSDIPIHMGTFRIN-ADD-SEWKLGPQQYYNEAAFTWMARSSTRCWITHNDRAL
A0A0K1LN09_9CAUD      EFPREWLSDKHYHMMSFRSNKDSGFESFTPGPMQYYAEPFFSWSRKSGTRCWIDNSNRVV
A0A0M4R4H6_9CAUD      DLRPGYTASLAINFATIRAH-IDDPTVWKFGAQEYYNEANYSWFFRDSVRTWITNDNRPL
A0A023ZW41_9CAUD      EFPREWLADKHYHMMAFIADEKSDWETFIPQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
I7J3Y4_9CAUD          AEYTQWHSDKHYHMMTFRSNEDSAWETFTPGPMKYYAEPWFCWSRRDSSRSWISTSDLAA
A0A0K2FGX1_9CAUD      DLVPGYTASISINFATVRAN-QNDPTVWNFGPQEYYNEANFSWHFRDKVSTWITNDNRPL
A0A0A0Q0S4_9CAUD      IFEEEFIHDKHYLMMSFRAGESSEYTKFEPGRMTYYAEPFFAWSRRDNTRCWITNANKAM
D7RMF8_9CAUD          VKDEQWIHDKHYLMMSFRANSKSDFKEFKPGRMAYYAEPFFSWSRRDGTRSWITTSNHAM
A0A0A0PZJ6_9CAUD      EFPREWLADKHYHMMAFIADEKSDWETFAPQPMKYYAEPFFNWSKKSNTRCWINNSDRVV
E5EPU8_9CAUD          EYVQQWIHDKHLLMMSFRANGFDGWDKWAPGRMKYYAEPYFSKCTNSGTRCWIDNSNRVV
K4IFJ4_9CAUD          EFPREWLSDKHYHMMSFRADEKSGYEQFVPGAMNYYAEPFFSWSRKSGTRCWINNSDRIV
K4FK05_9CAUD          EFPREWLADKHYHMMAFIADEKSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSNRAV
A0A0B7MRJ1_9CAUD      SQEPTYLTDKKIHQTTFRAS-YDDLRIWELGPQAYYNEADYTWMRRNGVRVWITNDNRPL
A0A0B6VL61_9CAUD      VYEPQYIHDKHYLMMSFRTSAENGWTEFKPGRMDYYAEPFFAWSRRDKTRCWITNSRRCM
Q56EM1_9CAUD          QLLPGYNSDITIHMGTFRIN-QDD-DVWKLGPQQYYNEAAYTRMARSGTRCWITNDNRAL
A0A0A7HGS7_9CAUD      VYDEQWIHDKHYLMMSFRAGEDSGFEEFKPGRMTYYAEPFFNWSRRDDTRCWITTSDRAM
D9I692_9CAUD          EFDQQYVHDKHYLMMSFRTGEALGWAEMKPGRMKYYAEPFFSYCKKSSTRCWITNSNRVL
F2VXL1_9CAUD          EFPREWLADKHYHMMAFIADEKSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
Q5QBX7_9CAUD          VKDEQWIHNKHYLMMSFRSNSKSDFKEFKPGRMAYYAEPFFSWSRRDGTRSWITTGDHAM
A0A097J465_BPR09      EFPREWLADKHYHMMAFIADEKSDWETFTLQPMKYYAEPFFNWSKKSNTRCWINNSDRAV
W6ATH0_9CAUD          EFTREWLSDKHYHMMSFRTNSKSGFKTFVPGAMNYYAEPFFNWSRKSKTRCWIDTSYRIV
                           :  .       .                 :* *. :    ..    *:       

BP07_BPT4             VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKA-SG
G0YKE0_9CAUD          MVYSDVEHSYAIDPYTQSSPNRFMKEVWDKGDCTVISPNIEFKNFTQYANGIVFYRY-SG
Q7Y4Y0_BPR69          VIYSDLLYTKVVESHPSTSPDRKVHEYWNDGDCKIVMPNIEFTGFKKYASGMLFYKS-SG
E5EYT6_9CAUD          VVYTSVEHTQTIEPYPETSPNRFVHEVWDGGECTVIFPNIDFKNFTRYASGVIFYKA-SG
A0A097BX10_9CAUD      VVYADLKYTKVIENFPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKA-SG
E3SEX0_9CAUD          VVYNDILYQYIIDTFGGTSPERIVHEYWNKGRVTITAPNIEFNGFKKYASGIMLHKN-TG
A0A0A0YP99_9CAUD      VVYSGFTHAKIIDTHGSGSPDRILHEIWDKGTCTVTSPNIEFNYFTKYASGVLFYKS-SG
K7NRD1_9CAUD          VVYPETLYTLVTDSASPASTIRVNHEVWDKGTVTIYLNNIKFTGFTKYTNGVLLYRS-GG
Q19CN3_9CAUD          VVYPKIEYSFSIDNEGTESDKRVNRETYNKGVVTLHANNVYFTGFKQYANGVLFHKN-TG
C3V2E2_BPR51          VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKS-SG
I6YMI8_9CAUD          VVYPKIEYSFSIDDEGTESDKRVNRETYNKGVVTLYANNVYFTGFKQYANGVLFHKN-TG
A0A0A7HDG7_9CAUD      VVYNDMLYQKIIDTFGGSSPERIVHEYWNKGQVTVTAPNIEFNGFKKYASGIMLHKN-TG
A0A0K1Y4W1_9CAUD      VVYNDILYQKRVDTAAQGTTERILSEVWDKGDATFYCPPVSFNGFLQYASGIMFHEP-DG
K4F7A5_9CAUD          VVYPKITYSLVTDSAGPSSSLRVNKEVWDRGHVTIYINNIKFTGFTKYTNGVLLYKS-SG
A0A097J4Z4_BPR10      VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKS-SG
E5DIG9_9CAUD          VVYSDIVHSKVIDANGSGSPDRVLHEYWDKGVCTVTSPNIQFDNFTKYASGILFHKM-SG
E5E4E4_9CAUD          MVYSDVEHSYAIDPASISSPDRVMKEVWKAGDCTVISPNVEFKNFTQYASGVMFYRY-SG
C4MYW0_9CAUD          VVYPEVIYTQEVDTSGILDQNRVNREVYDKGTVTCYLNNVKFEGFKQYASGVMFHKN-TG
D9ICQ5_9CAUD          VVYPKIVYEMVTDTAGPSSTLRVNKEVWDRGHVTIYINNIKFTGFTKYTNGVLLYKS-SG
Q06EH2_BPR32          VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKS-SG
A0A0K1LKJ5_9CAUD      VVYNDALYQKIIDLNSGSSPERIVHEIWNKGFCKVTSPNIEFNGFKKYSSGMMIHKS-TG
A0A0A7HCC7_9CAUD      VVYNDALYQKIIDLNSGSSPERIVHEIWNKGFCKVTSPNIEFNGFKKYSSGMMIHKS-TG
M9V2U0_9CAUD          VVYPKIVYELVTDTAGPSSTLRVNKEVWDRGHVTIYINNIKFTGFTKYTNGVLLYKS-SG
A0A0F6THW9_9CAUD      VIYSDLLYTKVIENHPLSSSDREVHEYWKDGDCTIVMPNVDFTGFKKYASGMIFYKS-SG
J7KIE4_9CAUD          VVYPKIEYSFSIDDEGTESDKRVNRETYNKGVVTLYANNVYFTGFKQYANGVLFHKN-TG
J7I4F7_9CAUD          VVYPKIEYSFSIDDEGTESDKRVNRETYNKGVVTLYANNVYFTGFKQYANGVLFHKN-TG
A0A0K1LN09_9CAUD      VVYSGFTHAKIIDTHGSGSPDRVLHEIWDKGVCTVTSPNIEFNYFTKYASGVLFYKS-SG
A0A0M4R4H6_9CAUD      VVYPKITYSLVTDSAGPSSSLRVNKEVWDRGHVTIYINNIKFTGFTKYTNGVLLYKS-SG
