CLUSTAL format seed alignment for MF_04134

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GT_LAMBD          MFLKTESFEHNGVTVTLSELSALQRIEHLALMKRQAEQAESDSNRKFTVEDAIRTGAFLV
G_LAMBD           MFLKTESFEHNGVTVTLSELSALQRIEHLALMKRQAEQAESDSNRKFTVEDAIRTGAFLV
GT_BPN15          MFLKSELLECNGSSVTLFQLSALQRIEHLEYLKQLEAVEVGDFQA--AITFTVKSGAYLV
G_BPN15           MFLKSELLECNGSSVTLFQLSALQRIEHLEYLKQLEAVEVGDFQA--AITFTVKSGAYLV
K7PHE1_9CAUD      ----MKLAREFGRPDWRAMLAGMSSTEYGDWKIFYQDNYFHDAQ----LDAHFSGLLYTI
M9NZA2_BPPH8      ------------------MLAGMTSSELGDWHQFYRDHYFQDAQ----LDAHFSELLYSI
Q687F4_9VIRU      ----------MGRADWRAMLAGMTSTEYADWRRFYCTHYFQDTQ----LDMHFSGLMYAV
K7PM17_9CAUD      MFLKSELLESNGSSVTLFQLSALQRIEYLEYLKQLEAVEAGDFQA--AITLTVKSGAYLV
M9NZD7_BPPH8      MFLKKEKFTWQTESLTIFELSALQRIEFLTFMAAEERAVSADSEG--ISDQEMTARLIGS
A5LH37_9CAUD      MQFVMRLAREFRRADWRRMLSEMSATELGEWGDYFRMQSFSDVW----MDAQFASLKALI
K7PH56_9CAUD      ------------------MLAGMTSSELGDWHLFYREHYFQDAQ----LDAHFSGLLYSI
Q687F5_9VIRU      MFLKTEQFEYNGVSVTLSELSALQRFDYIKFVSDAEQQETTKHDVVHINQRYLETASLLV
S5MQJ3_9CAUD      MFLKTEQFEYNGVSVTLSELSALQRFDYMKFVSDAAQQETTEHDAVHINQRYLETASLLV
S5MDP5_9CAUD      ----------MGRADWRAMLAGMTSTEYADWRRFYCTHYFQDTQ----LDMHFSGLTYAV
K7P6V0_9CAUD      ----MKLAREFGRPDWRAMLAGMSSTEYGDWKIFYQDNYFHDVQ----LDAHFSGLLYTI
E4WL32_BPPH8      MFSKKEKFTWQTESLTIFELSALQRIEFLTFMAAEERAVSADSEG--ISDQEMTARLIGS
K7PH46_9CAUD      MQFVMRLAREFRRADWRRMLSEMSATELGEWGDYFRMQSFSDVW----MDAQFASLKALI
Q9EYD9_9VIRU      MFLKTEQFEYNGVSVTLSELSALQRFDYIKFVSDAEQQETTKHDVVHINQRYLETASLLV
Q9EYE0_9VIRU      ----------MGRADWRAMLAGMTSTEYADWRRFYCTHYFQDTQ----LDMHFSGLMYAV
                                     *: :   :              .          .       

GT_LAMBD          A---------MSLWHNHPQKTQM-PSMNEAVKQIEQEVLTTWPTEAISHAENVVYRLSGM
G_LAMBD           A---------MSLWHNHPQKTQM-PSMNEAVKQIEQEVLTTWPTEAISHAENVVYRLSGM
GT_BPN15          A---------MSLWHGHPLKGSQGENAAAEVAKIQDEVMQTWPTELVAEAEYKVKLLSGM
G_BPN15           A---------MSLWHGHPLKGSQGENAAAEVAKIQDEVMQTWPTELVAEAEYKVKLLSGM
K7PHE1_9CAUD      S----------TLFFADP-----------ELTPDSFSILS---PVSE-------------
M9NZA2_BPPH8      S----------TLFFRDP-----------ELTPAHFSLLS--PSDSV-------------
Q687F4_9VIRU      L----------SLFFCDP-----------DMHPADFSLFA---PEAE-------------
K7PM17_9CAUD      A---------MSLWHGHALKGSQGENAAAEVEQIQDEVMQTWPTELVAEAEYKVKLLSGM
M9NZD7_BPPH8      NIRCGARLIAMSLWHNDPA--------GTDVETLYQQVLSGWPPEAIGKAEMEIKLLSGM
A5LH37_9CAUD      V----------RMVSGSS-----------DAAVADFSLLP--------------------
K7PH56_9CAUD      S----------TLFFRDP-----------ELTPAHFSLLS--PSESV-------------
Q687F5_9VIRU      A---------MSLWHSHSLKGTL-ASPETEMQQIRREVMLGWPADALNQATNRVLYLSGM
S5MQJ3_9CAUD      A---------MSLWHSHSLKGTL-ASPETEMQQIRREVMLGWPADALNQATNRVLYLSGM
S5MDP5_9CAUD      L----------SLFFCDP-----------DMHPADFSLFA---PEAE-------------
K7P6V0_9CAUD      S----------TLFFADP-----------ELTPDSFSILA---TAPE-------------
E4WL32_BPPH8      NIRCGARLIAMSLWHNDPA--------GTDVETLYQQVLSGWPPEAIGKAEMEIKLLSGM
K7PH46_9CAUD      V----------RMVSGSS-----------DAAVADFSLLP--------------------
Q9EYD9_9VIRU      A---------MSLWHSHSLKGTL-ASPETEMQQIRREVMLGWPADALNQATNRVLYLSGM
Q9EYE0_9VIRU      L----------SLFFCDP-----------DMHPADFSLFA---PEAE-------------
                              :    .                  .::                     

