CLUSTAL format seed alignment for MF_04110

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ENLYS_BPKMV       ----------MNKPLRGAALA--------------------AALAGLVALEGSETTAYRD
LYS_BPP21         --MPPSLRKAVAAAIGGGAIAIASVLI--------------TGPSGNDGLEGVSYIPYKD
LYS_BPP1          ---------MKGKTAAGGGAICAIAVMITIVMGNGNVRTNQAGLELIGNAEGCRRDPYMC
LYS_BPPA2         --MPPSLRKAVAAAIGGGAIAIASVLI--------------TGPSGNDGLEGVSYIPYKD
LYS_BPPS1         MAMSPALRNSVMAAISGGAIAIASVLI--------------TGPGGNDGLEGVRYKPYKD
LYS_BPPS3         MAMSPAVRNSVIAAISGGAIAIASVLI--------------TGPGGNDGLEGVRYKPYKD
ENLYS_BPMU        --MAGIPKKLKAALLAVTIAGGGVGGYQE------------MTRQSLIHLENIAYMPYRD
ENLYS_BPT1        --------MSLKNNVIGASIGAALT----------------LTPTLLERIEGIEYEVYYD
LYS_BPN15         ----MANRAKLSAAVLSLILAGASAPQ--------------ILDQFLDEKEGNSLTAYKD
LYS_BPH19         --MNAKIRYGLSAAVLALIGAGASAPE--------------ILDQFLDEKEGNHTTAYRD
LYS_BPHC1         ----MSKKFGAMILCSAAAVAAAFFAQQKGLPTQQQNQVSPKAVSMIVNLEGCVRNPYKC
LYS_BP933         --MSRKLRYGLSAAVLALIAAGASAPE--------------ILDQFLDEKEGNHTTAYRD
LYS_BPVT2         --MSRKLRYGLSAAVLALIAAGASAPE--------------ILDQFLDEKEGNHTTAYRD
ENLYS_BPT4        ----------------------------------------MNIFEMLRIDERLRLKIYKD
LYS_BPAPS         ------------MHISE------------------------KGLVLIKRYEGLRLKAYQC
ENLYS_BPB03       ------------MNISQ------------------------AGINLIKSFEGLRTKAYKA
ENLYS_BPPZA       ------------MQISQ------------------------AGINLIKSFEGLQLKAYKA
ENLYS_BPPH2       ------------MQISQ------------------------AGINLIKSFEGLQLKAYKA
ENLYS_BPP22       -----------MMQISS------------------------NGITRLKREEGERLKAYSD
LYS_BPLC2         ------------MKVSQ------------------------NGLNLIKEFEGCRLTAYKP
LYS_BPPHV         ------------MKVSQ------------------------NGLNLIKEFEGCRLTAYKP
Q333C0_9CAUD      ---------MKQKLVVGAATAAAIY----------------IAAPLIELVEGVENKPYMD
B0FIH9_BPE32      --MDNVALPPVQLNLSP------------------------AGMEFIMKHEGMRTKAYKD
Q76H64_9CAUD      -----------MAAISGGAIAIASVLI--------------TGPGGNDGLEGVRYKPYKD
Q7Y3V3_9CAUD      --MPSSTKSKLSAAILALIATGASAPV--------------MMSQFQKEKEGTSLIAYPD
C8CLH9_9CAUD      --MAPNPTSNGRRMALGLAVVLG------------------LAAPMIAKWEGVKHRPYKD
A2I817_9CAUD      --------MSVKKALAGGACSLALVTASFFGIVTDKVRISQEGLEHLIDCEGCKRQAYKD
Q3HQU9_9CAUD      --MADVPKKTLVSVVGAAAAA--------------------LLFSIVPKFEGLELVARPD