A0A023ZW41_9CAUD      VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKA-SG
I7J3Y4_9CAUD          VVYSDLIYTKPVELHGSGSPERVVHEIWDKGTGTFKCPNVEFSGFIKYASGILFHKGGTG
A0A0K2FGX1_9CAUD      VVYPETLYTLVTDSASPASTIRVNHEVWDKGTVTIYLNNIKFTGFTKYTNGVLLYRS-GG
A0A0A0Q0S4_9CAUD      VVYNDKLYQKSIDIYGSGSPDRIMHEHWDKGLVTVTSPNIEFTGFKKYASGIMIHKN-TG
D7RMF8_9CAUD          VVYNDALYQKIIDLNSGSSPERIIREIWDKGFCTVTCPNIEFNGFKKYSSGIMIHKS-SG
A0A0A0PZJ6_9CAUD      VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKA-SG
E5EPU8_9CAUD          MVYSDITHEYPIDPYPVTSPNRFMKEVWNTGDCTVSSPNIEFKNFTKYANGVVFYKH-SG
K4IFJ4_9CAUD          VVYSNITHTKIIDTHGSGSPERVLHEFWDKGTCTVTAPNVEFNGFTKYASGILFYKS-SG
K4FK05_9CAUD          VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKS-SG
A0A0B7MRJ1_9CAUD      VVYPEVIYTQEVDTSGILDQNRVNREVYDKGTVTCYLNNVKFEGFKQYASGVMFHKN-TG
A0A0B6VL61_9CAUD      VVYEDMLYQKVVDEFGSGSPDRIIHETWDKGHVTVTCPNIEFQGFKRYASGIMLHKN-TG
Q56EM1_9CAUD          VVYPKIVYSKSIDDAGFADDSRVNKETHNKGTITLYANNVRFNGFKRYANGILFHKN-TG
A0A0A7HGS7_9CAUD      VVYNDVLYQYIIDTFGGTSPERIVHEYWNKGQVTITAPNIEFNSFKKYASGIMLHKN-TG
D9I692_9CAUD          VVYNDITHAYPIDTFGERSPNRVMKETWKKGTFTAISPNIEFNNFNRYAAGVIFYKS-SG
F2VXL1_9CAUD          VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKA-SG
Q5QBX7_9CAUD          VVYNDALYQKIIDLNSGSSPERIVHEIWNKGFCKVTSPNIEFNGFKKYSSGMMIHKS-TG
A0A097J465_BPR09      VVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKS-SG
W6ATH0_9CAUD          VVYSDITHSKVIDINGSGSPDRVLHEYWDKGTCTVTSPNIQFDNFTKYASGILFHKM-SG
                      ::*    :    :        *   *  . *  .     : *  * :*: *::::.   *

BP07_BPT4             EIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTM
G0YKE0_9CAUD          ELIGYYEFNYRVKDNVRIVWKPSNIFLKAFLRQQTREEPWAPDDNNGYNNPDLRPFLTKM
Q7Y4Y0_BPR69          EIISYYDFSYRVRDNVSIIWKPTNVFLTSSLQNQEKETSWVPVEETGLADPDLRPLLTTM
E5EYT6_9CAUD          ELISYYEFNYRVKDEVRIVWKPTNVFLKAYLQQQTREEPWVPDESDWRRDPDLQPLITTM
A0A097BX10_9CAUD      EIISYYDFNYRVRDTVEIIWKPTGVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTM
E3SEX0_9CAUD          ELIGYFEFDYRVRDEVRIIWKPKEIMLMAELQNQEHDIPWTPENENKEKDPDLQPLLTKM
A0A0A0YP99_9CAUD      EIISYYEFNYRVRDEVKIIWKPSEVFLKAYLQNQERNEEWKPEERSGEQDPDLRPLINKM
K7NRD1_9CAUD          RIIGFYELSYRARDELTIFWKPDNTLMVASLVNQERENPYTPDIEPGLIDPDLSHMITRF
Q19CN3_9CAUD          EIIGYYEFPYRVRNTTSVFWKPANVMMVAELRNQEREVPWTPAPFVGLKDPDLQPLVTKM
C3V2E2_BPR51          EIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQERETPWSPEEERGLADPDLRPLIGTM
I6YMI8_9CAUD          EIIGYYEFPYRVRNTTSVFWKPANVMMVAELRNQEREVPWTPAPFVGLKDPDLQPLVTKM
A0A0A7HDG7_9CAUD      ELIGYFEFDYRMRDEVRLIWKPKEIMFTAELQNQEHDIPWTPDNDNQEKDPDLRPLLTKM
A0A0K1Y4W1_9CAUD      KLIGYYAFDYRVRDQVTLNWKPTDVMFKAFLQNQTREEDWTPEHTPGLRDPDLRPYLTKM
K4F7A5_9CAUD          EIIGFFELSYRARDSLTIFWKPDNTLLIADLIQQEREKPYTPDLSPGLIDPDLSHMITRF
A0A097J4Z4_BPR10      EIISYYDFNYRVRDTVEIIWKPTGIFLKAFLQNQERETPWSPEEEHGLADPDLRPLIGTM
E5DIG9_9CAUD          EIISYYEFNYRVRDEVSIIWKPSEIFLKAYLQNQERETPWTPDNRDGLKDPDLRPLLNTM
E5E4E4_9CAUD          ELIGYYEFNYRVKDNVRIVWKPSNVMLRAYLQNQEWPTEWKPDDEGGYNNPDLRPFLTKM
C4MYW0_9CAUD          EIIGFYQFNYRVRDQVGVYWKPTNVAFVAELQNQVREVPWVPVHYDREQDPDLRPLLNKM
D9ICQ5_9CAUD          EIIGFFELSYRARDSLTIFWKPDNTLLIADLIQQEREQPYVPDLSPGLIDPDLSHMITRF
Q06EH2_BPR32          EIISYYDFNYRVRDTVEIIWKPTGIFLKAFLQNQERETPWSPEEEHGLADPDLRPLIGTM
A0A0K1LKJ5_9CAUD      ELVGYFEFDYRVRDEVRVIWKPKEIMFTAELQNQEHEIPWKPKEEVGEQDPDLQPLLVKM
A0A0A7HCC7_9CAUD      ELVGYFEFDYRVRDEVRVIWKPKEIMFTAELQNQEHEIPWKPKEEVGEQDPDLQPLLVKM
M9V2U0_9CAUD          EIIGFFELSYRARDSLTIFWKPDNTLLIADLIQQEREQPYVPDLSSGLIDPDLSHMITRF
A0A0F6THW9_9CAUD      EIISYYDFSYRVRDNVSIIWKPTNIFLTASLQNQEKDTTWTPVEENGIADPDLRPLLTTM
J7KIE4_9CAUD          EIIGYYEFPYRVRNTTSVFWKPANVMMVAELRNQEREVPWTPAPFVGLKDPDLQPLVTKM
J7I4F7_9CAUD          EIIGYYEFPYRVRNTTSVFWKPVNVMMVAELRNQEREVPWTPAPFVGLKDPDLQPLVTKM
A0A0K1LN09_9CAUD      EIISYYEFNYRVRDEVKIIWKPSEIFLKAYLQNQERNEEWKPEERSGEQDPDLRPLINKM
A0A0M4R4H6_9CAUD      EIIGFFELSYRARDNLTIFWKPDNTLLIADLIQQEREKPYQPDLSPGLIDPDLSHMITRF
A0A023ZW41_9CAUD      EIISYYDFNYRVRDTVEIIWKPTGVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTM
I7J3Y4_9CAUD          DILGYYEFNYRVRDEAIVFWKPTETMFTAYLQSQSREVPWTPEASNKERDPDLRPLIRTM
A0A0K2FGX1_9CAUD      RIIGFYELSYRARDELTIFWKPDNTLMVASLVNQERENPYTPDIEPGLIDPDLSHMITRF
A0A0A0Q0S4_9CAUD      ELIGYFEFDYRVRDDVSIFWKPKEIMFTAELQNQERDVEWAPEVTNEERDPDLRPLLVKM