GT_LAMBD          ---YEFVVNNAPEQ-TEDAGPAEPVSAGKVFDGELSFALKLAREMGRPDWRAMLAGMSST
G_LAMBD           ---YEFVVNNAPEQ-TEDAGPAEPVSAGKCSTVS--------------------------
GT_BPN15          ---IAPVIDEPTSSGEERNEPAEPVTAGKALASELKFAMKLAREFGRPDWRAMLAGMSST
G_BPN15           ---IAPVIDEPTSSGEERNEPAEPVTAEKPSPVS--------------------------
K7PHE1_9CAUD      -----SIDVDEPDDD-TLMAKAAGISGGVRYGPDGSG-----------------------
M9NZA2_BPPH8      ---ISDD---EPDDD-TLMTAAEGITGGIRYGPAD-------------------------
Q687F4_9VIRU      -----EGQAETPDENDVLMQKAAGLAGGVRFGEEGRRL----------------------
K7PM17_9CAUD      ---IAPVTDDQAEPGEERNEPAEPVTAEKPSPVS--------------------------
M9NZD7_BPPH8      LVPVDEDNAADPDGS-TEAESAETVTAEKPLPAS--------------------------
A5LH37_9CAUD      -----EENGIPERTDEELMHLGEGISGGVRYGPDSQPGH---------------------
K7PH56_9CAUD      ---ISDD---EPDDD-TLMTAAEGITGGIRYGPAD-------------------------
Q687F5_9VIRU      ---LDNRHDADPEP-TGKTEATEPVTSKKHSKAS--------------------------
S5MQJ3_9CAUD      ---LDNRHDADPEP-TGKAEATEPVTSKKHSKAS--------------------------
S5MDP5_9CAUD      -----EGQADTPDENDVLMQKAAGLAGGVRFGEEGRRL----------------------
K7P6V0_9CAUD      -----PIDIDEPDDN-TLMAKAAGISGGVRYGPDGSR-----------------------
E4WL32_BPPH8      LVPVDEDNAADPDGS-TEAESAETVTAGKALASELKFVLNLAREFGRPDWRAMLAGMTSS
K7PH46_9CAUD      -----EENGIPERTDEELMHLGEGISGGVRYGPDSQPGH---------------------
Q9EYD9_9VIRU      ---LDNRHDADPEP-TGKTEATEPVTSKKHSKAS--------------------------
Q9EYE0_9VIRU      -----EGQAETPDENDVLMQKAAGLAGGVRFGEEGRRL----------------------
                                          ::.                                 

GT_LAMBD          EYADWHRFYSTHYFHDVLLDMHFSGLTYTVLSLFFSDPDMHPLDFSLLNRREADEEPEDD
G_LAMBD           ------------------------------------------------------------
GT_BPN15          EYGDWKIFYQDNYFHDAQLDAHFSGLLYTISTLFFADPELTPDSFSILSPAPEAIDIDDP
G_BPN15           ------------------------------------------------------------
K7PHE1_9CAUD      ------------------------------------------------------------
M9NZA2_BPPH8      ------------------------------------------------------------
Q687F4_9VIRU      ------------------------------------------------------------
K7PM17_9CAUD      ------------------------------------------------------------
M9NZD7_BPPH8      ------------------------------------------------------------
A5LH37_9CAUD      ------------------------------------------------------------
K7PH56_9CAUD      ------------------------------------------------------------
Q687F5_9VIRU      ------------------------------------------------------------
S5MQJ3_9CAUD      ------------------------------------------------------------
S5MDP5_9CAUD      ------------------------------------------------------------
K7P6V0_9CAUD      ------------------------------------------------------------
E4WL32_BPPH8      ELGDWHQFYRDHYFQDAQLDAHFSELLYSISTLFFRDPELTPAHFSLLSPSDSVISDDEP
K7PH46_9CAUD      ------------------------------------------------------------
Q9EYD9_9VIRU      ------------------------------------------------------------
Q9EYE0_9VIRU      ------------------------------------------------------------
                                                                              

GT_LAMBD          VLMQKAAGLAGGVRFGPDGNEVIPASPDVADMTEDDVMLMTVSEGIAGGVRYG
G_LAMBD           -----------------------------------------------------
GT_BPN15          DDDTLMAKAAGISGGVRYGPDGSR-----------------------------
G_BPN15           -----------------------------------------------------
K7PHE1_9CAUD      -----------------------------------------------------
M9NZA2_BPPH8      -----------------------------------------------------
Q687F4_9VIRU      -----------------------------------------------------
K7PM17_9CAUD      -----------------------------------------------------
M9NZD7_BPPH8      -----------------------------------------------------
A5LH37_9CAUD      -----------------------------------------------------
K7PH56_9CAUD      -----------------------------------------------------
Q687F5_9VIRU      -----------------------------------------------------
S5MQJ3_9CAUD      -----------------------------------------------------
S5MDP5_9CAUD      -----------------------------------------------------
K7P6V0_9CAUD      -----------------------------------------------------
E4WL32_BPPH8      DDDTLMTAAEGITGGIRYGPAD-------------------------------
K7PH46_9CAUD      -----------------------------------------------------
Q9EYD9_9VIRU      -----------------------------------------------------
Q9EYE0_9VIRU      -----------------------------------------------------