                                                                    *         

ENLYS_BPKMV       --IAGVPTICSGTT-----AGVKMGD-------------KATPEQCYQMTIKDF-QRFER
LYS_BPP21         --IVGVWTVCHGHT----GKDIMLGK-------------TYTKAECKALLNKDL-ATVAR
LYS_BPP1          --PAGVWTDGIGNT-----HGVTPGV-------------RKTDQQIAADWEKNI-LIAER
LYS_BPPA2         --IVGVWTVCHGHT----GKDIMLGK-------------TYTKAECKALLNKDL-ATVAR
LYS_BPPS1         --VVGVLTVCYGHT----GKDIMPGK-------------TYTEAECKALLNKDL-ITVAR
LYS_BPPS3         --VVGVLTVCYGHT----GKDIMPGK-------------TYTEAECKALLNKDL-ATVAR
ENLYS_BPMU        --IAGVLTVCVGHT----GPDIEM-R-------------RYSHAECMALLDSDL-KPVYA
ENLYS_BPT1        --IAGVPTVCSGIT----GPDVIPGK-------------KYTKRECDALLIKHI-GVAQR
LYS_BPN15         --GSGIWTICRGAT-MVDGKPVMQGM-------------KLTQAKCNQVNAIER-NKALA
LYS_BPH19         --GTGIWTICRGAI-LVDGKPVVPGM-------------KLSKEKCDQVNAIER-DKALA
LYS_BPHC1         --PADVWTNGVGNT-----HNVDKTK-------------ILTIDEVATDLRRNI-KEAEN
LYS_BP933         --GAGIWTICRGAT-RVDGKPVIPGM-------------KLSKEKCDRVNAIER-DKALA
LYS_BPVT2         --GAGIWTICRGAT-RVDGKPVIPGM-------------KLSKEKCDRVNAIER-DKALA
ENLYS_BPT4        --TEGYYTIGIGHL-LTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDV-DAAVR
LYS_BPAPS         --RAGRWTLGYGHT-----HNLNIGD-------------VITQEQAEAFLREDI-AQVTA
ENLYS_BPB03       VPTEKYYTIGYGHY----GSDVHPCQ-------------VISEEKAEKLLRDDV-QEFVD
ENLYS_BPPZA       VPTEKHYTIGYGHY----GSDVSPRQ-------------VITAKQAEDMLRDDV-QAFVD
ENLYS_BPPH2       VPTEKHYTIGYGHY----GSDVSPRQ-------------VITAKQAEDMLRDDV-QAFVD
ENLYS_BPP22       --SRGIPTIGVGHTGKVDGNSVASGM-------------TITAEKSSELLKEDL-QWVED
LYS_BPLC2         VPWEQMYTIGWGHY------GVTAGT-------------TWTQAQADSQLEIDINNKYAP
LYS_BPPHV         VPWEQMYTIGWGHY------GVTAGT-------------TWTQAQADSQLEIDINNKYAP
Q333C0_9CAUD      --IAGIPTVCAGVT----GPDVVWGK-------------NYSNRECRKLLEKHI-QIHGK
B0FIH9_BPE32      --SAGIWTICVGATRDMNGYPVRQGL-------------TYSIEDCLALLDRDT-QDSVR
Q76H64_9CAUD      --VVGVLTVCYGHT----GKDIMPGK-------------TYTEAECKALLNKDL-ITVAR
Q7Y3V3_9CAUD      --NGGVWTICGGVT-RVDGKPVVKGM-------------KLTQTQCNSIDKAEQ-AKALL
C8CLH9_9CAUD      --IVGVWTVCYGHT----GADVVHGK-------------TYTQAECEALLQRDM-LEASG
A2I817_9CAUD      --GAGVPTAGVGST-----IGIVMGR-------------LYTDGEVAKMLAKDV-MIAEQ
Q3HQU9_9CAUD      --PIGIITACNGDT-----KDVRAGQ-------------RFTPDECRARLEQRL-IEHAE
                         *   *         :                   :  .               