D7RMF8_9CAUD          ELVGYFEFDYRVRDEVRIIWKPKEIMFTAELQNQEHEIPWTPKEETGEQDPDLRPLLVKM
A0A0A0PZJ6_9CAUD      EIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTM
E5EPU8_9CAUD          ELVGYYEFNYRVKDSVRIVWKPSNVFLNAFMQNQTREDPWTPDDSNGYNNPDLRPFLTKI
K4IFJ4_9CAUD          EIISYYEFNYRVRDETKIIWKPSEIFLKAYLQNQERETEWKPEERDGIQDPDLRPLIRTM
K4FK05_9CAUD          EIISYYDFNYRVRDTVEIIWKPTGVFLKAFLQNQEHETPWSPEEEHGLADPDLRPLIGTM
A0A0B7MRJ1_9CAUD      EIIGFYQFNYRVRDQVGVYWKPTNVAFVAELQNQVREVPWVPVHYDREQDPDLRPLLNKM
A0A0B6VL61_9CAUD      ELIGYFEFDYRVRDEVRLIWKPKEIMFTADLQGQEREIPWTPEVTNKERDPDLRPLLNKM
Q56EM1_9CAUD          EIIGYYEFPYRVRDEAYVFWKPNFVMLVAELRNQERETPWTPAPNYGLKDPDLRPLVTKM
A0A0A7HGS7_9CAUD      ELIGYFEFDYRVRDEVRIIWKPKEIMLMAELQNQEHDIPWTPENENKEKDPDLQPLLTKM
D9I692_9CAUD          ELIAYYEFNYRVRDDVRIVWKPTNVFFSAYLQNQTREDPWVPDVNPNRVDPDLRPLLNKI
F2VXL1_9CAUD          EIISYYDFSYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTM
Q5QBX7_9CAUD          ELVGYFEFDYRVRDEVRVIWKPKEIMFTAELQNQEHEIPWAPKEETGEQDPDLKPLLVKM
A0A097J465_BPR09      EIISYYDFNYRVRDTVEIIWKPTGIFLKAFLQNQERETPWSPEEEHGLADPDLRPLIGTM
W6ATH0_9CAUD          EIISYFEFDYRVRDEVSIIWKPSEIFLKAYLQNQERVVPWTPDNRDGLKDPDLRPLLNTM
                       ::.:: : ** ::   : ***    : : :  *     : *       :***   :  :

BP07_BPT4             MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
G0YKE0_9CAUD          IPDSYLLEDSNFEKFCQYYLQYLSDGYGTPYNNLVNLIRDKYPKEKHSWEYMWSEIYKRN
Q7Y4Y0_BPR69          MPESYLLDNTNFEAFCEAYIQYLSDGYGTHYNNLLNLIKNKYPREEHAWEYLWSEIYKRN
E5EYT6_9CAUD          IPDSYLLEGSNFEKFSQYYLQYISDGYGTSYNNLLNLIRNKYPREKNSWEYLWSEIYKRN
A0A097BX10_9CAUD      MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNKYPREEHAWEYLWSEIYKRN
E3SEX0_9CAUD          IPDSYLLQDSKFEKFCEYYLQFISDGSGTYYNNLLNLIRNQYPREEDAWEYLWSEMYKRN
A0A0A0YP99_9CAUD      MPDSYLLDDSNFEKFCEAYIQYLSDGYGTQYNNLLNLIRNQYPREKDSWEYLWSEIYKRN
K7NRD1_9CAUD          APQSYLDN-QQFEKFGEYYLQYISLGSNSYYNKLLNLIRNKYPREKNNVEYLWSEINRRN
Q19CN3_9CAUD          MPESYLDEDTNFGAFAKYYLQFLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRN
C3V2E2_BPR51          MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
I6YMI8_9CAUD          MPESYLDEDTNFGAFAKYYLQFLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRN
A0A0A7HDG7_9CAUD      VPDSYLLQDSNFEKFCEYYLQFISDGSGTYYNNLLNLIRNQYPREEDAWEYLWSEMYKRN
A0A0K1Y4W1_9CAUD      MPDSYLLQDSNFEHFCKYYLQFLSDGNGTHYNSLVNLVKNKYPREENAWEYLWSEVYKRN
K4F7A5_9CAUD          APQSYLDQ-QYFEKFGEYYLQFVSLGENTYYNKLLNLIRNKYPREKNSVEYLWSEVNRRN
A0A097J4Z4_BPR10      MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
E5DIG9_9CAUD          MPDSYLLEESNFEAFCEAYIQYLSDGYGTQYNNLLNLIRNKYPREKDAWEYLWSEVYKRN
E5E4E4_9CAUD          IPDSYLLEDSNFEKFCQYYLQYLSDGYGTSYNNLVNLIRDKYPKEKHSWEYMWSEIYKRN
C4MYW0_9CAUD          TPDSFLLENENFRKFSEYYLQFLSDGSGTYYNKLKNLIKNKYPREQDAYEYLWSEMNKRN
D9ICQ5_9CAUD          APQSYLDQ-EYFEKFGEYYLQFVSLGENTYYNKLLNLIRNKYPREKNCVEYLWSEVNRRN
Q06EH2_BPR32          MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
A0A0K1LKJ5_9CAUD      IPDSYLLQDSNFEKFCEYYLQFISDGSGTHYNNLLNLIRNQYPREEDSWEYLWSEIYKRN
A0A0A7HCC7_9CAUD      IPDSYLLQDSNFEKFCEYYLQFISDGSGTHYNNLLNLIRNQYPREEDSWEYLWSEIYKRN
M9V2U0_9CAUD          APQSYLDQ-EYFEKFGEYYLQFVSLGENTYYNKLLNLIRNKYPREKNSVEYLWSEVNRRN
A0A0F6THW9_9CAUD      MPESYLLDNTNFEAFCEAYIQYLSDGYGTHYNNLLNLIKNQYPREEHAWEYLWSEIYKRN
J7KIE4_9CAUD          MPESYLDEDTNFGAFAKYYLQFLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRN
J7I4F7_9CAUD          MPESYLDEDTNFGAFAKYYLQFLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRN
A0A0K1LN09_9CAUD      MPDSYLLDDSNFEKFCEAYIQYLSDGYGTQYNNLLNLIRNQYPREKDSWEYLWSEIYKRN
A0A0M4R4H6_9CAUD      APQSYLDQ-QYFEKFGEYYLQFVSLGENTYYNKLLNLIRNKYPREKNSVEYLWSEVNRRN
A0A023ZW41_9CAUD      MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
I7J3Y4_9CAUD          MPETYLTEDTNFETFCTSYLQFLSDGYGTQYNNLLNVIKNKYPREEHAWEYLWSEIYKRN
A0A0K2FGX1_9CAUD      APQSYLDN-QQFEKFGEYYLQYISLGSNSYYNKLLNLIRNKYPREKNNVEYLWSEINRRN
A0A0A0Q0S4_9CAUD      MPESYLLQDTNFEKFCEYYLQFISDGSGTYYNNLLNLIKNKYPREEDSWEYLWSEIYKRN
D7RMF8_9CAUD          VPDSYLLQDSNFEKFCEYYLQFISDGSGTHYNNLLNLIRNQYPREEDAWEYLWSEIYKRN
A0A0A0PZJ6_9CAUD      MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNKYPREEHAWEYLWSEIYKRN
E5EPU8_9CAUD          VPESYIMEGSNFEKFCEYYLQYISDGYGTVYNNLTNLIRDKYPKEEHSWEYLWSEIYKRN
