CLUSTAL format seed alignment for MF_04140

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FEN_BPT5              ---MSKSWGKFIEEEEAEMASRRNLMIVDGTNLGFRFKHNN---SKKPFASSYVSTIQSL
A0A1S6KUW7_9CAUD      --MSTKSWKQIRDEEVAEFESRNNLVVIDLVNIAHRVSQNIK--DGKAFARKLLEDIKRF
A0A385E4P9_9CAUD      ---MMQGWELPKKDERK---TGKNLLIVDGFNLAFRWKHKG----QSEFATDYLKTVNSL
A0A2H5BGC6_9CAUD      ----MNMWDMATEQAMI---PKNNLLIVDGLNLAFRYKHRG----TNDFAADYVKTINSL
I7J3U8_9CAUD          ---MSKSWGKFIEEEEAELASRRNLMIVDGTNLGFRFKHNN---SKKPFASNYVSTIQSL
A0A0N9BA99_9CAUD      ----MNMWDMATEQAMI---PKNNLLIVDGLNLAFRYKHRG----TSDFAADYVKTINSL
F8WQ40_9CAUD          MRLLIDANNIAYRADKTQHLTTKQGESVGAIYGVIQMLNSYVKPSDSTYKNHIMDALKPY
A0A2H4PRH1_9CAUD      ----MSSWTKMLSTELV----GDNLLIVDMMNFSRSISSAS---SVEDFAKKLETSIRSF
A0A1V0DZG6_9CAUD      ---MSKSWGKFIEEEEAEMASRRNLMIVDGTNLGFRFKHNN---SKKPFASSYVSTIQSL
A0A2H4PH52_9CAUD      ---MSKSWGTMKREAEQRLASRRNLMIVDGTNLGFRFKKD----SGKPIAASFANTINSL
                           .                 :   :.                 .         :.  

FEN_BPT5              AKSYSARTTIVLG--DKGKSVFRLEHLPEYKGNRDEKYAQRTEEEKALDEQFFEYLKDAF
A0A1S6KUW7_9CAUD      EKEYHGRKVIVLT--DKGKSSYRVALFPEYKDNRRKAREKRSEAEQRAQREWFSKLKEGI
A0A385E4P9_9CAUD      AKSYSCEDIVVLS--DHKGSYHRKELYEGYKGNR--DYSKQTEQEKEAAMEFFAGFDRTI
A0A2H5BGC6_9CAUD      AKSYHAREIVVLV--DYKGSWYRKDLHPKYKFDRKAKFADQTDEEKLAAEQFFEDFNKAI
I7J3U8_9CAUD          AKSYSARTTIVLG--DKGKSAFRLGLLPDYKGNREEKYALRSEEEKALDEQFFEYLRDAF
A0A0N9BA99_9CAUD      AKSYHAREIVVLV--DYKGSWYRKDLHPKYKFDRKAKFADQTEEEKLAAEQFFEDFNKAV
F8WQ40_9CAUD          VSDIEKGFTSVVTCWDVGKSAFRLKLYPDYKGQREIRRAEKTEEEKEEFRRLIEQMNILR
A0A2H4PRH1_9CAUD      AKSYSCGKVVLLS--DKGVSSYRKEILPEYKENRKKKREAMSEAQRAAEAEWFFMMRDAV
A0A1V0DZG6_9CAUD      AKSYSARTTIVLG--DKGKSVFRLEHLPEYKGNRDEKYSQRTEEEKALDEQFFEYLRDAF
A0A2H4PH52_9CAUD      ANSYDAKHTIVLG--DKGKSIFRTNIFPEYKGNRDAKYADRSEAEVEADRQFFEYLDDAF
                       ..       ::   *   * .*      ** :*       :: :     . :  :    

FEN_BPT5              EL-CKTTFPTFTIRGVEADDMAAYIVKLI--GHLYDHVWLISTDGDWDTLLTDKVSRFSF
A0A1S6KUW7_9CAUD      RI-VEETIKIFGYEGVEADDMAAVIVDQYSGTQLFDHIWLISTDGDWDLLLKDDVSRYSF
A0A385E4P9_9CAUD      DLITRSSMHLVRFTGIEADDFAAYLVMGLEG--VYDNIWLISTDKDWDELLSPKVHRFSY
A0A2H5BGC6_9CAUD      EL-CECNFTVIKLEGVEADDTAAYLVEEFENDDEFDHIWLISTDKDWDELLGEKVSRFSY
I7J3U8_9CAUD          DL-CETTFPTFTIRGVEADDMAAYIVKLI--GHLYDHVWLVSTDGDWDTLLTDQVSRFSF
A0A0N9BA99_9CAUD      EL-CECNFTVVKLEGVEADDTAAYFVEEFENDDEFDHIWLISTDKDWDELLGDKVSRFSY
F8WQ40_9CAUD          DSLPIFGVKSLSLPGWEADDLIYTTTQLS-----TEPCVVVSTDADMLQLVSENVFVWQP
A0A2H4PRH1_9CAUD      DS-LADTFPLFKYQDVEADDMAALITDWAIDGEHVEEVFLLSTDGDWDTFLRERVSRFAF
A0A1V0DZG6_9CAUD      EL-CETTFPTFTIRGVEADDMAAYIVKLI--GHLYDHVWLISTDGDWDTLLTDKVSRFSF
A0A2H4PH52_9CAUD      EL-IASQFPTFRIRGVEADDMAAFIIQLI--GHHYDHIWLISTDGDWDTLLAPNISRFSF
                             .  .   . ****               :   ::*** *   ::   :  :  