ENLYS_BPKMV       IVLDAIKV-PLNVN----EQTALTFFC-YNVGP-VCTT-----------STAFKRFN---
LYS_BPP21         QINPYIKV-DIPET----MRGALYSLL-YNVGAGNFRT-----------STLLRKIN---
LYS_BPP1          CINQHFRGKDMPDN----AFSAMTSAA-FNMGCNSLRTYYSKARGMRVETSIHKWAQ---
LYS_BPPA2         QINPYIKV-DIPET----TRGPLYSFV-YNVGAGNFRT-----------STLLRKIN---
LYS_BPPS1         QINPYIKV-DIPET----TRGALYSFV-YNVGAGNFRT-----------STLLRKIN---
LYS_BPPS3         QINPYIKV-DIPET----TRGGIYSFV-YNVGAGNFET-----------STLLRKIN---
ENLYS_BPMU        AIDRLVRV-PLTPY----QKTALATFI-FNTGVTAFSK-----------STLLKKLN---
ENLYS_BPT1        YVDKKVKV-DIPVT----MRASLYSFT-FNVGTGAFGS-----------STMLKLIN---
LYS_BPN15         WVDRNIKV-PLTEP----QKAGIASFCPYNIGPGKCFP-----------STFYKRLN---
LYS_BPH19         WVEKNIKV-PLTDP----QKAGIASFCPYNIGPGKCFP-----------STFYRRIN---
LYS_BPHC1         CINTYFNGEKMNQG----QYDAMVSLA-FNVGCGNIKTYYSKTQGKRVATTIYRAAQ---
LYS_BP933         WVEKNIKV-PLTEP----QKAGIASFCPYNIGPGKCFP-----------STFYRRIN---
LYS_BPVT2         WVEKNIKV-PLTEP----QKAGIASFCPYNIGPGKCFP-----------STFYRRIN---
ENLYS_BPT4        GILRNAKLKPVYDSLDAVRRCALINMV-FQMGETGVAGF----------TNSLRMLQ---
LYS_BPAPS         LLNTQIKV-PLTQN----QYDAICSLV-FNIGMTAFTT-----------STLLKKLN---
ENLYS_BPB03       GVDKLLKV-DVTQS----QFDALVSFA-YNVGLGALKS-----------STLLQYLN---
ENLYS_BPPZA       GVNKALKV-SVTQN----QFDALVSFA-YNVGLGAFRS-----------SSLLEYLN---
ENLYS_BPPH2       GVNKALKV-SVTQN----QFDALVSFA-YNVGLGAFRS-----------SSLLEYLN---
ENLYS_BPP22       AISSLVRV-PLNQN----QYDALCSLI-FNIGKSAFAG-----------STVLRQLN---
LYS_BPLC2         MVDAYVKG-KANQN----EFDALVSLA-YN--CGNVFV-----------ADGWAPFS---
LYS_BPPHV         MVDAYVKG-KANQN----EFDALVSLA-YN--CGNVFV-----------ADGWAPFS---
Q333C0_9CAUD      YVEDAVTY-PIAPQ----TRAALISFS-YNVGGSSMRK-----------STAVRLIN---
B0FIH9_BPE32      ATQKNIKV-PLLVH----EFDALTSFN-FNVGSGALST-----------SKLRKVIN---
Q76H64_9CAUD      QINPYIKV-DIPET----TRGALYSFV-YNVGAGNFRT-----------STLLRKIN---
Q7Y3V3_9CAUD      WVQKNVYV-PLTEP----QKVGIASFCPWNIGPSKCFT-----------STFYRKLN---
C8CLH9_9CAUD      YVRRCITV-PMFPH----VEAALVSAT-FNIGPKVVCG-----------STLQRKAL---
A2I817_9CAUD      CLNRNVKV-DLNQG----EWDAYVSFV-FNVGCSAFVS-----------STTYRILNGVK
Q3HQU9_9CAUD      PVLKCTPSLKGHTY----QLAAAVSFA-YNVGSGAYCS-----------STTAKRFN---
                                              ::                   :          

ENLYS_BPKMV       QGRATEGC-QAL-------AMWNKVTING------QKVVSKGLVNRRNAEIKQC----LE
LYS_BPP21         QGDIKGAC-DQL-------RRWTYAGGKQ----------WKGLMTRREIEREIC----LW
LYS_BPP1          KGEWVNMC-NHL-------PDFVNSNGVP----------LRGLKIRREKERQLC----LT
LYS_BPPA2         QGDIKGAC-DQL-------RRWTYAGGKQ----------WKGLMTRREIEREVC----LW
LYS_BPPS1         QGDIKGAC-DQL-------RRWTYAGGKQ----------WKGLMTRREVERDVC----LW
LYS_BPPS3         QVDIKGAC-DQL-------RRWTYAGGKQ----------WKGLMTRREIEREVC----LW
ENLYS_BPMU        AGDYAGAR-DQM-------ARWVFAAGHK----------WKGLMNRREVE--MA----IW
ENLYS_BPT1        QRKHKEAC-NQL-------WRWVYYYNPKTK----KREVSRGIKNRRAEEYAYC----VK
LYS_BPN15         AGDRHGAC-EAI-------RWWIKDGGRDCRLTKGQKNGCYGQVERRDQESALT----CW