K4IFJ4_9CAUD          MPDSYLLEDTNFEKFCDAYIQYLSDGYGTQYNNLLNLIRNQYPREKDSWEYLWSEVYKRN
K4FK05_9CAUD          MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
A0A0B7MRJ1_9CAUD      TPDSFLLENENFRKFSEYYLQFLSDGSGTYYNKLKNLIKNKYPREQDAYEYLWSEMNKRN
A0A0B6VL61_9CAUD      MPDSYLLQDTNFEKFCEYYLQFLSDGSGTYYNNLLNLIRDQYPREEDAWNYLWSEIYKRN
Q56EM1_9CAUD          MPESYLDEDSNFGAFAKYYLQYLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRN
A0A0A7HGS7_9CAUD      VPDSYLLQDSKFEKFCEYYLQFISDGSGTYYNNLLNLIRNQYPREEDAWEYLWSEMYKRN
D9I692_9CAUD          IPDSYLLEDSNFEKFCEYYLQYISTGYGTQYNNLLNLIRNKYPKEEHSWEYMWGEVYKRN
F2VXL1_9CAUD          MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNKYPREEHAWEYLWSEIYKRN
Q5QBX7_9CAUD          VPDSYLLQDSNFEKFCEYYLQFISDGSGTHYNNLLNLIRNQYPREEDSWEYLWSEIYKRN
A0A097J465_BPR09      MPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRN
W6ATH0_9CAUD          MPDSYLLEESNFEAFCEAYIQYLSDGYGTQYNNLLNLIRNKYPREKDAWEYLWSEVYKRN
                       *:::: :   *  *   *:*::* * .: **.* *:::::**:*:   :*:*.*: :**

BP07_BPT4             IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
G0YKE0_9CAUD          IYLSKEKRDLVARFFETRKNDFYSTKGIEASYKFLFKVLYNEDVEIDIESANGLEYDIIV
Q7Y4Y0_BPR69          IYLNAEKRDLVSRFFESRSYDFYSTKGTEASYKFLFKVLYNEDVEVEIESSAGTEYDIII
E5EYT6_9CAUD          IYLNREKRDLVSRFFQTRKADFYSTKGIEESYKFLFKVLYNEEVEIDIESNSGTEYDVII
A0A097BX10_9CAUD      IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
E3SEX0_9CAUD          IYLSKEKRDEAVRFFQARQSDFWATKGTEASYKFLFKLLYNEDVEIDIESKNGTEYDIVV
A0A0A0YP99_9CAUD      IYLNKDKRDAVSRFFEARRSDFYSTKGVEASYQFLFKLLYNEDVQIEIESNSGTEYDIII
K7NRD1_9CAUD          IYLDKTKREAVVRFFESRASDFYSTKGIEASYTFLFKLLYNEDVSVEIESSNSLEYDILV
Q19CN3_9CAUD          IYLDEAKRDSVARFFESRAYDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVV
C3V2E2_BPR51          IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDVII
I6YMI8_9CAUD          IYLDEAKRDSVARFFESRAYDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVV
A0A0A7HDG7_9CAUD      IYLSKTKRDEVVRFFEARQSDFWATKGTEASYKFLFKLLYNEDVEIDIESKNGTEYDIIV
A0A0K1Y4W1_9CAUD      IYLSKDARDAVVRFFEARKNDFYATKGIEDSYKFLFKLLYNEDVEIDIESKNTTEYDIIV
K4F7A5_9CAUD          IYLDKTKRDQVVRFFESRCSDFYSTKGIEASYKFLFKLLYNEDVTVEIESSNTLEYDILV
A0A097J4Z4_BPR10      IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
E5DIG9_9CAUD          IYLNPDKRDAVSRFFEARKSDFYSTKGIEASYQFLFKLLYNENVEIEIESNSGTEYDIIV
E5E4E4_9CAUD          IYLNKDKRDLVSRFFETRKNDFYSTKGVEASYKFLFKALYNEDVEIDIESNNGLEYDIIV
C4MYW0_9CAUD          IYADKNKRDAVVRFFESRKSDFYSTKGVEASYKFLFKLLYNEDVEIEVESQAGLEYDIVV
D9ICQ5_9CAUD          IYLDKTKRDQVVRFFESRASDFYSTKGIEASYKFLFKLLYNEDVSVEIESSNTLEYDILV
Q06EH2_BPR32          IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
A0A0K1LKJ5_9CAUD      IYLSKEKRDEVVRFFQARQTDFWSTKGTEASYKFLFKLLYNEDVEIDIESKNSIEYDIIV
A0A0A7HCC7_9CAUD      IYLSKEKRDEVVRFFQARQSDFWSTKGTEASYKFLFKLLYNEDVEIDIESKNSIEYDIIV
M9V2U0_9CAUD          IYLDKTKRDQVVRFFESRASDFYSTKGIEASYKFLFKLLYNEDVSVEIESSNTLEYDILV
A0A0F6THW9_9CAUD      IYLNAEKRDLVSRFFESRSYDFYSTKGTEASYKFLFKVLYNEDVEIEIESSSGTEYDIII
J7KIE4_9CAUD          IYLDEAKRDSVARFFESRAYDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVV
J7I4F7_9CAUD          IYLDEAKRDSVARFFESRAYDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVV
A0A0K1LN09_9CAUD      IYLNKDKRDAVSRFFEARRSDFYSTKGVEASYQFLFKLLYNEDVQIEIESNSGTEYDIII
A0A0M4R4H6_9CAUD      IYLDKTKRDQVVRFFESRCSDFYSTKGIEASYKFLFKLLYNEDVSVEIESSNTLEYDILV
A0A023ZW41_9CAUD      IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
I7J3Y4_9CAUD          IYLSQEARDQVIRFFEARKADFYATKGIEDSYKFLFKVLYNEDVQIDIESKNTDEYDIIV
A0A0K2FGX1_9CAUD      IYLDKTKREAVVRFFESRASDFYSTKGIEASYTFLFKLLYNEDVSVEIESSNSLEYDILV
A0A0A0Q0S4_9CAUD      IYLSKTKRDEVVRFFESRATDLWSTKGTEASYKFLFKLLYNEDVQIDIESKNTTEYDIVV
D7RMF8_9CAUD          IYLSKEKRDEVVRFFQARQSDFWSTKGTEASYKFLFKLLYNEDVEIDIESKNSIEYDIIV
A0A0A0PZJ6_9CAUD      IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
E5EPU8_9CAUD          IYLNKEKRDFVARFFETRKNDFYSTKGIEASYKFLFKVLYNEDVEIDIESANGLEYDIIV
K4IFJ4_9CAUD          IYLNKDKRDAVSRFFEARRSDFYSTKGIEASYKFLFKLLYNEDVEIEIESNSGTEYDIVI
K4FK05_9CAUD          IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
A0A0B7MRJ1_9CAUD      IYADKNKRDAVVRFFESRKSDFYSTKGVEASYKFLFKLLYNEDVEIEVESQAGLEYDIVV