FEN_BPT5              TTRREYHLRD------MYEHHNVDDVEQFISLKAIMGDLGDNIRGVEGIGAKRGYNIIRE
A0A1S6KUW7_9CAUD      YTQREYKLKD------MYENSGVDTPEQLASLKALQGDRKDNIDGVEGVGTKRGYGLIRE
A0A385E4P9_9CAUD      ASRKEFFFNNGEEGCNFFDEHACDNPEQYVLMKCLKGDLSDGIRGVEGIGDKRAYSIIRN
A0A2H5BGC6_9CAUD      TTRKEYTLQN------FYEHHQCDTPDEYTSIKAIMGDPGDSVYGVGGIGAKRAYNLVRQ
I7J3U8_9CAUD          TTRREYHLRD------IYEHHNVDDVDQFISLKAIMGDLGDNIRGVEGIGAKRGYNIIRE
A0A0N9BA99_9CAUD      TTRKEYTMDN------FYEYHQCDTPDEYTSIKAIMGDPGDSVYGVGGIGAKRAYNLVRQ
F8WQ40_9CAUD          FKSVLYTLDN-------FEELTGVKKDVYLQMRTLVGDSSDNIPGIHGIGPKTAAKLLNE
A0A2H4PRH1_9CAUD      TTRKMFTIDN------MFEEHGADSPEQFALLKAIQGDLGDNIRGIDGVGKKRGYSVIRE
A0A1V0DZG6_9CAUD      TTRREYHLRD------MYEHHNVDDVEQFISLKAIMGDLGDNIRGVEGIGAKRGYNIIRE
A0A2H4PH52_9CAUD      TTRKEYHEKD------MFDNHNVDTVDQFISLKAIMGDMGDNIRGVEGIGEKRGYNLIRE
                       .   :   :       ::       :    :: : **  *.: *: *:* * .  ::.:

FEN_BPT5              FGNVLDIIDQLP-LPGKQKYIQNLNASEELLFRNLILVDLPTYCVDAIAAVGQDVLDKFT
A0A1S6KUW7_9CAUD      FGSALDIVEAIP-LPGKQAFIRKVNESAELIERNVQLVDLVSFSAEALAHAG--VYNKFV
A0A385E4P9_9CAUD      YDSLYELIDDLP-LPGKQKYIQNLNASEEILERNLMLMDLKTFSPEIIAE-NPEALEYVD
A0A2H5BGC6_9CAUD      YGDALTLATLLP-IEGKQKYIQELNKSEEKLILNTQLVDLRSFHKEAIAYPSPENLLYLE
I7J3U8_9CAUD          FGNVFDIVDQLP-LPGKQKYIQNLNASEDLMLRNLVLVDLPSYCVDAIAAVGQDVLDKFT
A0A0N9BA99_9CAUD      YGDALTLATLLP-IEGKQKYIQELNKSEEKLILNTQLVDLRSFHKEAIAYPSPENLLFLE
F8WQ40_9CAUD          YGSLEGIIKNHA-ELMKKKTTARIFENIEILDRNDALMNMNRIPFETIKPYVQEALEKEE
A0A2H4PRH1_9CAUD      FNSTAHFLDSIPDLVGSQKFICNIRDGQDIIERNLLLVDLRSFAYDALVHAG--VYDEFK
A0A1V0DZG6_9CAUD      FGNVLDIIDQLP-LPGKQKYIQNLNASEELLYRNLILVDLPTYCVDAIAAVGQDVLDKFT
A0A2H4PH52_9CAUD      HGSVLDIIDALP-LPGTQKFVQALNKSGELMERNLTLVDLPSFCGEAVAAAGQDIYDQFV
                      ...   :    .    .:     :  . : :  *  *:::     : :            

FEN_BPT5              KDILEIAEQ-------------------------
A0A1S6KUW7_9CAUD      EELEEIINA-------------------------
A0A385E4P9_9CAUD      NLIDTLTNQIHDSIDVEDISEL------------
A0A2H5BGC6_9CAUD      RICKNLRGTL------------------------
I7J3U8_9CAUD          KDILEIAK--------------------------
A0A0N9BA99_9CAUD      QICKNLRGNL------------------------
F8WQ40_9CAUD          SFDMKAVKKFLIRYQFVSILKYVKQMEQTFGKLS
A0A2H4PRH1_9CAUD      SRVYSEVFGE------------------------
A0A1V0DZG6_9CAUD      KDILEIAEQ-------------------------
A0A2H4PH52_9CAUD      KDIMAIATGEV-----------------------