LYS_BPH19         AGDRRGAC-EAI-------RWWIKDGGRDCRI---RSNNCYGQVSRRDQESALA----CW
LYS_BPHC1         AENWILMC-NRI-------EDFNKSGGRV----------LKGLQNRRAKEKALC----LG
LYS_BP933         AGDRKGAC-EAI-------RWWIKDGGRDCRI---RSNNCYGQVSRRDQESALA----CW
LYS_BPVT2         AGDRKGAC-EAI-------RWWIKDGGRDCRI---RSNNCYGQVSRRDQESALA----CW
ENLYS_BPT4        QKRWDEAA-VNL-------------AKSI----------WYNQTPNRAKRVITTFRTGTW
LYS_BPAPS         VGDYSGAS-AEF-------MKWSKAKVNG------KRTPLPGLIKRRQAEKALF----ES
ENLYS_BPB03       AGNFQKAA-NEF-------LKWNKSGGKV----------YNGLVKRREQERTLF----LT
ENLYS_BPPZA       EGRTALAA-AEF-------PRWNKSGGKV----------YQGLVNRRAQEQALF----NS
ENLYS_BPPH2       EGRTALAA-AEF-------PKWNKSGGKV----------YQGLINRRAQEQALF----NS
ENLYS_BPP22       LKNYQAAA-DAF-------LLWKKAGKDP-----------DILLPRRRRERALF----LS
LYS_BPLC2         ----HAYCASMI-------PKYRNAGGQV----------LQGLVRRRQAELNLF----NK
LYS_BPPHV         ----HAYCASMI-------PKYRNAGGQV----------LQGLVRRRQAELNLF----NK
Q333C0_9CAUD      QGKVEQGC-KAL-------GLWNKATVNG------RKVVVKGLVNRRNEEIKLC----LS
B0FIH9_BPE32      -GEVKGDVYSEF-------LRWDKITVKG------EKQRSQGLHNRRVAEADLY----TE
Q76H64_9CAUD      QGDIKGAC-DQL-------RRWTYAGGKQ----------WKGLMTRREVERDVC----LW
Q7Y3V3_9CAUD      LGDRLGAC-AEI-------KRWIHDGGKDCRI---RSNNCYGQIERREQESELT----CW
C8CLH9_9CAUD      ANDWPGAC-AEL-------ARWKHAGGRG----------IRGLTLRRDDEQALCEGRILW
A2I817_9CAUD      PGTRIQAC-EAM-------GMWNKITVNG------VKVFSQGVYNRRIKDMALC----VK
Q3HQU9_9CAUD      SGDWKGAC-RALNEADNGRPQWVTAGGRV----------LPGLVKRRAEERALC----ER
                             :                                 .*             

ENLYS_BPKMV       PSSQYSSLLW--------------------------------------------------
LYS_BPP21         GQQ---------------------------------------------------------
LYS_BPP1          GLVNE-------------------------------------------------------
LYS_BPPA2         GQQ---------------------------------------------------------
LYS_BPPS1         GKQ---------------------------------------------------------
LYS_BPPS3         GQQ---------------------------------------------------------
ENLYS_BPMU        NIRGADDLRQ--------------------------------------------------
ENLYS_BPT1        EL----------------------------------------------------------
LYS_BPN15         EIDQ--------------------------------------------------------
LYS_BPH19         GIDR--------------------------------------------------------
LYS_BPHC1         E-----------------------------------------------------------
LYS_BP933         GIDR--------------------------------------------------------
LYS_BPVT2         GIDR--------------------------------------------------------
ENLYS_BPT4        DAYKNL------------------------------------------------------
LYS_BPAPS         A-----------------------------------------------------------
ENLYS_BPB03       GESKNVSRETSKPKTSKTNTHVVKKGDTLSEIAKKIKTSTKTLLELNPTIKNPNKIYVGQ
ENLYS_BPPZA       GTPKNVSRGTSSSKV--TPKYKVKSGDNLTKIAKKHNTTVATLLKLNPSIKDPNMIRVGQ
ENLYS_BPPH2       GTPKNVSRGTSSTKT--TPKYKVKSGDNLTKIAKKHNTTVATLLKLNPSIKDPNMIRVGQ