A0A0B6VL61_9CAUD      IYLSKDKRDEVVRFFEARQSDFWMTKGTEASYKFLFKLLYNEDVEIDIESKNTTEYDILV
Q56EM1_9CAUD          IYLDEAKRDSVARFFEARSFDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVV
A0A0A7HGS7_9CAUD      IYLSKEKRDEAVRFFQARQSDFWATKGTEASYKFLFKLLYNEDVEIDIESKNGTEYDIVV
D9I692_9CAUD          LYLDREKRDYVARFFETRKSDFYSTKGIEASYKFLFRLLYNEDVEIDIESNSGTEYDIIV
F2VXL1_9CAUD          IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
Q5QBX7_9CAUD          IYLSKEKRDEVVRFFQARQSDFWSTKGTEASYKFLFKLLYNEDVEIDIESKNSIEYDIIV
A0A097J465_BPR09      IYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIV
W6ATH0_9CAUD          IYLNPDKRDAVSRFFEARKSDFYSTKGIEASYQFLFKLLYNENVEIEIESNPGTEYDIII
                      :* .   *: . ***::*  *:: *** * ** ***: ****:* :::**    ***:::

BP07_BPT4             QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
G0YKE0_9CAUD          ESDNITEDLAGRTVYTATGRSNVTYIERHYNKGKLQWKLTIHNLMGRFINGQEILSER-T
Q7Y4Y0_BPR69          QSDSISEDLVGQTIYTATGRCNVTYLERSYSKGKLQWTVTIHNLLGRLLVGQEVKAERLA
E5EYT6_9CAUD          ESDLINDDLAGQTIYTPSGRCNVTYVERHYNDGKLQWRVTIHNLIGRLMVGQEVKAER-S
A0A097BX10_9CAUD      QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
E3SEX0_9CAUD          ESDNISEDIVGQTIYTATGRSNVTYMERDYKDGKLRWRITIHNLLGRFIVGQEIKSER-T
A0A0A0YP99_9CAUD      ESDSINENLVGQTIYTPTGRCNVTYLERSYSNGKLQWKVTIHNLLGRLIVGQEVKSERML
K7NRD1_9CAUD          SSTNISQDIVGRTIYTPTGRANVTYIEREYENGQLRWSMTLHNAQGNFIEGQVVKSEK-T
Q19CN3_9CAUD          YSTNISQDIVGRTIYTPTGRANVTYVDREYVEGQLKWRITIHNMIGKFFEGQQIKSET-S
C3V2E2_BPR51          QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
I6YMI8_9CAUD          YSTNISQDIVGRTIYTPTGRANVTYVDREYVEGQLKWRITIHNMIGKFFEGQQIKSET-S
A0A0A7HDG7_9CAUD      ESDNISEDIVGQTIYTPTGRSNVTYMERDYKQGKLRWRITIHNLLGRFIVGQEIKSER-T
A0A0K1Y4W1_9CAUD      ESTNISDDLVGRTIYTASGRSNVTYIEREYRDGRLLWRITIHNLSGRFIEGQEIKSER-T
K4F7A5_9CAUD          QSTNISQDIVGRTIYTPTARANVTYIERQYDDGQLRWSMTLHNVIGNFLEGQVVKSEK-T
A0A097J4Z4_BPR10      QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
E5DIG9_9CAUD          ESDSVNDDLVGQTIYTATGRTNVTYVERHYNEGRLQWRITIHNLLGRLIVGQELKAERMP
E5E4E4_9CAUD          QSDNITEDLAGRTIYTPTGRSNVTYIERHYAKGKLQWRLTIHNLMGRFLAGQEIKSER-T
C4MYW0_9CAUD          SSTNIDEDIVGRTIYTPTGRANVTYLEREYEGGRLRWRVTIHNLIGRFEEGQVIKSEK-T
D9ICQ5_9CAUD          SSTNISQDIVGRTIYTPTARANVTYIERDYEDGQLRWSMTLHNVIGNFLEGQVVKSEK-T
Q06EH2_BPR32          QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
A0A0K1LKJ5_9CAUD      ESDNISEDIVGQTIYTPTGRSNVTYIERNYKDGKLQWRLTIHNLLGRFIVGQEIKSER-T
A0A0A7HCC7_9CAUD      ESDNISEDIVGQTIYTPTGRSNVTYIERNYKQGKLQWRLTIHNLLGRFIVGQEIKSER-T
M9V2U0_9CAUD          SSTNISQDIVGRTIYTPTARANVTYIERDYKDGQLRWSMTLHNVIGNFLEGQVVKSEK-T
A0A0F6THW9_9CAUD      ESDSLTEDLVGQTIYTATGRCNVTYIERSYSKGKLQWTVTIHNLLGRLIQGQEVKAERLP
J7KIE4_9CAUD          YSTNISQDIVGRTIYTPTGRANVTYVDREYVEGQLKWRITIHNMIGKFFEGQQIKSET-S
J7I4F7_9CAUD          YSTNISQDIVGRTIYTPTGRANVTYMDREYVEGQLKWRITIHNMIGKFFEGQQIKSET-S
A0A0K1LN09_9CAUD      ESDSINENLVGQTIYTQTGRCNVTYLERSYSKGKLQWKVTIHNLLGRLIVGQEVKSERML
A0A0M4R4H6_9CAUD      HSTNINQDIVGRTIYTPTARANVTYIERQYDDGQLRWSVTLHNVIGNFLEGQVVKSEK-T
A0A023ZW41_9CAUD      QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
I7J3Y4_9CAUD          DSNNISNDLAGRTIYTPTGRCNVTYIERDYSAGRLRWRITIHNLIGRFVTGQVIKSEQ-T
A0A0K2FGX1_9CAUD      SSTNISQDIVGRTIYTPTGRANVTYIEREYENGQLRWSMTLHNAQGNFIEGQVVKSEK-T
A0A0A0Q0S4_9CAUD      ESDNINEDIVGTTIYTPTGRSNVTYIERSYSDGKLQWNITIHNLLGRFIAGQEIKSET-Q
D7RMF8_9CAUD          ESDNISEDIVGQTIYTPTGRSNVTYIERNYKDGKLQWRLTIHNLLGRFIVGQEIKSER-T
A0A0A0PZJ6_9CAUD      QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
E5EPU8_9CAUD          ESDNINEDLAGRTIYTATGRSNVTYIERHYSKGKLQWKITIHNLLGRFIAGQEIKSER-T
K4IFJ4_9CAUD          ESDSINEDLVGQTIYTPTGRCNVTYIERSYSKGKLQWNVTIHNLLGRLIQGQEVKAERYP
K4FK05_9CAUD          QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
A0A0B7MRJ1_9CAUD      SSTNIDEDIVGRTIYTPTGRANVTYLEREYEGGRLRWRVTIHNLIGRFEEGQVIKSEK-T
A0A0B6VL61_9CAUD      ESDNINEDIVGQTIYTKTGRSNVTYLERYYNEGKLQWRVTIHNLLGNFNAGQEILSER-T
Q56EM1_9CAUD          YSTNISQDIVGRTIYTPTGRANVTYIEREYNEGKLRWRITIHNMIGKFFEGQEIKSET-T
A0A0A7HGS7_9CAUD      ESDNISEDIVGQTIYTATGRSNVTYMERDYKDGKLRWRITIHNLLGRFIAGQEIKSER-T
D9I692_9CAUD          ESDNINEGIVGQTIYTESGRCNVTYMQRNYVKGKLQWRITIHNMLGRFLVGQEVKAER-S
F2VXL1_9CAUD          QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
Q5QBX7_9CAUD          ESDNISEDIVGQTIYTPTGRSNVTYIERNYKDGKLQWRLTIHNLLGRFIVGQEIKSER-T
A0A097J465_BPR09      QSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLP
W6ATH0_9CAUD          ESDSVNDDLVGHTIYTATGRTNVTYVERHYNEGRLQWRITIHNLLGRLIVGQEIKAERMP
                       *  : :.:.* *:** :.* ****::* *  *:* * :*:**  *.:  ** : :*   

BP07_BPT4             SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
G0YKE0_9CAUD          NFKGMIVQGVRGKDMSSNTIDYINRGRAYYVMKIKSALPSSRYRDDVLRFVHPVGFGFIG
Q7Y4Y0_BPR69          DFEGEIVRGIKGKELAQNTIDYFNRGRAYYVMKIKSNLPSSRWKSDVLRFVHPVGFGFIA
E5EYT6_9CAUD          SMTGTIIQGVRGKDLASNTIEYINRNRSYYVMRIKSTLPTSRYRDDVLRFVHPVGFGFVG
A0A097BX10_9CAUD      SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
E3SEX0_9CAUD          SFEGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFIG
A0A0A0YP99_9CAUD      SFDGMIVRGVRGKELVENNIDYINRNRSYYVMKIKSNLPTSRYRNDVLRFVHPVGFGFIG
K7NRD1_9CAUD          NFTGMVIRGVRGKQMANNSIDYINRGRSYYVMKIRSNLPTSRYKDDVLRFVHPVGFGFMG
Q19CN3_9CAUD          SFVGEILVGVRGKELMSDSIDYINRGRSYYTMTIKSTLPASRYTQDVLRFVHPVGFGFVG
C3V2E2_BPR51          GFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
I6YMI8_9CAUD          SFVGEILVGVRGKELMSDSIDYINRGRSYYTMTIKSTLPASRYAQDVLRFVHPVGFGFVG
A0A0A7HDG7_9CAUD      SFEGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSSLPTSRYRNDVLRFVHPVGFGFVG
A0A0K1Y4W1_9CAUD      DFEGIIVQGVRGKDMLSNNIDYINRSRSYYVMKIKSQLPTSRFRDDVLRFVHPVGFGFIG
K4F7A5_9CAUD          NFTGTILRGVRGKQMANNSIDYFNRGRSYYVMKIRSNLPASRYKDDVLRFVHPVGFGFIG
A0A097J4Z4_BPR10      SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
E5DIG9_9CAUD          GFSGIIVQGVRGKELVENTIEYINRNRSYYVMKIKSNLPTSRYRNDVLRFVHPVGFGFIG
E5E4E4_9CAUD          NFEGMIVQGVRGKDMSSNTIEYINRSRAYYVMKIKSQLPTSRYRDDVLRFVHPVGFGFIG
C4MYW0_9CAUD          AFEGMILVGVRGKELLSSSIDYINRSRSQYTMKIKSALPVSRYANDVMRFVHPVGFGFIG
D9ICQ5_9CAUD          NFTGSILRGVRGKQMANNSIDYFNRGRSYYVMKIRSNLPASRYKDDVLRFVHPVGFGFIG
Q06EH2_BPR32          SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFIHPVGFGFIA
A0A0K1LKJ5_9CAUD      SFKGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFVG
A0A0A7HCC7_9CAUD      SFKGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFVG
M9V2U0_9CAUD          NFTGNILRGVRGKQMANNSIDYFNRGRSYYVMKIRSNLPASRYKDDVLRFVHPVGFGFIG
A0A0F6THW9_9CAUD      GFEGEIVRGIKGKELSQNNIDYINRGRAYYVMKIKSKLPSSRWKSDVLRFVHPVGFGFIA
J7KIE4_9CAUD          SFVGEILVGVRGKELMSDSIDYINRGRSYYTMTIKSTLPASRYAQDVLRFVHPVGFGFVG
J7I4F7_9CAUD          SFVGEILVGVRGKELMSDSIDYINRGRSYYTMTIKSTLPASRYKQDVLRFVHPVGFGFVG
A0A0K1LN09_9CAUD      SFDGMIVRGVRGKELVENNIDYINRNRSYYVMKIKSNLPTSRYRNDVLRFVHPVGFGFIG
A0A0M4R4H6_9CAUD      NFTGTILRGVRGKQMANNSIDYFNRGRSYYVMKIRSNLPASRYKDDVLRFVHPVGFGFIG
A0A023ZW41_9CAUD      SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
I7J3Y4_9CAUD          GFVGTIIQGVRGKELLSNNIDYINRARSYYVMKISSNLPTSRYRNDILRFVHPVGFGFIG
A0A0K2FGX1_9CAUD      NFTGMVIRGVRGKQMANNSIDYINRGRSYYVMKIRSNLPTSRYKDDVLRFVHPVGFGFMG
A0A0A0Q0S4_9CAUD      AFEGMIVRGVRGKDLMSNTIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFIG
D7RMF8_9CAUD          SFKGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFIG
A0A0A0PZJ6_9CAUD      SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
E5EPU8_9CAUD          SFEGTIVQGVRGKDMSSNTIEYINRGRSYYVMKIKSALPSSRYRDDVLRFVHPVGFGFIG
K4IFJ4_9CAUD          GFNGMIVRGVRGKELVENTIDYINRNRSYYVMKIRSNLPTSRYRNDVLRFVHPVGFGFIG
K4FK05_9CAUD          SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
A0A0B7MRJ1_9CAUD      AFEGMILVGVRGKELLSSSIDYINRSRSQYTMKIKSALPVSRYANDVMRFVHPVGFGFIG
A0A0B6VL61_9CAUD      AFKGMIIRGVRGKELLSNTIEYINRNRSYYVMTIKSNLPTSRYRGDVLRFVHPVGFGFIG
Q56EM1_9CAUD          GFKGDVIVGVRGKELLSDSIDYINRGRSYYTMTIKSVLPASRYSQDVLRFVHPVGFGFVG
A0A0A7HGS7_9CAUD      SFEGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFIG
D9I692_9CAUD          TFEGTIVQGVRGKDLMTNNIDYINRSRSYYVMKIKSTLPTSRYREDILRFVHPVGFGFVG
F2VXL1_9CAUD          SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
Q5QBX7_9CAUD          SFKGMIVQGVRGKELLSNNIDYINRNRSYYVMTIKSNLPTSRYRNDVLRFVHPVGFGFIG
A0A097J465_BPR09      SFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIA
W6ATH0_9CAUD          GFSGTIVQGVRGKELVENTIEYINRNRSYYVMKIKSNLPTSRYRNDVLRFVHPVGFGFIG
                       : * :: *::**::  ..*:*:** *: *.* * * ** **:  *::**:*******:.