ENLYS_BPP22       ------------------------------------------------------------
LYS_BPLC2         PVSSNSNQNNQTGGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKL
LYS_BPPHV         PVSSNSNQNNQTGGMIKMYLIIGLDNSGKAKHWYVSDGVSVRHVRTIRMLENYQNKWAKL
Q333C0_9CAUD      GLQR--------------------------------------------------------
B0FIH9_BPE32      GKY---------------------------------------------------------
Q76H64_9CAUD      GKQ---------------------------------------------------------
Q7Y3V3_9CAUD      GLDE--------------------------------------------------------
C8CLH9_9CAUD      R-----------------------------------------------------------
A2I817_9CAUD      YM----------------------------------------------------------
Q3HQU9_9CAUD      GL----------------------------------------------------------
                                                                              

ENLYS_BPKMV       -----------------------------------------------------------
LYS_BPP21         -----------------------------------------------------------
LYS_BPP1          -----------------------------------------------------------
LYS_BPPA2         -----------------------------------------------------------
LYS_BPPS1         -----------------------------------------------------------
LYS_BPPS3         -----------------------------------------------------------
ENLYS_BPMU        -----------------------------------------------------------
ENLYS_BPT1        -----------------------------------------------------------
LYS_BPN15         -----------------------------------------------------------
LYS_BPH19         -----------------------------------------------------------
LYS_BPHC1         -----------------------------------------------------------
LYS_BP933         -----------------------------------------------------------
LYS_BPVT2         -----------------------------------------------------------
ENLYS_BPT4        -----------------------------------------------------------
LYS_BPAPS         -----------------------------------------------------------
ENLYS_BPB03       RINVGGSPVKSTLKYKIKRGETLTGIAKKNKTTVSQLMKLNPNIKNANNIYAGQTIRLK
ENLYS_BPPZA       TINVTGSGGKT---HKVKSGDTLSKIAVDNKTTVSRLMSLNPEITNPNHIKVGQTIRLS
ENLYS_BPPH2       TINVTGSGGKT---HKVKSGDTLSKIAVDNKTTVSRLMSLNPEITNPNHIKVGQTIRLS
ENLYS_BPP22       -----------------------------------------------------------
LYS_BPLC2         NLPVDTMFIAEIEAEFGRKIDMASGEVK-------------------------------
LYS_BPPHV         NLPVDTMFIAEIEAEFGRKIDMASGEVK-------------------------------
Q333C0_9CAUD      -----------------------------------------------------------
B0FIH9_BPE32      -----------------------------------------------------------
Q76H64_9CAUD      -----------------------------------------------------------
Q7Y3V3_9CAUD      -----------------------------------------------------------
C8CLH9_9CAUD      -----------------------------------------------------------
A2I817_9CAUD      -----------------------------------------------------------
Q3HQU9_9CAUD      -----------------------------------------------------------