BP07_BPT4             ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRIAKLTPTGEIEHDSVTGEAI
G0YKE0_9CAUD          ITLITMFINAGLSMKHVETVINTLKNYRWDSGLPSYWPDRVAKFGPDGKIDHDAVTGEPL
Q7Y4Y0_BPR69          ITLLTMFINTGLTLKHVETIINKYKNYKWDSGLPTEYADRVARLDPQGNVEFNPATGEVI
E5EYT6_9CAUD          ITLLTMFMNAGLSMKHTETIINKLKNYRWDAGLPSVWPDRVAILTANDVISMDPVTGEPV
A0A097BX10_9CAUD      ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
E3SEX0_9CAUD          ITLLTMFVNVGLTLKHTETIINKLSNYRWSSGIPSEWNDRVAVIGVDGTIEKNPITGEAI
A0A0A0YP99_9CAUD      ITLLTMFINVGLTMKHVQTIINKYKNYKWDAGIPTFYPDRAVSLDSNGNPERDPITGLVI
K7NRD1_9CAUD          ITMLTVFINSGLSMTHNETIIDILRNYRFDSGYPKFWPDRIASMDGNGNQQFDLVTGEPL
Q19CN3_9CAUD          ITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPTEQYDRVAKLDVDGNIEHDSITGEAL
C3V2E2_BPR51          ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
I6YMI8_9CAUD          ITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPTEQYDRVAKLDVDGNIEHDSITGEAL
A0A0A7HDG7_9CAUD      ITLLTMFVNAGLSLKHTETIINKLNNYRWSSGIPSEWCDRIAVIGVDSNIEKNPVTGEAV
A0A0K1Y4W1_9CAUD      ITLLTMFINSGLNMKHVETIINKLKNYKWDAGLPSVYPDRVAIIASDDTIERDPITNEPR
K4F7A5_9CAUD          ITMLTVFINSGLSMTHSETIIDILRNYRFDSGYPKYWPDRVARLDGNGNQTFDLVTGEAL
A0A097J4Z4_BPR10      ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEYDSVTGEAI
E5DIG9_9CAUD          ITLLTMFINVGLTLKHVQTIINKYKNYKWDAGLPSIWADRVAQLDSNGDIEHDPVTGEAL
E5E4E4_9CAUD          ITLLTMFINAGLSLKHVETIINTYKNYRWDSGLPSHYPDRVAVIGPNGKIEHDITTGEPI
C4MYW0_9CAUD          VTLLTMFINSGLSMRHVETIIQSLKNYKFDSGLPSVYPDRVADLDVDGNIKIDPLTGKPL
D9ICQ5_9CAUD          ITMLTVFINSGLSMTHSETIIDILRNYRFDSGYPKYWPDRVARLDGNGNQTFDLVTGEAL
Q06EH2_BPR32          ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
A0A0K1LKJ5_9CAUD      ITLLSMFVNVGLTLKHTETIINILKNYKWDSGLPSEWYDRVAVIGFDGNIERDPRTGLPV
A0A0A7HCC7_9CAUD      ITLLSMFVNVGLTLKHTETIINILKNYKWDAGLPSEWYDRVAVIGFDGNIERDPRTGAPV
M9V2U0_9CAUD          ITMLTVFINSGLSMTHSETIIDILRNYRFDSGYPKFWPDRVARLDGNGNQTFDLVTGEAL
A0A0F6THW9_9CAUD      ITLLTMFINTGLTLKHVETIINKYKNYKWDSGLPTKYADRVAKLDPQGNVEFDPITGKAI
J7KIE4_9CAUD          ITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPTEQYDRVAKLDVDGNIEHDSITGEAL
J7I4F7_9CAUD          ITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPTEQYDRVAKLDVDGNIEHDSATGEAL
A0A0K1LN09_9CAUD      ITLLTMFINVGLTMKHVQTIINKYKNYKWDAGIPTFYPDRVASLDSNGNPEKDPITGLVI
A0A0M4R4H6_9CAUD      ITMLTVFINSGLSMTHSETIIDILRNYRFDSGYPKYWPDRVARLDGNGNQTFDLVTGEAL
A0A023ZW41_9CAUD      ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
I7J3Y4_9CAUD          ITLLTMFINVGLTMKHVETIINIMKNYKWDAGLPSVYPDRVAVLDSNGNIEHDSVSGKAL
A0A0K2FGX1_9CAUD      ITMLTVFINSGLSMTHNETIIDILRNYRFDSGYPKFWPDRIASMDGNGNQQFDLVTGEPL
A0A0A0Q0S4_9CAUD      ITLLTMFINTGLTLKHVETIINTYKNYRWDAGLPSVWPDRVAVLNSAGDVVRNPITGSVE
D7RMF8_9CAUD          ITLLSMFVNVGLTLKHTETIINILKNYKWDSGLPSEWYDRVAVIGFDGNIERDPRTGLPV
A0A0A0PZJ6_9CAUD      ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
E5EPU8_9CAUD          ITLISMFINAGLSMKHVETIINTLKNYKWDAGLPSVWPDRVAKFGPDGKIDRDPTTGEPI
K4IFJ4_9CAUD          ITLLTMFINVGLTMKHVQTIINKYKNYKWDAGIPTFYPDRVASLDSSGNVEKDPVTGEVI
K4FK05_9CAUD          ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
A0A0B7MRJ1_9CAUD      VTLLTMFINSGLSMKHTETIIQSLKNYKFDSGLPSVYPDRVADLDVDGNIKKDPLTGKAL
A0A0B6VL61_9CAUD      ITLLTMFINAGLTLKHVETILNIYKNYRWDAGLPSVYPDRVAVMDSNGDVERDPVTGEVR
Q56EM1_9CAUD          ITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPLEQYDRVAKLDVDGNIETDPVTGEAV
A0A0A7HGS7_9CAUD      ITLLTMFVNVGLTLKHTETIINKLSNYRWSSGIPSEWNDRVAVIGVDGTIEKNPTTGEAI
D9I692_9CAUD          ITLLTMFINAGLSLKHVETVINKYKTYRWDAGLPSVWPDRVAVLNAQDKIETDSITGEPV
F2VXL1_9CAUD          ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEHDSVTGEAI
Q5QBX7_9CAUD          ITLLSMFVNVGLTLKHTETIINILKNYKWDSGLPSEWYDRVAVIGFDGNIERDPRTGAPM
A0A097J465_BPR09      ITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRVAKLTPTGEIEYDSVTGEAI
W6ATH0_9CAUD          ITLLTMFINVGLTLKHVQTIINKYKNYKWDAGLPLIWPDRVAQLDSNGNIEHNDVTGEAL
                      :*::::*:* **.: * :*:::   .*::.:* *    ** . :   .    :  :.   

BP07_BPT4             YEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
G0YKE0_9CAUD          YNPHPNAGQKFPLRPTYMADNPG-LYYGVNADDRRVPMSPLFDQSAVTFARYRDLVNKRL
Q7Y4Y0_BPR69          YDAGPYAGIEYPLPANYNEENDNSIFQGQLPSERRKPMSPLFDASGTTFSRFRELVNERL
E5EYT6_9CAUD          YALHPNAGQPFIIPPTYNSENNNTIISGQNPDQRRRPMSPTFDQSAVTFASYRALVDQRL
A0A097BX10_9CAUD      YEPGPMAGVEYPLPDDYNTENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
E3SEX0_9CAUD          YNIAPNAGQPFPLPADYDAENDFSMFYGLLPSQRRGKYSPLFDQSAVTFSNWRALVDQRL
A0A0A0YP99_9CAUD      YTSGPLAGIAYPVPADYDSDNDNSIFQGQTPTERRKLMSPLFDQSAVAFSQFRDLVEERL
K7NRD1_9CAUD          YTVHPRAGEPFDVPPEYDIEEK--PLNGVLPSARRFDQSPLFDCSGVKYSQFRNLVDKRL
Q19CN3_9CAUD          YLVGPNAGEPFVPPPEYDTEEA--SWLGKLPSERRFNMSPLFDQSAVTFSHFRRLVEKRL
C3V2E2_BPR51          YEPGPMAGVEYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
I6YMI8_9CAUD          YLVGPNAGEPFVPPPEYDTEEA--SWLGKLPSERRFNMSPLFDQSAVTFSHFRRLVEKRL
A0A0A7HDG7_9CAUD      YNIAPNAGLPFPLPADYDAENDFSDFHGTLPSERRKKYSPLFDQSAVTFSNWRNLVNQRL
A0A0K1Y4W1_9CAUD      YSSRAQAGEPFPLPANYNQENNNSVIAGQNPGQRRKPLSPTFDQSAVTFANYRDLVNQRL
K4F7A5_9CAUD          YEPHPKAGQPFDVPPEYDVEEQ--PLNGVLPSARRFDQSPLFDSSAVKYSQFRNLVEKRL
A0A097J4Z4_BPR10      YEPGPMAGVEYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
E5DIG9_9CAUD          YLPHPRAGEDFDIPADYDAENNNSVIAGQLPSERRKPMSPTFDQSAVTFSNWRDLVDARL
E5E4E4_9CAUD          YSPTGREDEEFPLRPDYMSINNT-TYYGLDADQRRRPMSPLFDQSAVTFSKFRALVDLRL
C4MYW0_9CAUD          YLTSPTIGEEFPVPPEYDQENSE-LFHGLKASERRFAMSPLFDQSAVTFSMFRELVDKRL
D9ICQ5_9CAUD          YEPHPKAGQPFDVPPQYDIDEQ--PLNGVLPSARRFDQSPLFDSSAVKYSQFRNLVEKRL
Q06EH2_BPR32          YEPGPMAGVEYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
A0A0K1LKJ5_9CAUD      YNVGPKAGEPFDIPADYDAENDFSVFQGQLPHKRIKKHSPLFDQSAVTFANWRALVDKRL
A0A0A7HCC7_9CAUD      YNVGPKAGEPFDIPADYDAENDFSIFQGQLPHERVKKHSPLFDQSAVTFANWRELVDKRL
M9V2U0_9CAUD          YEPHPNAGQPFDVPPEYDIDEQ--PLNGVLPSARRFDQSPLFDSSAVKYSQFRNLVEKRL
A0A0F6THW9_9CAUD      YEIGPMAGQDYPLPEDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFSRFRDLVEQRL
J7KIE4_9CAUD          YLVGPNAGEPFVPPPEYDTEEA--SWLGKLPSERRFNMSPLFDQSAVTFSHFRRLVEKRL
J7I4F7_9CAUD          YLVGPNAGEPFVPPPEYDTEEE--SWLGKLPSERRFAMSPLFDQSAVTFSQFRRLVEKRL
A0A0K1LN09_9CAUD      YTAGPMTGIPYPVPADYDSENDNSIFQGQTPTERRKAMSPLFDQSAVTFSQFRDLVEDRL
A0A0M4R4H6_9CAUD      YDPHPKAGQPFDVPPQYDIDEQ--PLNGVLPSARRFDQSPLFDSSAVKYSQFRNLVEKRL
A0A023ZW41_9CAUD      YEPGPMAGVEYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
I7J3Y4_9CAUD          YTAAPDAGLPFPLPIDYNSENDDSIFQGQLPNERRKALSPLFDQSAVTFSSFRDLVDKRL
A0A0K2FGX1_9CAUD      YTAHPRAGEPFDVPPEYDIEEK--PLNGVLPSARRFDQSPLFDCSGVKYSQFRNLVDRRL
A0A0A0Q0S4_9CAUD      YQPAPNAGLDFPLRLNYNEENDDSIFQGQNPDERRKPMSPLFDQSSVTFSQWRDLVDKRL
D7RMF8_9CAUD          YNVGPKAGEPFPIPDGYDAENDFSVFQGQLPHERIKKHSPLFDQSAVTFSKWRALVDDRL
A0A0A0PZJ6_9CAUD      YEPGPMAGVEYPLPDDYNTENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
E5EPU8_9CAUD          YLDAPNKGVDFPLRPTYMADNPG-TYYGLDADERRRPMSPLFDQSAVTFAQFRNLVDMRL
K4IFJ4_9CAUD          YLPGPMSGIAYPVPADYDSENDNSIFQGQTPTERRKSMSPLFDQSAVTFSQFRDLVEQRL
K4FK05_9CAUD          YEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
A0A0B7MRJ1_9CAUD      YLTSPTMGEEFPVPPEYDQENSE-LFHGLKASERRFAMSPLFDQSAVTFSMFRELVDQRL
A0A0B6VL61_9CAUD      YDTPPNAGLPFPIRPDYIDENNNSMWHGLNPDERRRPMSPLFDQSAVTFAQWRALVDKRL
Q56EM1_9CAUD          YLVGPNAGQPFDVPPEYDTEES--SWHGKLPSERRFKMSPLFDQSAVTFSNFRRLVEQRL
A0A0A7HGS7_9CAUD      YNIAPNAGQPFPLPADYDAENDFSMFYGLLPSQRRGKYSPLFDQSAVTFSNWRALVDQRL
D9I692_9CAUD          YAQHSNAGQPFPLPPNYDAENNNSIIGGQTPGERRKPMSPTFDQTAVTFSKFRALVDERL
F2VXL1_9CAUD          YEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
Q5QBX7_9CAUD          YNVGPKAGEPFDIPADYDAENDFSVFQGQLPHERIKKHSPLFDQSAVTFANWRALVDKRL
A0A097J465_BPR09      YEPGPMAGVEYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRL
W6ATH0_9CAUD          YLPHPRANEDFDIPDDYDAENNNSVIAGQLPSERRKPMSPTFDQSAVTFSNWRDLVNSRL
                      *      .  :     *   :      *  .  *    ** ** :.. :: :* **: **

BP07_BPT4             KDNIGNPRDPENPTQVKIDE-
G0YKE0_9CAUD          KDDIGNPRDPKEPTQVKVNE-
Q7Y4Y0_BPR69          LDNVGNPRDPINPPQVKLDE-
E5EYT6_9CAUD          KDDIGLPRDPTEPTQVKINE-
A0A097BX10_9CAUD      KDNIGNPRDPENPTQVKIDE-
E3SEX0_9CAUD          KDDIGNPRDPVNPTQVNVNE-
A0A0A0YP99_9CAUD      IDKVGIPRDPVNTTQVKINE-
K7NRD1_9CAUD          KDDAGNPRDPNPPSQIKVGN-
Q19CN3_9CAUD          KDDAGNPRDQQNPTQVKIDE-
C3V2E2_BPR51          KDNIGNPRDPENPTQVKIDE-
I6YMI8_9CAUD          KDDAGNPRDQQNPTQVKIDE-
A0A0A7HDG7_9CAUD      KDDIGNPRDPRDPTQVKVNE-
A0A0K1Y4W1_9CAUD      KDDAGNPRDPENPTQVKIDE-
K4F7A5_9CAUD          KDDAGNPRDPNPPTQRKVA--
A0A097J4Z4_BPR10      KDNIGNPRDPENPTQVKIDE-
E5DIG9_9CAUD          IDKVNIPRDPANPTQVKINE-
E5E4E4_9CAUD          KSNIGNPRDPEHPTQVKVDE-
C4MYW0_9CAUD          KDNIGNPRDPKNPTQRKING-
D9ICQ5_9CAUD          KDDAGNPRDPNPPTQRKVGK-
Q06EH2_BPR32          KDNIGNPRDPENPTQVKIDE-
A0A0K1LKJ5_9CAUD      KDDIGNPRDPKVPTQVKIND-
A0A0A7HCC7_9CAUD      KDDIGNPRDPKVPTQVKLND-
M9V2U0_9CAUD          KDDAGNPRDPNPPTQIKVGK-
A0A0F6THW9_9CAUD      IDNVGNPRDPVNPPQVKLDE-
J7KIE4_9CAUD          KDDAGNPRDQQNPTQVKIDE-
J7I4F7_9CAUD          KDDVGNPRDPQNPTQVKIDE-
A0A0K1LN09_9CAUD      IDKVGIPRDPENPTQVKINE-
A0A0M4R4H6_9CAUD      KDDAGNPRDPNPPTQRKVA--
A0A023ZW41_9CAUD      KDNIGNPRDPENPTQVKIDE-
I7J3Y4_9CAUD          KDDAGNPRDPSNPTQVLINE-
A0A0K2FGX1_9CAUD      KDDAGNPRDPNPPSQIKVGN-
A0A0A0Q0S4_9CAUD      KDDIGNPRDPINPTQVQLNEQ
D7RMF8_9CAUD          KADIGNPRDPQDPTQVKIDD-
A0A0A0PZJ6_9CAUD      KDNIENPRDPENPTQVKIDE-
E5EPU8_9CAUD          KSDVGNPRDPQNPTQVKVDE-
K4IFJ4_9CAUD          IDKTGLPREPNNPTQVKIDE-
K4FK05_9CAUD          KDNIGNPRDPENPTQVKIDE-
A0A0B7MRJ1_9CAUD      KDNIGNPRDPKNPTQRKING-
A0A0B6VL61_9CAUD      KDDVGHPRDPQNPTQVKVDE-
Q56EM1_9CAUD          KDDAGNPRDPKVPTQVKIDE-
A0A0A7HGS7_9CAUD      KDDIGNPRDPVNPTQVNVNE-
D9I692_9CAUD          KENVGNPRDPVDPTLINIGD-
F2VXL1_9CAUD          KDNIGNPRDPENPTQVKIDE-
Q5QBX7_9CAUD          KDDIGNPRDPKVPTQVKIND-
A0A097J465_BPR09      KDNIGNPRDPENPTQVKIDE-
W6ATH0_9CAUD          IDKVNIPRDPANPTQVKINE-
                        .   **:   ..   :